Estatísticas da Wikilivros inglês simplificado

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiautoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201853   495 10,1        137
nov 201853   495 10,1        137
out 201853   495 10,1        137
set 201853   495 10,1        137
ago 201853   495 10,1        137
jul 201853   495 10,1        137
jun 201853   495 10,1        137
mai 201853   495 10,1        137
abr 201853   495 10,1        137
mar 201853   495 10,1        137
fev 201853   495 10,1        137
jan 201853   495 10,1        137
dez 201753   495 10,1        137
nov 201753   495 10,1        137
out 201753   495 10,1        137
set 201753   495 10,1        137
ago 201753   495 10,1        137
jul 201753   495 10,1        137
jun 201753   495 10,1        137
mai 201753   495 10,1        137
abr 201753   495 10,1        137
mar 201753   495 10,1        137
fev 201753   495 10,1        137
jan 201753   495 10,1        137
dez 201653   495 10,1        137
nov 201653   495 10,1        137
out 201653   495 10,1        137
set 201653   495 10,1        137
ago 201653   495 10,1        137
jul 201653   495 10,1        137
jun 201653   495 10,1        137
mai 201653   495 10,1        137
abr 201653   495 10,1        137
mar 201653   495 10,1        137
fev 201653   495 10,1        137
jan 201653   495 10,1        137
dez 201553   495 10,1        137
nov 201553   495 10,1        137
out 201553   495 10,1        137
set 201553   495 10,1        137
ago 201553   495 10,1        137
jul 201553   495 10,1        137
jun 201553   495 10,1        137
mai 201553   495 10,1        137
abr 201553   495 10,1        137
mar 201553   495 10,1757 521 kb62 k65238334855137
fev 201553   495 10,1757 521 kb62 k65238334855137
jan 201553   495 10,1757 521 kb62 k65238334855137
dez 201453   495 10,1757 521 kb62 k65238334855137
nov 201453   495 10,1757 521 kb62 k65238334855137
out 201453   495 10,1757 521 kb62 k65238334855137
set 201453   495 10,1757 521 kb62 k65238334855137
ago 201453   495 10,1757 521 kb62 k65238334855137
jul 201453   495 10,1757 521 kb62 k65238334855137
jun 201453   495 10,1757 521 kb62 k65238334855137
mai 201453   495 10,1757 521 kb62 k65238334855137
abr 201453   495 10,1757 521 kb62 k65238334855137
mar 201453   495 10,1757 521 kb62 k65238334855137
fev 201453   495 10,1757 521 kb62 k65238334855137
jan 201453   495 10,17571521 kb62 k65238334855137
dez 201353   495 10,1758 522 kb62 k65238734855137
nov 201353   495 10,1758 522 kb62 k65238734855137
out 201353   495 10,1758 522 kb62 k65238734855137
set 201353   495 10,1758 522 kb62 k65238734855137
ago 201353   495 10,1758 522 kb62 k65238734855137
jul 201353   495 10,1758 522 kb62 k65238734855137
jun 201353   495 10,1758 522 kb62 k65238734855137
mai 201353   495 10,1758 522 kb62 k65238734855137
abr 201353   495 10,1758 522 kb62 k65238734855137
mar 201353   495 10,1758 522 kb62 k65238734855137
fev 201353   495 10,1758 522 kb62 k65238734855137
jan 201353   495 10,1758 522 kb62 k65238734855137
dez 201253   495 10,1758 522 kb62 k65238734855137
nov 201253   495 10,1758 522 kb62 k65238734855137
out 201253   495 10,1758 522 kb62 k65238734855137
set 201253   495 10,1758 522 kb62 k65238734855137
ago 201253   495 10,1758 522 kb62 k65238734855137
jul 201253   495 10,1758 522 kb62 k65238734855137
jun 201253   495 10,1758 522 kb62 k65238734855137
mai 201253   495 10,1758 522 kb62 k65238734855137
abr 201253   495 10,1758 522 kb62 k65238734855137
mar 201253   495 10,1758 522 kb62 k65238734855137
fev 201253   495 10,1758 522 kb62 k65238734855137
jan 201253   495 10,1758 522 kb62 k65238734855137
dez 201153   495 10,1758 522 kb62 k65238734855137
nov 201153   495 10,1758 522 kb62 k65238734855137
out 201153   495 10,1758 522 kb62 k65238734855137
set 201153   495 10,1758 522 kb62 k65238734855137
ago 201153   495 10,17581522 kb62 k65238734855137
jul 201153   495 10,1758 522 kb62 k65338734956137
