Estatísticas da Wikilivros interlíngua

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiautoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20187   183 3,9        17
nov 20187   183 3,9        17
out 20187   183 3,9        17
set 20187   183 3,9        17
ago 20187   183 3,9        17
jul 20187   183 3,9        17
jun 20187   183 3,9        17
mai 20187   183 3,9        17
abr 20187   183 3,9        17
mar 20187   183 3,9        17
fev 20187   183 3,9        17
jan 20187   183 3,9 1      17
dez 20177   183 3,9        17
nov 20177   183 3,9 7      17
out 20177   183 3,8        17
set 20177   183 3,8        17
ago 20177   183 3,8        17
jul 20177   183 3,8        17
jun 20177   183 3,8 2      17
mai 20177   183 3,8        17
abr 2017711 183 3,8 98      17
mar 20176   183 3,3 1      7
fev 20176   183 3,3        7
jan 20176   183 3,3        7
dez 20166   183 3,3 1      7
nov 20166   183 3,3        7
out 20166   183 3,3        7
set 20166   183 3,3        7
ago 20166   183 3,3        7
jul 20166   183 3,3        7
jun 20166   183 3,3        7
mai 20166   183 3,3        7
abr 20166   183 3,3 1      7
mar 20166   183 3,3        7
fev 20166   183 3,3        7
jan 20166   183 3,3        7
dez 20156   183 3,3        7
nov 20156   183 3,3        7
out 20156   183 3,3        7
set 20156   183 3,3        7
ago 20156   183 3,3        7
jul 20156   183 3,3        7
jun 20156   183 3,3        7
mai 20156   183 3,3 4      7
abr 20156 1 183 3,2 18      7
mar 2015611 183 3,116449244,1 Mb215 k5451215155
fev 20155   181 320526 4,1 Mb205 k5451215155
jan 20155   181 320526 4,1 Mb205 k5451215155
dez 20145   181 32052614,1 Mb205 k5451215155
nov 20145   181 320526 4,1 Mb205 k5451215155
out 20145   181 320526 4,1 Mb205 k5451215155
set 20145   181 320526 4,1 Mb205 k5451215155
ago 20145   181 320526 4,1 Mb205 k5451215155
jul 20145   181 320526 4,1 Mb205 k5451215155
jun 20145   181 320526 4,1 Mb205 k5451215155
mai 20145   181 320526 4,1 Mb205 k5451215155
abr 20145   181 320526 4,1 Mb205 k5451215155
mar 20145   181 320526 4,1 Mb205 k5451215155
fev 20145   181 320526 4,1 Mb205 k5451215155
jan 20145   181 320526 4,1 Mb205 k5451215155
dez 20135   181 320526 4,1 Mb205 k5451215155
nov 20135   181 32052614,1 Mb205 k5451215155
out 20135   181 320526 4,1 Mb205 k5451215155
set 20135   181 320526 4,1 Mb205 k5451215155
ago 20135   181 320526 4,1 Mb205 k5451215155
jul 20135   181 320526 4,1 Mb205 k5451215155
jun 20135   181 320526 4,1 Mb205 k5451215155
mai 20135   181 320526 4,1 Mb205 k5451215155
abr 20135   181 320526 4,1 Mb205 k5451215155
mar 20135 1 181 32052654,1 Mb205 k5451215155
fev 20135   180 320526 4,1 Mb205 k5441215155
jan 20135   180 320526 4,1 Mb205 k5441215155
dez 20125   180 320526 4,1 Mb205 k5441215155
nov 20125   180 320526 4,1 Mb205 k5441215155
out 20125   180 320526 4,1 Mb205 k5441215155
set 20125   180 320526 4,1 Mb205 k5441215155
ago 20125   180 320526 4,1 Mb205 k5441215155
jul 20125   180 320526 4,1 Mb205 k5441215155
jun 20125   180 320526 4,1 Mb205 k5441215155
mai 20125   180 320526 4,1 Mb205 k5441215155
abr 20125   180 320526 4,1 Mb205 k5441215155
mar 20125   180 320526 4,1 Mb205 k5441215155
fev 20125   180 320526 4,1 Mb205 k5441215155
jan 20125   180 320526 4,1 Mb205 k5441215155
dez 20115   180 320526 4,1 Mb205 k5441215155
nov 20115   180 32052644,1 Mb205 k5441215155
out 20115   180 320526 4,1 Mb205 k5441215155
set 20115   180 32052614,1 Mb205 k5441215155
ago 20115   180 320526 4,1 Mb205 k5441215155
jul 20115   180 320526 4,1 Mb205 k5441215155
jun 20115   180 320526 4,1 Mb205 k5441215155
mai 20115   180 320526 4,1 Mb205 k5441215155
abr 20115   180 320526 4,1 Mb205 k5441215155
mar 20115   180 320526 4,1 Mb205 k5441215155
fev 20115   180 320526 4,1 Mb205 k5441215155
jan 20115   180 320526 4,1 Mb205 k5441215155
dez 20105   180 32052624,1 Mb205 k5441215155
nov 20105 1 180 32052654,1 Mb205 k5441215155
out 20105   177 320831 4,1 Mb205 k5801212155
set 20105   177 32083164,1 Mb205 k5801212155
ago 20105   177 32083064,1 Mb205 k5801212155
jul 20105   177 2,920832 4,1 Mb205 k6001212155
jun 20105   177 2,92083234,1 Mb205 k6001212155
mai 20105   177 2,92083234,1 Mb205 k6001212155
abr 20105   176 2,92083144,1 Mb205 k5991212155
mar 2010511 176 2,92083174,1 Mb205 k5991212155
fev 20104   176 2,92083134,0 Mb205 k5991212155
jan 20104   175 2,920830 4,0 Mb205 k5981212155
dez 20094   175 2,920830 4,0 Mb205 k5981212155
nov 20094   175 2,92083034,0 Mb205 k5981212155
out 20094   175 2,820830 4,1 Mb205 k5981212155
set 20094   175 2,820830 4,1 Mb205 k5981212155
ago 20094   175 2,820830 4,1 Mb205 k5981212155
jul 20094   175 2,820830 4,1 Mb205 k5981212155
jun 20094   175 2,82083014,1 Mb205 k5981212155
mai 20094   175 2,820830 4,1 Mb205 k5981212155
abr 20094   175 2,820830 4,1 Mb205 k5981212155
mar 2009411 17512,820830324,1 Mb205 k5981212155
fev 20093   159 2,921133 4,1 Mb205 k5821212154
jan 20093   159 2,92113314,1 Mb205 k5821212154
dez 20083   159 2,921133 4,1 Mb205 k5821212154
