Estatísticas da Wikinotícias árabe

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2017
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 20170%   +1%   -65%      0%
jan 20170%   +5%   -26%      +2%
dez 20160%   +8%   -44%      +1%
nov 2016+5%   +12%          +1%
set 20160%   0%   -40%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 201765 4 3,2 k24,6 86      391
jan 201765 213,1 k54,6 245      391
dez 201665 113,0 k74,7 331      382
nov 2016653412,8 k105 590      379
out 201662 1 2,5 k 5,4 14      377
set 201662 2 2,5 k 5,4 52      377
ago 20166215 2,5 k15,3 86      377
jul 20166121 2,4 k15,4 44      376
jun 201659 1 2,4 k15,4 54      376
mai 201659 1 2,4 k 5,4 24      376
abr 20165913 2,4 k15,4 57      376
mar 201658 212,4 k25,5 157      375
fev 201658 212,3 k25,5 192      360
jan 201658 1 2,3 k 5,6 26      351
dez 201558 3 2,2 k 5,6 28      351
nov 201558 1 2,2 k15,6 52      351
out 201558 1 2,2 k 5,7 26      351
set 201558 4 2,2 k15,7 51      351
ago 2015581312,2 k15,7 918      350
jul 20155722 2,1 k15,4 53      348
jun 20155521 2,1 k15,4 60      348
mai 201553 1 2,1 k25,5 64      348
abr 201553 2 2,0 k15,6 59      346
mar 201553 1 2,0 k15,61624697,6 Mb548 k1,1 k70784,2 k346
fev 20155311 2,0 k15,71625517,6 Mb547 k1,1 k70784,2 k346
jan 20155222 1,9 k15,716251197,5 Mb546 k1,1 k70784,2 k345
dez 20145011 1,9 k 5,81629377,3 Mb543 k1,1 k70784,2 k344
nov 201449 1 1,9 k15,81629327,3 Mb542 k1,1 k70744,2 k344
out 201449   1,9 k 5,9162997,3 Mb543 k1,1 k74744,2 k344
set 201449   1,9 k 5,91629117,3 Mb543 k1,1 k74744,2 k344
ago 201449 1 1,9 k 5,91728167,6 Mb576 k1,1 k74744,2 k344
jul 20144913 1,8 k15,91729467,6 Mb575 k1,1 k73734,2 k344
jun 20144822 1,8 k 5,91733347,5 Mb572 k1,1 k737 4,2 k343
mai 20144612 1,8 k161735587,5 Mb571 k1,1 k737 4,2 k342
abr 20144523 1,8 k26,117451037,4 Mb569 k1,1 k737 4,2 k340
mar 20144311 1,7 k 6,31647286,9 Mb534 k1,1 k737 4,2 k340
fev 201442   1,7 k 6,31650246,8 Mb532 k1,1 k737 4,2 k340
jan 20144212 1,7 k16,31653396,8 Mb531 k1,1 k737 4,1 k337
dez 20134111 1,7 k 6,31659176,8 Mb528 k1,1 k737 4,1 k336
nov 20134011 1,7 k 6,31659196,8 Mb527 k1,1 k737 4,1 k336
out 20133913 1,7 k 6,31660466,8 Mb525 k1,1 k737 4,1 k335
set 201338 3 1,6 k 6,41661356,7 Mb524 k1,1 k737 4,1 k335
ago 2013381511,6 k16,416611686,7 Mb522 k1,1 k720 4,1 k335
jul 2013371311,6 k16,516571576,5 Mb512 k1,1 k686 4,0 k330
jun 201336 411,6 k16,516471916,4 Mb501 k1,1 k655 3,9 k328
mai 201336 111,5 k16,516321666,2 Mb486 k1,1 k614 3,8 k326
abr 2013361311,5 k16,616303546,1 Mb476 k1,1 k588 3,7 k324
mar 201335 111,5 k16,516292065,9 Mb461 k1,1 k515 3,6 k319
fev 2013351211,4 k16,516242635,8 Mb452 k1,1 k459 3,5 k315
jan 201334 111,4 k16,416183845,7 Mb439 k1,1 k409 3,4 k313
dez 201234 211,4 k16,316171905,5 Mb427 k1,1 k389 3,3 k307
nov 2012342211,3 k16,416142055,4 Mb415 k1,0 k353 3,2 k305
out 201232 211,3 k16,416187355,3 Mb409 k1,0 k344 3,1 k301
set 2012321411,2 k1616153235,1 Mb401 k1,0 k32013,0 k298
ago 201231 311,2 k15,916161565,0 Mb386 k99430312,9 k294
jul 2012311421,2 k2616133464,9 Mb374 k99030012,8 k289
jun 201230 311,1 k1616082184,6 Mb353 k97028912,6 k281
mai 2012301211,1 k1616092354,4 Mb339 k96328012,5 k272
abr 20122912 1,0 k16,11618744,3 Mb326 k95126712,4 k264
mar 201228 1 995 6,11615124,2 Mb320 k935264 2,3 k264
fev 20122812 987 6,11617244,2 Mb319 k935264 2,3 k264
jan 201227111980 6,216101094,2 Mb316 k935264 2,3 k264