jun 201153   495 10,1758 522 kb62 k65338734956137
mai 201153   495 10,1758 522 kb62 k65338734956137
abr 201153   495 10,1758 522 kb62 k65338734956137
mar 201153   495 10,1758 522 kb62 k65338734956137
fev 201153   495 10,1758 522 kb62 k65338734956137
jan 201153   495 10,1758 522 kb62 k65338734956137
dez 201053   495 10,1758 522 kb62 k65338734956137
nov 201053   495 10,1758 522 kb62 k65338734956137
out 201053   495 10,1758 522 kb62 k65338734956137
set 201053   495 10,1758 522 kb62 k65338734956137
ago 201053   495 10,1758 522 kb62 k65338734956137
jul 201053   495 10,1758 522 kb62 k65338734956137
jun 201053   495 10,1758 522 kb62 k65338734956137
mai 201053   495 10,1758 522 kb62 k65338734956137
abr 201053   495 10,1758 522 kb62 k65338734956137
mar 201053   495 10,1758 522 kb62 k65338734956137
fev 201053   495 10,17587522 kb62 k65338734956137
jan 201053 2 495 10,175745521 kb62 k65838734855137
dez 200953 1 493 1075516519 kb62 k65038334355137
nov 200953   491 1076132518 kb62 k64538134355137
out 200953410 487210,1761314513 kb61 k63437934355137
set 20094916 437 10,577099474 kb54 k58737830954111
ago 20094823 432 10,477082462 kb53 k58637829554110
jul 20094612 429 10,373044442 kb51 k58034327854105
jun 20094512 422 10,372842430 kb50 k57534227854105
mai 20094412 419 10,3723124425 kb49 k56034227454105
abr 20094322 417 10,173143421 kb50 k5573082715470
mar 20094113 416 10729114418 kb50 k5433082725470
fev 200940 2 410 9,8722106403 kb48 k5382422685369
jan 200940251401 9,8703316387 kb46 k4892012535366
dez 20083812 38719,3702114367 kb41 k4671902365162
nov 200837 21347 10,1680151328 kb39 k4421552075162
out 20083733 344 9,7660106319 kb36 k4411542064960
set 20083411 339 9,661427296 kb34 k401841704958
ago 200833 2 336 9,661437295 kb34 k401831704858
jul 200833 1 33319,561578292 kb33 k398781704756
jun 20083311 315 9,862037287 kb33 k398781684347
mai 20083216 31319,8622129285 kb33 k393751664346
abr 20083134 289110,260295253 kb30 k372741614244
mar 200828 3 270 10,560264240 kb29 k344741484244
fev 200828   261 10,660046234 kb28 k319711434044
jan 20082823 255 10,759178223 kb28 k319701344044
dez 20072614 245 10,860571218 kb27 k317691294042
nov 20072514 244110,6605167217 kb27 k317681264042
out 200724 1 215 11,260219192 kb24 k274671014041
set 200724 3 215 11,160173192 kb24 k274671014041
ago 200724141213 10,9604437191 kb24 k273671014041
jul 200723 5 210 960192192 kb24 k250701014040
jun 20072358220518,7583361183 kb22 k243691014038
mai 20071827 184 7,8555107155 kb19 k21365533515
abr 200716 1 181 7,357127154 kb19 k22666183815
mar 20071613 177 7,356561149 kb19 k22067183814
fev 200715 2 176 754755144 kb18 k22065173413
jan 20071524 167 7,155666138 kb17 k19765173413
dez 20061333 164 6,854576133 kb17 k19665163613
nov 200610 4 157 6,652597123 kb15 k19664153613
out 20061023 152 6,250199116 kb15 k17762142813
set 20068 1 150 5,645447107 kb13 k16658142713
ago 20068 3 147 5,444577102 kb12 k13958142713
jul 200684511434543742398 kb11 k13060132013
jun 20064 1 21 14,113212641 kb5,0 k5357131912
mai 2006413 20 13,610093836 kb3,4 k445513145
abr 20063   17 13,7921526 kb2,9 k43541354
mar 20063 1 17 13,49203126 kb2,9 k43541354
fev 2006311 14 14,19372622 kb2,5 k26521354
jan 20062   12 14,26873014 kb1,6 k15521343
dez 20052   10 14,118231228 kb3,7 k13521843
nov 20052   10 12,92188331 kb4,4 k1451653
out 20052   10 12,62186531 kb4,4 k1350653
set 20052   10 12,12187 31 kb4,4 k11496193
ago 20052   10 12,12187231 kb4,4 k11496193
jul 20052   10 11,91752426 kb3,6 k12496183
jun 20052 1 10 11,517511526 kb3,6 k12496183
mai 2005211 6 16,724383524 kb3,3 k8496173
abr 20051   2 32,59884223 kb3,3 k1106518 
mar 20051   2 31,59834 23 kb3,3 k1106518 
fev 20051   2 31,59834 23 kb3,3 k1106518 
jan 20051   2 31,59834 23 kb3,3 k1106518 
dez 20041   2 31,59834223 kb3,3 k1106518 
nov 20041   2 30,59750423 kb3,3 k1106518 
out 20041   2 28,58769 20 kb3,0 k1106 18 