nov 20083   159 2,921133 4,1 Mb205 k5821212154
out 20083   159 2,921133 4,1 Mb205 k5821212154
set 20083   159 2,92113314,1 Mb205 k5821212154
ago 20083   159 2,921133 4,1 Mb205 k5821212154
jul 20083   159 2,921133 4,1 Mb205 k5821212154
jun 20083   159 2,92113314,1 Mb205 k5821212154
mai 20083   159 2,921133 4,1 Mb205 k5821222154
abr 20083   159 2,921133 4,1 Mb205 k5821222154
mar 20083   159 2,921133 4,1 Mb205 k5821222154
fev 20083   159 2,921133 4,1 Mb205 k5821222154
jan 20083   159 2,92113334,1 Mb205 k5821222154
dez 20073 1 159 2,920512124,1 Mb205 k5821222154
nov 20073 1 15612,99735463,0 Mb100 k4921222154
out 20073   127 3,14807 2,5 Mb32 k4081222154
set 20073   127 3,1480712,5 Mb32 k4081222154
ago 20073   127 3,1480722,5 Mb32 k40872154
jul 20073   126 3,2492332,5 Mb32 k40352144
jun 2007311 126 3,14807362,5 Mb32 k40872154
mai 20072   125 2,94808152,4 Mb32 k40872144
abr 20072   124 2,84808 2,4 Mb32 k40872144
mar 20072   124 2,84808 2,4 Mb32 k40872144
fev 20072   124 2,8480822,4 Mb32 k40872144
jan 20072   122 2,8497022,4 Mb31 k3782 24
dez 20062   122 2,8497032,4 Mb31 k3782 24
nov 20062   121 2,84847 2,4 Mb31 k377108 114
out 20062   121 2,84847 2,4 Mb31 k377108 114
set 20062   121 2,84847 2,4 Mb31 k377108 114
ago 20062   121 2,84847 2,4 Mb31 k377108 114
jul 20062   121 2,84847 2,4 Mb31 k377108 114
jun 20062   121 2,8484712,4 Mb31 k377108 114
mai 20062   121 2,8484712,4 Mb31 k377108 114
abr 20062   121 2,8484712,4 Mb31 k377106 114
mar 20062   121 2,84847372,4 Mb31 k377106 114
fev 20062   121 2,4449532,5 Mb25 k351106 114
jan 20062   120 2,4449422,4 Mb25 k350106 114
dez 20052   120 2,4449452,4 Mb25 k350106 114
nov 20052   120 2,4449412,4 Mb25 k350106 114
out 20052   120 2,4449422,4 Mb25 k350106 114
set 20052   119 2,44494 2,4 Mb25 k350106 114
ago 20052   119 2,4449462,4 Mb25 k350106 114
jul 20052   118 2,34494 2,4 Mb25 k350106 114
jun 20052   118 2,34494 2,4 Mb25 k350106 114
mai 20052   118 2,3449422,4 Mb25 k350106 114
abr 2005211111742,444932662,4 Mb25 k350106 114
mar 20051 1 4 2,2274624 kb911106 91
fev 20051   2 1,527422,5 kb911106 91
jan 20051      445 1,8 kb77 106 91
dez 20041      445 1,8 kb77 106 91
nov 20041      445 1,8 kb77 106 91
out 200411     44511,8 kb77 106 91
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiautoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiautores (usuários registrados)
A = Wikiautores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiautores que editaram pelo menos dez vezes desde que chegaram
C = Wikiautores que contribuíram cinco vezes ou mais este mês
D = Wikiautores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1  3  5  10  25  5  10  1  3  5  10  25  5 
dez 2018                   
nov 2018                   
out 2018             2     
set 2018                   
ago 2018                   
jul 2018             1     
jun 2018                   
mai 2018                   
abr 2018             1     
mar 2018             1     
fev 2018             1     
jan 20181                  
dez 2017      1      11    
nov 20171                  
out 2017                   
set 2017             1     
ago 2017      1            
jul 2017                   
jun 2017             2     
mai 2017      11111  111111
abr 201711111  1      211   
mar 20171                  
fev 2017             2     
jan 2017                   
out 2018             2     
jul 2018             1     
abr 2018             1     
jan 20181                  
out 2017                   
jul 2017                   
abr 201711111  1      211   
jan 2017                   
out 2016                   
jul 2016                   
abr 20161                  
jan 2016                   
out 2015      5      2    1
jul 2015      1      2     
abr 20151111   1    2221    
jan 2015      11     11    
out 2014             2     
jul 2014      1            
abr 2014             4     
jan 2014      1      31    
out 2013      2      411   
jul 2013             4     
abr 2013             2     
jan 2013             1     
out 2012      1      32    
jul 2012      1      2     
abr 2012      11     211   
jan 2012             1     
out 2011      1      3     
jul 2011      1      21    
abr 2011             211   
jan 2011             3     
out 2010             1     
jul 2010                   
abr 201011           21    
jan 2010      1      1111  
out 2009             1     
jul 2009             2     
abr 2009             211   
jan 2009             111   
out 2008      1      222   
jul 2008                   
abr 2008                   
jan 20081     2      2     
out 2007      2      2     
jul 2007                   
abr 2007      1      1     
jan 20071                  
out 2006                   
jul 2006                   
abr 2006                   
jan 20061            2     
out 2005                   
jul 2005                   
abr 20051111111              
jan 2005                   
out 20041                  