dez 201126   978 6,11612594,1 Mb316 k935264 2,3 k264
nov 201126 1 978 61613204,1 Mb316 k93525912,3 k263
out 20112612 967 6,11612574,1 Mb314 k935259 2,3 k263
set 201125   954 6,11626224,1 Mb313 k934238 2,3 k254
ago 201125 1 948 6,11626194,1 Mb313 k934238 2,3 k254
jul 20112512 941 6,116283134,0 Mb313 k934238 2,3 k252
jun 20112412 93515,81601624,0 Mb313 k93424042,3 k245
mai 201123 3191725,915925263,9 Mb306 k84624042,3 k241
abr 20112312 84525,713371092,8 Mb232 k2,7 k24042,2 k238
mar 20112213278226,110795292,2 Mb176 k1,4 k24041,6 k238
fev 201121 1 708 6780141,5 Mb116 k199219 880226
jan 201121   700 6780121,5 Mb116 k199218 880226
dez 201021   700 6780121,5 Mb116 k199217 880226
nov 201021   699 677851,5 Mb115 k199218 880226
out 201021   698 677921,5 Mb115 k199216 880226
set 201021   698 677921,5 Mb115 k199215 880226
ago 201021   697 677981,5 Mb115 k199215 880226
jul 201021 1 692 6778111,5 Mb115 k199215 879226
jun 201021 2 689 6779411,5 Mb115 k199215 877225
mai 201021 1 682 6785481,4 Mb115 k194168 874224
abr 201021   674 6785121,4 Mb114 k193168 866222
mar 201021   673 678511,4 Mb114 k193169 865221
fev 2010211  673 6780111,4 Mb113 k193197 862221
jan 201020 1 671 6783121,4 Mb113 k192197 862221
dez 20092011 668 6783151,4 Mb113 k188197 859218
nov 200919   666 6784131,4 Mb113 k188194 858218
out 200919   664 6785281,4 Mb113 k188194 858217
set 20091913 659 67813821,4 Mb112 k188194 856217
ago 20091813 65215,57861611,4 Mb111 k18619121852210
jul 20091715162125,57932421,3 Mb106 k18417221821194
jun 200916 5 56715,67742031,2 Mb93 k18116420763165
mai 200916 3 54015,57661481,1 Mb88 k18214220728161
abr 20091638350455,67527721,0 Mb81 k17912526692154
mar 200913510236665,69001,3 k788 kb63 k166982755648
fev 2009822116524,81071247411 kb32 k158521034619
jan 20096   105 5,310732254 kb19 k1044892978
dez 20086   105 5,21073 255 kb19 k1044892978
nov 20086 1 105 5,2107319255 kb19 k1044892978
out 20086   98 5,410771229 kb19 k1034892978
set 20086 1 97 5,5107734226 kb19 k1034892978
ago 20086   96 5,211902224 kb17 k1034891278
jul 20086   96 5,11190 224 kb17 k1034891278
jun 20086   96 5,111903224 kb17 k1034891278
mai 20086   96 5,11190 224 kb17 k1034091278
abr 20086   96 5,111903224 kb17 k1034091278
mar 20086   95 5,11197 223 kb17 k1034081268
fev 20086   95 5,111971223 kb17 k1034081268
jan 20086   95 5,111971223 kb17 k1034081268
dez 20076 1 95 5,1119726223 kb17 k1034081268
nov 20076 1 91 5,1123430215 kb16 k30408927
out 20076   90 4,812092208 kb16 k30318917
set 20076   89 4,81209 207 kb16 k30318917
ago 20076   89 4,81209 207 kb16 k30318917
jul 20076 1 89 4,8120958207 kb16 k30318917
jun 20076   89 4,210392207 kb11 k30318987
mai 2007612 89 4,1103927207 kb11 k30318987
abr 2007512 7914,31145113189 kb10 k19318767
mar 2007411 57 4128859155 kb8,9 k7318134
fev 20073   57 312804152 kb9,4 k7278142
jan 20073   56 2,912693149 kb9,2 k5278142
dez 20063   54 312721141 kb9,0 k5278142
nov 20063   53 312721140 kb9,0 k5278142
out 20063   53 31272 140 kb9,0 k5278142
set 20063   53 312722140 kb9,0 k5278142
ago 20063   52 3126041137 kb8,7 k5279132
jul 20063   48 2,41319 116 kb9,0 k52710132
jun 20063   48 2,413194116 kb9,0 k52710132
mai 20063   46 2,513192114 kb9,0 k52710132
abr 20063   46 2,413194114 kb9,0 k52710132
mar 20063 1 46 2,3131411113 kb8,9 k52710132
fev 20063 1 43 2,2131514107 kb8,7 k52710122
jan 20063   41 212868101 kb8,3 k52710122
dez 2005332 3811,911157486 kb7,0 k11235182