set 20041   2 28,58769 20 kb3,0 k1106 18 
ago 20041   2 28,58769120 kb3,0 k1106 18 
jul 20041 1 2 2887691320 kb3,0 k1106 18 
jun 20041   1 4315721317 kb2,7 k   18 
mai 20041   1 4015469 17 kb2,6 k   18 
abr 20041   1 40154692617 kb2,6 k   18 
mar 20041   1 1416516818 kb2,8 k69  5 
fev 20041   1 616588 18 kb2,8 k73  3 
jan 20041   1 616588218 kb2,8 k73  3 
dez 20031   1 416566118 kb2,8 k72  3 
nov 20031   1 316566 18 kb2,8 k72  4 
out 20031   1 316566 18 kb2,8 k72  4 
set 200311  1 316566318 kb2,8 k72  4 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiautoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiautores (usuários registrados)
A = Wikiautores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiautores que editaram pelo menos dez vezes desde que chegaram
C = Wikiautores que contribuíram cinco vezes ou mais este mês
D = Wikiautores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  5  10  100  1  3  5  10  25  100  250  5  10 
dez 2018                         
nov 2018                         
out 2018                         
set 2018                         
ago 2018                1        
jul 2018                         
jun 2018                         
mai 2018                         
abr 2018                         
mar 2018                         
fev 2018                         
jan 2018                         
dez 2017                         
nov 2017                         
out 2017                         
set 2017                         
ago 2017                         
jul 2017                1        
jun 2017                         
mai 2017                         
abr 2017                         
mar 2017                1        
fev 2017                         
jan 2017                         
out 2018                         
jul 2018                         
abr 2018                         
jan 2018                         
out 2017                         
jul 2017                1        
abr 2017                         
jan 2017                         
out 2016                         
jul 2016                         
abr 2016                         
jan 2016                         
out 2015                       1 
jul 2015       1        2        
abr 2015             222       11
jan 2015       2                 
out 2014                         
jul 2014                         
abr 2014                         
jan 20141               1        
out 2013                         
jul 2013                         
abr 2013                         
jan 2013                         
out 2012                         
jul 2012                         
abr 2012                         
jan 2012                         
out 2011                         
jul 2011                         
abr 2011                         
jan 2011                         
out 2010                         
jul 2010                         
abr 2010                         
jan 20101062     81       19741     
out 200920111084   20118431   331713841 11
jul 20098221    3        112       
abr 20099321    741      1632    11
jan 20091675321   168552    34129542111
out 2008185321   1253      261072     
jul 200863111   11111    20641     
abr 200811742    4111     3196      
jan 20089332    1031      248211    
out 2007321     11       8        
jul 2007126531   8541     118652    
abr 20072111    1        622      
jan 20079643    53       421      
out 200663332   21111    82111    
jul 20069554311  2211     1053      
abr 20062      1        611      
jan 200621     3        31       
out 20051      2        211      
jul 20051               21       
abr 2005                         
jan 2005                211      
out 2004                2        
jul 2004211     1        1111     
abr 2004                         
jan 20041                        
out 2003                         