 

Distribuição de edições de artigos por wikiautores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiautoresEdições total
125100.0%563100.0%
3832.0%53995.7%
10624.0%52994.0%
32312.0%45480.6%
10014.0%31956.7%
31614.0%31956.7%

 

20 wikiautores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Josu Lavin~iawikibooksUC1319fev 27, 20055054dez 02, 20074046
Samuele2002UC298abr 16, 2017623abr 26, 2017613
McDutchieUC337fev 09, 20064707abr 16, 20151354
Carlos A. SantosUC428jun 03, 20074228jun 12, 20074219
Katxis100UC524mar 09, 20151392mar 13, 20151388
Peter KovacsUC623fev 25, 20103230dez 16, 20102936
Harleigh Kyson Jr.UC75nov 03, 20102979nov 04, 20102978
DanlishUC85mar 04, 20132127mar 05, 20132126
RudharUC93mai 08, 20151332mai 08, 20151332
MithridatesUC102fev 13, 20074338fev 13, 20074338
DerHexerUC112jan 14, 20084003jan 14, 20084003
JanwallsUC122nov 02, 20112615nov 02, 20112615
VituzzuUC132nov 07, 20112610nov 07, 20112610
LusitanusUC142nov 24, 2017401nov 24, 2017401
?UC151out 05, 20045199out 05, 20045199
Hégésippe CormierUC161jan 06, 20064741jan 06, 20064741
AhoerstemeierUC171ago 01, 20074169ago 01, 20074169
KorgUC181jun 07, 20083858jun 07, 20083858
MalafayaUC191set 09, 20083764set 09, 20083764
RotlinkUC201nov 07, 20131879nov 07, 20131879