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201712 11714317 10      18
out 201612 15 15 16 16      18
jul 201612515 15915 13      18
abr 20161258 15715 10      18
jan 201613 15 15 15 14      18
out 201513 14 15 15 14      18
jul 201513311 15715 12      18
abr 201513 12 151015 13      18
jan 2015133108151115111114151116181518
out 2014139178151115111714151116181518
jul 201413812915815111414141116181518
abr 201415510515315111114141116181418
jan 201415713815915111413141116181418
out 201315798151215111413141116181318
jul 2013168138151014111313141116181318
abr 2013151014815141410913141116181318
jan 2013151016816111310813141117181418
out 2012151013616111310413151117181418
jul 2012157841691410913151117181518
abr 20121591310161214101313151117181618
jan 201215111710151415151412141017181518
out 20111512151215141515161213917181418
jul 20111591491413131391212917181218
abr 201115915111391313141214616181218
jan 201115141813131513131815151416181518
out 20101491711131412121714151415181418
jul 201014121411131312121514151415171418
abr 20101410157131112121514151415171418
jan 20101411137131112121514151315171418
out 200914101510131212121414151315171418
jul 200914911813812121014151315141418
abr 2009146831341212515151315131518
jan 200915141510151312121615151315141517
out 200815121311151412121515151315141516
jul 200815111511151211111615151315141516
abr 2008157139151111111515151214141516
jan 200814111512141410101514141214141416
out 200714111310141210101314141314121414
jul 2007148118141010101014141314121414
abr 20071481171411991014141314121414
jan 2007141014101411991414141414121414
out 200614101361411881314141414121414
jul 200614101381410881314141414121414
abr 20061391281310771213131313111314
jan 2006121112101210771212121212101213
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  5  10  100  1000 
fev 2017175411    1131      111 20211       
jan 20171232111    1421      111 182211      
dez 201616311111   11211     111 1542111     
nov 201613743211   321      111 1643211 1   
out 2016511      71       111 20621       
set 201633211    911      11  105322      
ago 2016115531    165221    111 249722      
jul 201610311     52       111 1951        
jun 20161121      741      111 2342    11  
mai 2016921      111       111 15432       
abr 201643311    1143      111 229531      
mar 2016532211    82       111 184221      
fev 2016742111    411      111 226211      
jan 20164111     121       111 19211       
dez 2015733      92       111 1773        
nov 201593111    10        111 18332       
out 20156111     9111     111 164211  211 
set 20151554      1453111   111 2210421  31  
ago 201515633211111197422111111  3186221 1111
jul 201515322     73211        256111      
jun 201512311     63111        14441       
mai 2015122111    4            1621        
abr 20151352      71       222 1321    11  
mar 20151231      101       111 19421       
fev 201515311     102           257421      
jan 201514321     7311         2642        
jan 20171232111    1421      111 182211      
out 2016511      71       111 20621       
jul 201610311     52       111 1951        
abr 201643311    1143      111 229531      
jan 20164111     121       111 19211       
out 20156111     9111     111 164211  211 
jul 201515322     73211        256111      
abr 20151352      71       222 1321    11  
jan 201514321     7311         2642        