 

Distribuição de edições de artigos por wikiautores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiautoresEdições total
1257100.0%4,005100.0%
39737.7%3,75093.6%
105220.2%3,49687.3%
32259.7%3,03875.9%
10083.1%2,06351.5%
31631.2%1,33933.4%

 

20 wikiautores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
CromwelltUC1532fev 19, 20064697nov 15, 20093332
Microchip08UC2429mai 16, 20083880jan 20, 20103266
HSTutorials~simplewikibooksUC3378jul 14, 20064552jan 28, 20074354
Ezra KatzUC4213dez 25, 20064388nov 10, 20093337
PmlineditorUC5149ago 02, 20093437jan 19, 20103267
Isis~simplewikibooksUC6146jun 20, 20074211jul 20, 20083815
WikihermitUC7113jun 22, 20074209ago 29, 20074141
PxMa~simplewikibooksUC8103jun 23, 20074208jun 25, 20074206
Mike.lifeguardUC989mar 27, 20074296set 13, 20093395
JuliancoltonUC1089mai 18, 20093513out 21, 20093357
TempodivalseUC1176abr 10, 20093551nov 27, 20093320
XaniaUC1275dez 09, 20064404jan 25, 20103261
ThereenUC1375mar 22, 20083935dez 23, 20083659
Rozzychan~simplewikibooksUC1471nov 21, 20074057jun 18, 20093482
GrinktisUC1568dez 21, 20083661fev 04, 20093616
AbigorUC1662jan 02, 20093649jul 07, 20093463
Anonymous101UC1757abr 13, 20083913nov 07, 20083705
CookyStartsWithCUC1849jan 04, 20084013jun 23, 20083842
GrooveDogUC1947out 11, 20093367nov 10, 20093337
Purplebackpack89UC2044ago 30, 20093409jan 12, 20103274

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 910 edições foram feitas por usuários anônimos, de um total de 5000 edições ( 18e %)
  