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 142 edições foram feitas por usuários anônimos, de um total de 708 edições ( 20e %)
  


1 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
タチコマ robotUC13mai 08, 20151332jun 22, 2017556--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 20182003265 148 9       
nov 20182003265 148 9       
out 20182003265 148 9       
set 20182003255 148 9       
ago 20182003255 148 9       
jul 20182003255 148 9       
jun 20182003255 148 9       
mai 20182003255 148 9       
abr 20182003255 148 9       
mar 20182003255 148 9       
fev 20182003255 148 9       
jan 20182003245 148 9       
dez 20172003245 148 9       
nov 20172003225 148 9       
out 20172003225 148 9       
set 20172003225 148 9       
ago 20172003215 148 9       
jul 20172003215 148 9       
jun 20172003215 148 9       
mai 20172003215 148 9       
abr 20172003214 122 9       
mar 20171903214 120 9       
fev 20171903214 120 9       
jan 20171903194 120 9       
dez 20161903194 120 9       
nov 20161903194 120 9       
out 20161903194 120 9       
set 20161903194 120 9       
ago 20161903194 120 9       
jul 20161903184 120 9       
jun 20161903184 120 9       
mai 20161903184 120 9       
abr 20161903174 120 9       
mar 20161903174 120 9       
fev 20161903174 120 9       
jan 20161903174 120 9       
dez 20151903174 120 9       
nov 20151903144 120 9       
out 20151903144 120 9       
set 20151903144 113 9       
ago 20151903144 113 9       
jul 20151903144 112 9       
jun 20151903134 112 9       
mai 20151903134 112 9       
abr 20151903134 112 9       
mar 20151883123 112 8      24
fev 20151863123 16 6       
jan 20151863073 16 6       
dez 20141863053 16 6      1
nov 20141863053 16 6       
out 20141863033 16 6       
set 20141863023 16 6       
ago 20141862993 16 6       
jul 20141862973 16 6       
jun 20141862973 16 6       
mai 20141862973 16 6       
abr 20141862973 16 6       
mar 20141862943 16 6       
fev 20141862923 16 6       
jan 20141862893 16 6       
dez 20131862863 16 6       
nov 20131862863 16 6      1
out 20131862823 16 6       
set 20131862783 16 6       
ago 20131862633 16 6       
jul 20131862613 16 6       
jun 20131862583 16 6       
mai 20131862573 16 6       
abr 20131862563 16 6       
mar 20131862523 16 6      5
fev 20131852473 16 6       
jan 20131852413 16 6       
dez 20121852403 16 6       
nov 20121852343 16 6       
out 20121852343 16 6       
set 20121852303 16 6       
ago 20121852273 16 6       
jul 20121852243 16 6       
jun 20121852243 16 6       
mai 20121852193 16 6       
abr 20121852153 16 6       
mar 20121852083 16 6       
fev 20121852063 16 6       
jan 20121851973 16 6       
dez 20111851953 16 6       
nov 20111851923 16 6      4
out 20111851783 15 6       
set 20111851733 15 6       
ago 20111851693 15 6       
jul 20111851643 15 6       
jun 20111851563 15 6       
mai 20111851523 15 6       
abr 20111851493 15 6       
mar 20111851433 15 6       
fev 20111851423 15 6       
jan 20111851393 15 6       
dez 20101851373 15 6      2
nov 20101851363 15 6      5
out 20101821343  5 6       
set 20101821333  5 6      3
ago 20101821283  5 6      2
jul 20101821123  5 6       
jun 20101821123  5 6      3
mai 20101821023  5 6       
abr 20101811003  5 6      3
mar 2010181963  5 6      7
fev 2010181943  5 6      3
jan 2010180923  5 6       
dez 2009180813  5 6       
nov 2009180803  5 6      2
out 2009180793  5 6       
set 2009180783  5 6       
ago 2009180733  5 6       
jul 2009180733  5 6       
jun 2009180713  5 6       
mai 2009180703  4 6       
abr 2009180693  4 6       
mar 2009180613  4 6      14
fev 2009163593  3 6       
jan 2009163553  3 6       
dez 2008163553  3 6       
nov 2008163543  3 6       
out 2008163413  3 6       
set 2008163313  3 6      1
ago 2008163313  3 6       
jul 2008163293  3 6       
jun 2008163293  3 6      1
mai 2008163253  3 6       
abr 2008163243  3 6       
mar 2008163243  3 6       
fev 2008163172  3 6       
jan 2008163172  3 6      2
dez 2007163162  3 6      12
nov 2007160142  3 6      45
out 2007131142  3 6       
set 2007131132  3 6       
ago 2007131111  3 6      1
jul 200713081  3 6       
jun 200713081  3 6      28
mai 200712971  3 6       
abr 200712851  3 5       
mar 200712841  3 5       
fev 200712841  3 5      2
jan 200712631  2 5      1
dez 200612631  2 5       
nov 200612531  2 1       
out 200612531  2 1       
set 200612531  2 1       
ago 200612531  2 1       
jul 200612531  2 1       
jun 200612531  2 1       
mai 200612531  2 1       
abr 200612531  2 1       
mar 200612531  2 1       
fev 200612531  2 1      3
jan 200612421  1         
dez 200512421            
nov 2005124 1            
out 2005124 1            
set 2005123              
ago 2005123              
jul 2005122              
jun 2005122              
mai 2005122              
abr 2005121              
mar 20055              
fev 20053              
jan 20051              
dez 20041              
nov 20041              
out 20041              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2004: 1 1 Main Page