out 201471      3            931        
jul 20147432     73111        8532   1   
abr 201427932     2            1851    1   
jan 20148321     11           11422   11  
out 20138431     41           15511   11  
jul 2013633211 1  211      11  1143211 331 
abr 20131143311111 105411    111 21421111221 
jan 20137111111   3111     111 8321111221 
out 2012632211111183331    111 15533111332 
jul 2012844332    75443    11  2588632122  
abr 201263211    532      111 147531  11  
jan 2012221111             111 81111  11  
out 2011102221    32211        132         
jul 201183221 11132221    1   134221  111 
abr 201163222    3            1843    22  
jan 2011     11 11111    11  1133    22  
out 20102       1            121     32  
jul 2010411                   911        
abr 201021      51111    111 144     221 
jan 2010311      111111       83321      
out 200943   11 21111        83221  1   
jul 20091255441    114321        2384441 11  
abr 200915108533111 15753111      2698541 221 
jan 2009        4            1043        
out 20081       1            1352        
jul 2008                     7431       
abr 20081       1            51111      
jan 2008        3            41         
out 2007        2            631        
jul 200711111    11           52111      
abr 200722221 11 62222        733221 11  
jan 2007                                
out 2006                     1          
jul 2006                     31         
abr 2006        1            4          
jan 20065       2            2          

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1457100.0%11,653100.0%
312326.9%11,19596.1%
106414.0%10,86393.2%
32245.3%10,13787.0%
100112.4%9,19178.9%
31661.3%8,34371.6%
100051.1%7,95868.3%
316210.2%3,19927.5%

 

17 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Anassalama3UC5 01,0193033421nov 04, 201611560221--
CommonsDelinkerUC15 088126-set 16, 20092721----
TarawnehUC25+3316223-jan 02, 20064074143--
Fwaz malheUC45+171981-nov 14, 201610581--
Ah3kalUC69+3409831fev 02, 2016391----
Samer jabalUC123...4433fev 16, 20171111--
StrynUC140+393192ago 01, 2014941----
أ-ش-ر-فUC217...22--fev 10, 201717----
AymanAbdelMomenUC218...22--fev 23, 2017411--
أسامة الجباريUC219...2211fev 26, 2017111--
Bibicha madridistaUC451...1122fev 01, 20172611--
Nouari79UC452...1111fev 01, 20172611--
PicvuygUC453...1133fev 05, 20172211--
سلوى حلوىUC454...1144fev 10, 20171711--
Cilip2UC455...1111fev 11, 20171611--
مدينة نصر اليومUC456...11--fev 18, 2017911--
AlialbdareUC457...11--fev 23, 2017411--

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
PICAWNUC13,199abr 17, 20121777jul 04, 2014969
SeHUC21,416fev 14, 20092935jun 02, 20102462
Meno25UC31,256mar 22, 20073630dez 27, 201662
CiphersUC41,068fev 21, 20092928fev 20, 20131468
FPPUC6385abr 15, 2015684jul 29, 2016213
خلدون شنتوتUC7279mar 05, 20112186mai 10, 20112120
AzitonyUC8177jun 23, 20121710nov 13, 20131202
عباد ديرانيةUC9148mai 11, 20112119set 15, 20131261
Mo7amedsalimUC10142mar 02, 20092919ago 19, 20092749
روخوUC11102nov 18, 20092658jan 07, 20121878
وليد شرف الدينUC1297abr 24, 20112136mai 18, 20112112
محمد أحمد عبد الفتاحUC1390dez 21, 20073356mar 15, 2016349
OsamaKUC1489abr 02, 20073619dez 24, 20073353
براق سالمUC1681mar 23, 20092898mar 30, 20092891
عماد الدين المقدسيUC1780ago 05, 2015572dez 09, 2015446
IzoozoUC1874jul 15, 2016227set 08, 2016172
Mr. IbrahemUC1973mai 14, 20131385nov 19, 2015466