9 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
ChenzwBotUC137mar 07, 20093585mar 07, 20093585--
Thjis!bot~simplewikibooksUC216ago 13, 20074157ago 14, 20074156--
HermesBot~simplewikibooksUC37ago 25, 20074145ago 25, 20074145--
CarsracBotUC47ago 26, 20093413nov 29, 20093318--
AbiBotUC56mar 13, 20093579mar 14, 20093578--
MaximillionBotUC64jan 18, 20093633jan 18, 20093633--
AEBotUC74mai 13, 20093518mai 13, 20093518--
TechBotUC83mar 16, 20093576mar 16, 20093576--
タチコマ robotUC91jul 09, 20083826jul 09, 20083826--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPng
dez 20186323251025434055111       113
nov 20186323251025434055111       113
out 20186323251025434055111       113
set 20186323251025434055111       113
ago 20186323251025434055111       113
jul 20186323251025434055111       113
jun 20186323251025434055111       113
mai 20186323251025434055111       113
abr 20186323251025434055111       113
mar 20186323251025434055111       113
fev 20186323251025434055111       113
jan 20186323251025434055111       113
dez 20176323251025434055111       113
nov 20176323251025434055111       113
out 20176323251025434055111       113
set 20176323251025434055111       113
ago 20176323251025434055111       113
jul 20176323251025434055111       113
jun 20176323251025434055111       113
mai 20176323251025434055111       113
abr 20176323251025434055111       113
mar 20176323251025434055111       113
fev 20176323251025434055111       113
jan 20176323251025434055111       113
dez 20166323251025434055111       113
nov 20166323251025434055111       113
out 20166323251025434055111       113
set 20166323251025434055111       113
ago 20166323251025434055111       113
jul 20166323251025434055111       113
jun 20166323251025434055111       113
mai 20166323251025434055111       113
abr 20166323251025434055111       113
mar 20166323251025434055111       113
fev 20166323251025434055111       113
jan 20166323251025434055111       113
dez 20156323251025434055111       113
nov 20156323251025434055111       113
out 20156323251025434055111       113
set 20156323251025433985111       113
ago 20156323251025433985111       113
jul 20156323251025433975111       113
jun 20156323241025433975111       113
mai 20156323241025433975111       113
abr 20156323241025433975111       113
mar 20156323241025433975111       113
fev 20156323241025433975111       113
jan 20156323221025433975111       113
dez 20146323221025433975111       113
nov 20146323221025433975111       113
out 20146323221025433975111       113
set 20146323221025433975111       113
ago 20146323221025433975111       113
jul 20146323221025433975111       113
jun 20146323221025433975111       113
mai 20146323221025433975111       113
abr 20146323221025433975111       113
mar 20146323221025433975111       113
fev 20146323221025433975111       113
jan 20146323221025433975111      1113
dez 20136323221025423975111       113
nov 20136323221025423975111       113
out 20136323221025423975111       113
set 20136323221025423975111       113
ago 20136323221025423975111       113
jul 20136323221025423975111       113
jun 20136323221025423975111       113
mai 20136323221025423975111       113
abr 20136323221025423975111       113
mar 20136323221025423975111       113
fev 20136323221025423975111       113
jan 20136323221025423975111       113
dez 20126323221025423975111       113
nov 20126323221025423975111       113
out 20126323221025423975111       113
set 20126323221025423975111       113
ago 20126323221025423975111       113
jul 20126323221025423975111       113
jun 20126323221025423975111       113
mai 20126323221025423975111       113
abr 20126323221025423975111       113
mar 20126323221025423975111       113
fev 20126323221025423975111       113
jan 20126323221025423975111       113
dez 20116323221025423975111       113
nov 20116323221025423975111       113
out 20116323221025423975111       113
set 20116323221025423975111       113
ago 20116323221025423975111      1113
jul 20116323221025423975111       113
jun 20116323221025423975111       113
mai 20116323221025423975111       113
abr 20116323221025423975111       113
mar 20116323221025423975111       113
fev 20116323221025423975111       113
jan 20116323221025423975111       113
dez 20106323221025423975111       113
nov 20106323221025423975111       113
out 20106323221025423975111       113
set 20106323221025423975111       113
ago 20106323221025423975111       113
jul 20106323221025423975111       113
jun 20106323221025423975111       113
mai 20106323221025423975111       113
abr 20106323221025423975111       113
mar 20106323221025423975111       113
fev 20106323211025423975111      2113
jan 20106323171025423975111      32113
dez 20096303071025423975111      9113
nov 20096283061025423975110      25113
out 20096242981015423975110      284113
set 2009548278875403895102      95113
ago 2009542269865403885102      72113
jul 2009534253855393845101      34113
jun 2009527249855393845101      32113
mai 2009524247855393835101      102113
abr 2009487236825283835100      32113
mar 2009486223825273835100      50113
fev 200947921478427377392      63112
jan 200946719778415375392      291112
dez 200844917560215355370      8211 
nov 200840917359215352370      12611 
out 200840415756215347363      9211 
set 200839714054215335363      1511 
ago 200839413453215326363      2911 
jul 200838912649215259354      7211 
jun 200836212648215250352      2811 
mai 200835911948215240352      9711 
abr 200833311344215220349      6811 
mar 200831410944215206349      4011 
fev 200830510143215194349      1211 
jan 20082999843215117349      5011 
dez 20072878940215114348      5211 
nov 20072868040215106348      11711 
out 20072567140215105348      1011 
set 20072567140215105348      6811 
ago 20072546539215102348      40411 
jul 2007250603821597347      8111 
jun 2007243523421589344      34511 
mai 2007199422121571332      8211 
abr 2007196362121567332      2011 
mar 2007191352121565332      4411 
fev 2007189312121565332      4411 
jan 2007180292121565332      5311 
dez 2006177292121564332      5811 
nov 2006170242111564330      54 1 
out 20061652321 1564330      75   
set 20061632221 1560326      38   
ago 20061602120 1559226      49   
jul 20061562117 1557226      412   
jun 2006331616 1557226      19   
mai 2006251511 1555225      34   
abr 200621144 1548124      2   
mar 200621134 1547124      27   
fev 200618114 1512123      24   
jan 200615104 1411123      5   
dez 20051394 1411123      7   
nov 20051361 149 23      1   
out 20051351 148 23      1   
set 20051331 148 23          
ago 20051331 147 23          
jul 20051331 147 22      1   
jun 20051331 146 22      6   
mai 2005931 144 20      17   
abr 20052   142            
mar 20052   142            
fev 20052   142            
jan 20052   142            
dez 20042   141            
nov 20042   81            
out 20042   81            
set 20042   81            
ago 20042   81            
jul 20042   81            
jun 20041                 
mai 20041                 
abr 20041                 
mar 20041                 
fev 20041                 
jan 20041                 
dez 20031                 
nov 20031                 
out 20031                 
set 20031                 