fev 2005: 1 1 Grammatica de Interlingua

mar 2005: 1 1 Le sonio del princessa

abr 2005: 1 1 Tosto Venetia non essera le sol citate con problemas de inundationes ra

mai 2005: 1 1 Pronunciation de Interlingua

jan 2006: 1 1 Main Page

fev 2006: 1 1 Historiettas e contos in interlingua

jan 2007: 1 1 Janua linguarum

fev 2007: 1 1 Turco/Lista de Phrases

jun 2007: 1 1 Apocalypse Capitulo 3

ago 2007: 1 1 Pagina principal

nov 2007: 1 1 Interlexico z

dez 2007: 1 1 Interlexico aqua

jan 2008: 1 1 Grammatica

jun 2008: 1 1 Pagina principal

set 2008: 1 1 Pagina principal

mar 2009: 1 1 Historiettas e contos in interlingua/Le Ranetto Promenante

nov 2009: 1 1 Breve Grammatica de Interlingua

fev 2010: 1 1 Historiettas e contos in interlingua/Le historietta que membros de Facebook scribe insimul

mar 2010: 1 1 Historiettas e contos in interlingua/Le historietta que membros de Facebook scribe insimul

abr 2010: 1 1 Historiettas e contos in interlingua/Le historietta que membros de Facebook scribe insimul

jun 2010: 1 1 Historiettas e contos in interlingua/Le historietta que membros de Facebook scribe insimul

ago 2010: 1 1 Historiettas e contos in interlingua/Le historietta que membros de Facebook scribe insimul

set 2010: 1 1 Historiettas e contos in interlingua/Le historietta que membros de Facebook scribe insimul

nov 2010: 1 1 Articulos de scientia/Extraterrestres e intelligentia artificial

dez 2010: 1 1 Historiettas e contos in interlingua/Le historietta que membros de Facebook scribe insimul

nov 2011: 1 2 Historiettas e contos in interlingua/Le Rossiniolo e le rosa

mar 2013: 1 1 Historiettas e contos in interlingua/Le episcopo embarassate

nov 2013: 1 1 Ido-espaniol

dez 2014: 1 1 Interlexico c

mar 2015: 1 1 Historia del litteratura italian/Copertura

abr 2015: 1 1 Libro Articulos de scientia/Extraterrestres e intelligentia artificial

mai 2015: 1 1 Historiettas e contos in interlingua/Le Rossiniolo e le rosa

abr 2016: 1 1 Pagina principal

dez 2016: 1 1 Etxepare

mar 2017: 1 1 Cinque theses a clavar ad le portas de Babel

abr 2017: 1 1 Exercitio 05

nov 2017: 1 1 Pronunciation de Interlingua

jan 2018: 1 1 Cinque theses a clavar ad le portas de Babel

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 31 de janeiro 2019 21:14 (final run)

Dump file iawikibooks-20190101-stub-meta-history.xml.gz (edits only), size 113 kb as gz -> 822 kb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sat-05/01/2019-16:14 after 2 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.