باسمUC2062fev 11, 20131477nov 14, 2015471
لا روساUC2157set 05, 20131271nov 13, 2015472
عدنان حليمUC2254jun 13, 2016259nov 10, 2016109

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 823 edições foram feitas por usuários anônimos, de um total de 14509 edições ( 5e %)
  


19 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
MenoBotUC11,157ago 30, 20092738jan 23, 20141131--
CipherBotUC2190mar 27, 20092894mai 05, 20112125--
XeBotUC3179mar 23, 20092898jul 18, 20092781--
YiFeiBotUC4139ago 09, 2015568set 09, 2015537--
AvocatoBotUC5117jul 28, 20112041jul 26, 20131312--
TrBotUC675mar 08, 20092913mar 15, 20092906--
OKBotUC736abr 03, 20073618dez 26, 200733511-
VolkovBotUC834abr 17, 20092873abr 15, 20131414--
SahimrobotUC931mai 20, 20112110mai 20, 20112110--
GrondinBotUC1022mai 17, 20092843out 31, 20131215--
MjbmrbotUC1115nov 12, 20102299mar 14, 20112177--
KamikazeBotUC1212dez 17, 20111899dez 18, 20111898--
AvicBotUC1310mar 29, 2016335jan 16, 201742--
タチコマ robotUC147fev 29, 20083286ago 23, 20131284--
JAnDbotUC154jun 13, 20131355ago 13, 2014929--
AlexbotUC162jun 06, 20083188jun 20, 20083174--
DorganBotUC171jun 07, 20083187jun 07, 20083187--
K.J.BotUC181jan 26, 20102589jan 26, 20102589--
AmirobotUC191mar 13, 20112178mar 13, 20112178--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPng
fev 20173,6 k8067485170738282,6 k44528     212
jan 20173,5 k7947465170738282,6 k44522     212
dez 20163,4 k7877445170737282,6 k44516     212
nov 20163,1 k7797435170735282,5 k44501     212
out 20162,9 k7727425170735282,4 k44490     212
set 20162,8 k7617425170735282,4 k44484     212
ago 20162,8 k7607405170728282,4 k44480     212
jul 20162,8 k7467155170712272,4 k44478     212
jun 20162,8 k7417145170712272,3 k44472     212
mai 20162,8 k7337055170710272,3 k44467     212
abr 20162,8 k7267045170709272,3 k44459     212
mar 20162,7 k7187005170709272,3 k44446     212
fev 20162,7 k7166965170708272,3 k43429     212
jan 20162,6 k7166945170705272,2 k43412     212
dez 20152,6 k7106925170703272,2 k43405     212
nov 20152,6 k7006925170700272,2 k43401     212
out 20152,5 k6956915170698272,2 k42388     212
set 20152,5 k6946905170689272,1 k42379     212
ago 20152,5 k6856885170688272,1 k42370     212
jul 20152,5 k6786765170682272,1 k42354     212
jun 20152,5 k6706705170666262,1 k42348     212
mai 20152,4 k6656635170665262,1 k42338     212
abr 20152,4 k6646595170665262,1 k42327     212
mar 20152,3 k6586585170665262,1 k42312    26212
fev 20152,3 k6516575170665262,1 k42301    38212
jan 20152,3 k6416555170660262,1 k41292    41212
dez 20142,2 k6306525170660262,1 k41276    18212
nov 20142,2 k6246495170659262,1 k41265    18212
out 20142,2 k6216485170659262,0 k41254    9212
set 20142,2 k6186485170657262,0 k41251    5212
ago 20142,2 k6116475170657262,0 k41247    10212
jul 20142,2 k6076465170655262,0 k41245    45212
jun 20142,2 k6056455170653262,0 k41241    33212
mai 20142,2 k6046445170653262,0 k41240    31212
abr 20142,1 k6026435170653262,0 k41240    72212
mar 20142,0 k5966425169653262,0 k41234    23212
fev 20142,0 k5926415169652262,0 k41233    23212
jan 20142,0 k5856335169652262,0 k41231    37212
dez 20132,0 k5786325169651262,0 k41230    16212
nov 20132,0 k5756315169651262,0 k41229    19212
out 20132,0 k5676305169650262,0 k41229    31212
set 20132,0 k5616295169650262,0 k41224    32212
ago 20132,0 k5456285169649262,0 k41221    160212