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2003: 1 1 First Aid

jan 2004: 1 1 First Aid

mar 2004: 1 2 First Aid

jul 2004: 1 2 Main Page

nov 2004: 1 1 First Aid

dez 2004: 1 1 First Aid

mai 2005: 1 2 Categories , 2 1 First Aid

jun 2005: 1 1 First Aid

jul 2005: 1 1 World History/Ancient Rome

out 2005: 1 1 First Aid

nov 2005: 1 1 First Aid

dez 2005: 1 2 Main Page , 2 1 World History/Ancient Rome

jan 2006: 1 1 English/Simple Sentences

fev 2006: 1 1 First Aid

mar 2006: 1 3 First Aid , 2 2 Chemistry/Content

abr 2006: 1 1 English/Simple Sentences

mai 2006: 1 3 Cookbook/Content/BLT Sandwich , 2 2 English/Introduction , 3 2 English/Differences between British English and American English , 4 2 Physics/Content , 5 1 First Aid

jun 2006: 1 2 Main Page , 2 1 First Aid

jul 2006: 1 4 Algebra I/Content/Introduction to Basic Algebra Ideas/Variables and Expressions , 2 3 First Aid , 3 3 Algebra I/Content/Introduction to Basic Algebra Ideas/The Ideas of Algebra , 4 3 Algebra I/Content , 5 2 Algebra I/Radical Expressions and Equations/Chapter Review , 6 2 Algebra I/Rational Expressions and Equations/Chapter Test , 7 2 Algebra I/Rational Expressions and Equations/Chapter Review , 8 2 Algebra I/Exponential Functions/Chapter Test , 9 2 Algebra I/Exponential Functions/Chapter Review , 10 2 Algebra I/Quadratic Functions/Chapter Test , 11 2 Algebra I/Quadratic Functions/Chapter Review , 12 2 Algebra I/Solving Quadratic Equations/Chapter Test , 13 2 Algebra I/Solving Quadratic Equations/Chapter Review , 14 2 Algebra I/Factoring/Chapter Test , 15 2 Algebra I/Factoring/Chapter Review , 16 2 Algebra I/Polynomials/Chapter Test , 17 2 Algebra I/Polynomials/Chapter Review , 18 2 Algebra I/Systems of Linear Equations/Chapter Test , 19 2 Algebra I/Systems of Linear Equations/Chapter Review , 20 2 Algebra I/Linear Inequalities/Chapter Test

ago 2006: 1 2 Algebra I/Content/Introduction to Basic Algebra Ideas/Variables and Expressions , 2 1 First Aid

set 2006: 1 2 English/Parts of Speech/Nouns/Proper Nouns , 2 2 Main Page , 3 1 Algebra I/Radical Expressions and Equations/The Distance Formula

out 2006: 1 2 Cookbook/Content , 2 2 Main Page , 3 1 Algebra I/Lines (Linear Functions)/Graph Lines (Linear Functions)

nov 2006: 1 4 World History/Ancient Rome , 2 2 Algebra I/Content/Introduction to Basic Algebra Ideas/Solving Equations Using Properties of Mathematics , 3 2 Algebra I/Content/Introduction to Basic Algebra Ideas/Variables and Expressions , 4 2 Algebra I/Content/Introduction to Basic Algebra Ideas/Order of Operations , 5 1 First Aid

dez 2006: 1 2 First Aid , 2 1 Cookbook/Pancake

jan 2007: 1 3 Algebra I/Content/Introduction to Basic Algebra Ideas/Variables and Expressions , 2 3 Algebra I/Content/Introduction to Basic Algebra Ideas/Order of Operations , 3 2 Cookbook/Hearty Beef Vegetable Soup

fev 2007: 1 2 Cookbook/Pancake , 2 2 Algebra I/Solving Equations/Solving Equations with Variables on Both Sides of the Equation

mar 2007: 1 2 Algebra I/Content/Introduction to Basic Algebra Ideas/Simple Operations , 2 1 Cookbook/Pancake

abr 2007: 1 1 Algebra I/Exponential Functions/Zero and Negative Exponents

mai 2007: 1 5 Main Page , 2 4 Animal Kingdoms/Content/Mollusks , 3 4 Animal Kingdoms/Content/Birds , 4 3 Physics/Content/Energy conservation at home , 5 3 Numbers/Content/What Are Numbers/Fractions , 6 3 Numbers/Content , 7 3 Cookbook/Content/Hamburger , 8 3 English/Differences between British English and American English , 9 1 First Aid

jun 2007: 1 5 First Aid , 2 3 Chemistry , 3 3 Biology/Content/Vertebrate , 4 3 Cookbook/Content/Cheese and Crackers , 5 3 Numbers/Content/What Are Numbers/Normal Numbers , 6 3 Numbers/Content/Using Numbers/Multiplying and Dividing , 7 3 Numbers/Content/Using Numbers/Order of Operations , 8 3 Numbers/Content/What Are Numbers? , 9 3 Numbers/Content/What Are Numbers/Bases , 10 3 Numbers/Content/What Are Numbers/The Number Line , 11 3 Animal Kingdoms/Content/Birds , 12 3 English/Table of contents , 13 2 World History/Ancient China , 14 2 WB:U , 15 2 Chess/Content/Playing The Game , 16 2 Chess/Content , 17 2 World History/Ancient Mesopotamia , 18 2 Chess , 19 2 Cookbook/Water

jul 2007: 1 3 First Aid , 2 3 Animal Kingdoms/Content/Mammals , 3 2 First Aid/How To Read This Book , 4 2 English/Parts of Speech/Articles , 5 2 English/Parts of the Sentence/Predicates , 6 2 Numbers , 7 2 Numbers/Content/What Are Numbers/Fractions

ago 2007: 1 4 Algebra I/Content , 2 3 Algebra I/Content/Working with Numbers/Subtracting Rational Numbers , 3 3 Algebra I/Content/Introduction to Basic Algebra Ideas/Exponents and Powers , 4 3 Algebra I/Content/For Contributors , 5 3 English/Idiomatic Phrases , 6 2 Algebra I/Content/Rational Expressions and Equations/Direct and Inverse Variation , 7 2 Algebra I/Solving Quadratic Equations/The Zero Product Property , 8 2 Algebra I/Polynomials/Multiplying Monomials , 9 2 Algebra I/Content/Working with Numbers/Distributive Property , 10 1 First Aid/How To Read This Book

set 2007: 1 3 First Aid , 2 2 First Aid/How To Read This Book

out 2007: 1 1 First Aid

nov 2007: 1 3 Cookbook/Content/Cheese and Crackers , 2 2 First Aid , 3 2 Biology/Systems/Reproductive System , 4 2 Biology/Systems/Senses , 5 2 World History/Cold War , 6 2 World History/European Union , 7 2 Physics/Content/What Physics is , 8 1 Cookbook/Pancake

dez 2007: 1 3 Cookbook/Horchata , 2 2 First Aid , 3 2 English/Parts of Speech/Verbs/Tenses/Future with 'going to' and 'will' , 4 2 Biology/Systems/Nervous System/Senses , 5 2 Biology/Systems/Digestive System , 6 2 Cookbook/Content/Apple Pie

jan 2008: 1 2 First Aid , 2 2 Physics/Astronomy/Planets , 3 2 Cookbook/Content/Ants on a log , 4 2 Algebra I/Rational Expressions and Equations/Simplifying Rational Expressions , 5 2 Cookbook/Content/Fruity Swirl

fev 2008: 1 1 First Aid

mar 2008: 1 2 Geology , 2 2 English/Spelling , 3 1 First Aid

abr 2008: 1 2 Physics/Astronomy/Planets/Saturn , 2 2 Physics/Astronomy/Planets/Jupiter , 3 1 First Aid/How To Read This Book

mai 2008: 1 3 Cricket , 2 2 Cookbook/Content , 3 1 Critical Thinking

jun 2008: 1 1 World History/China/The First Emperor of China

jul 2008: 1 2 English/Table of contents , 2 1 English/Appositives

ago 2008: 1 3 Cookbook/Sandwiches , 2 3 Cookbook/Water , 3 1 First Aid

set 2008: 1 1 Baseball

out 2008: 1 4 Algebra I/Content , 2 3 Main Page/Sandbox/1 , 3 3 Biology/Systems/Respiratory System , 4 3 How to learn a language , 5 2 Geology/Content/Inner Core , 6 2 Cookbook/Contents , 7 2 Algebra I/Polynomials/Exponents , 8 1 Critical Thinking

nov 2008: 1 2 Card Games , 2 2 Algebra I/Factoring/Squares of Binomials , 3 2 World History/Canada , 4 2 Main Page , 5 1 First Aid

dez 2008: 1 2 Japanese/Introduction , 2 1 Cookbook/Pancake

jan 2009: 1 2 Football/Content/Players , 2 2 Transport/Content , 3 2 Football/Content/Basics of the Game , 4 2 Football/Content , 5 2 Football , 6 2 World History/World War I , 7 2 Transport , 8 2 Piano/Fingering , 9 2 Piano/Reading Music , 10 2 Piano/Types of Pianos , 11 2 Piano , 12 2 Abacus/Manual/Quick use , 13 2 Abacus/Manual , 14 2 Abacus/Manual/Appearance , 15 2 Abacus/Cover , 16 2 Abacus , 17 2 Biology/Metabolism/Photosynthesis , 18 2 Main Page/Sandbox/3 , 19 1 Football/Players

fev 2009: 1 2 German/Contents , 2 2 Cookbook/Cheesy Chicken Pasta , 3 2 Cookbook/Pasta , 4 2 Cookbook/Basic Pancakes , 5 2 Cookbook/Scrambled eggs , 6 2 Card Games/Blackjack , 7 1 Cookbook/Pancake

mar 2009: 1 5 Cookbook , 2 2 How to learn a language , 3 1 German/Mathematics

abr 2009: 1 3 How to learn a language , 2 1 First Aid

mai 2009: 1 3 Cookbook , 2 2 Cookbook/Basic Pancakes , 3 2 Cookbook/Breakfast , 4 2 Cookbook/Apple Pie , 5 1 Cookbook:Shepherd's Pie

jun 2009: 1 2 Geology/Content/Crust , 2 2 Geology , 3 2 Animal Kingdoms , 4 1 First Aid

jul 2009: 1 2 PHP and MySQL Programming/Syntax Overview , 2 2 English/Idiomatic Phrases , 3 1 English/Word Functions/Subjects

ago 2009: 1 3 Chess/Content/Playing The Game , 2 3 How to learn a language , 3 3 World History/Contents , 4 2 American History , 5 2 World History/America/Civil War , 6 2 World History/America/Great Figures , 7 2 Chess/Content/Tactics

set 2009: 1 4 English/Parts of Speech/Nouns/Number , 2 3 French , 3 3 English/Parts of Speech/Adjectives , 4 2 English/Parts of Speech/Interjections , 5 2 French/Verbs/Present , 6 2 French/Verbs , 7 2 Transport/Content/Modes , 8 2 World History/World War I , 9 2 Abacus/Manual , 10 2 Physics/Newton/Third Law , 11 2 Biology/Systems/Skeletal System , 12 1 First Aid

out 2009: 1 3 Football , 2 3 Japanese/Parts of Speech/Pronouns , 3 3 Japanese/Hiragana , 4 2 Geology/Content/Outer Core , 5 2 Illegal Drugs , 6 2 WB:BOTS , 7 2 Cookbook/Pancake , 8 2 Weather/Content , 9 2 English/Parts of Speech/Verbs/Tenses/Continuous Tenses , 10 2 Cookbook/Bakery , 11 2 Cookbook/Banana bread , 12 2 Card Games/War , 13 2 Cookbook/Saute , 14 2 Cookbook/Stew , 15 2 Google Services And Products/Search , 16 2 PHP and MySQL Programming/Database Connectivity , 17 2 Japanese/Parts of Speech/Nouns/Numbers , 18 2 Japanese/Vocabulary , 19 2 Cricket , 20 2 PHP and MySQL Programming/Introduction to PHP , 21 1 Cricket/Equipment

nov 2009: 1 4 World History/Indus River Valley , 2 3 World History/Contents , 3 2 Cookbook/Contents

dez 2009: 1 1 Cookbook/Apple Parsnip Soup

jan 2010: 1 3 Main Page , 2 2 World History/America/Great Figures , 3 2 How to Start a Diary , 4 2 Cookbook/BLT Sandwich , 5 1 Card Games/Canasta

fev 2010: 1 1 How to Start a Diary

ago 2011: 1 1 Algebra I/Quadratic Functions/Using the Discriminant to Help Graph a Parabola

jan 2014: 1 1 Main Page

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 31 de janeiro 2019 21:14 (final run)

Dump file simplewikibooks-20190101-stub-meta-history.xml.gz (edits only), size 772 kb as gz -> 5.7 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sat-05/01/2019-16:15 after 6 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.