jul 20131,9 k5406275169646261,9 k41219    147212
jun 20131,9 k5346245169638251,9 k41219    188212
mai 20131,8 k5336235169630251,9 k41217    152212
abr 20131,8 k5306205167614251,8 k41214    317212
mar 20131,8 k5226165166585251,7 k41209    183212
fev 20131,7 k5116125161578251,7 k41207    253212
jan 20131,7 k5026105161564251,6 k41203    380212
dez 20121,7 k4986065159519251,5 k41198    189212
nov 20121,6 k4926005159505241,4 k41198    204212
out 20121,6 k4915975159498241,4 k41195    361212
set 20121,5 k4785805158424231,2 k41191    303212
ago 20121,5 k4665675155373221,2 k41185    156212
jul 20121,5 k4595595155358221,1 k40178    333212
jun 20121,4 k4515474153346211,1 k40171    213112
mai 20121,3 k4425444152333211,0 k40162    228112
abr 20121,3 k43554141523272094640153    72112
mar 20121,3 k42953741523262092338147    7112
fev 20121,3 k42753741523262092338147    21112
jan 20121,2 k41853741523262092238146    104112
dez 20111,2 k41353541522952091336146    2112
nov 20111,2 k40953541522952091336145    16112
out 20111,2 k39553541522942091336144    55112
set 20111,2 k38753541522942091336140    7112
ago 20111,2 k38053541522931991336138    17112
jul 20111,2 k37353541522911990036137    74112
jun 20111,2 k35853441522871987836135    37112
mai 20111,2 k34853441522851986536135    483112
abr 20111,1 k34453241522841885736134    104112
mar 20111,0 k33352841522841885235134    373112
fev 201193432951131522781884335132    10111
jan 201192632450831522781884335131     111
dez 201092631950731522771884335130    4111
nov 201092531450631522771884135127    1111
out 201092431150631522771884135124    2111
set 201092430750631522771884135122    2111
ago 201092330050631522771884135120    4111
jul 201091828350431522751884133116    9111
jun 201091428250431522741884033115    29111
mai 201090625750431522741883533107    38111
abr 201089625643031502731882733104    4111
mar 201089424742831502731882533102    1111
fev 20108942414263150273188253396    6111
jan 20108922324083150273188213393    11111
dez 20098862193903143269188203390    8111
nov 20098842143903143269188203388    7111
out 20098812123283143269188203383    12111
set 20098762122973143269188203278    55111
ago 20098622052661143269188163271    137  1
jul 20098152022621143264187963255    232  1
jun 20097321941911141258167722135    120  1
mai 20097011891901141253167561425    139  1
abr 20096581841331141250167331315    725  1
mar 20094141461321141203166801110    936  1
fev 2009184130571132175136009     239  1
jan 2009113116291132147101402        1
dez 200811311429113214710139         1
nov 200811311329113214610139      8  1
out 20081069829113214610139      1  1
set 20081058529113214610139      34  1
ago 20081048129112913810123      2  1
jul 20081047627110912610123         1
jun 20081047627110112610123         1
mai 2008104672714312610123         1
abr 2008104652713312610123      2  1
mar 2008103632712212510123         1
fev 2008103562712212510123         1
jan 2008103492712212510123         1
dez 2007103472712212510123      11  1
nov 200798402612212210123      28  1
out 200797402612212210120         1
set 200796392612211910120         1
ago 200796382612211910120         1
jul 200796362612211810120      58  1
jun 20079635261221051117      2  1
mai 200796352512260178      26  1
abr 200786292512142178      91  1
mar 20076124191151812      57  1
fev 2007591714131512      3  1
jan 2007581514131512         1
dez 2006561514131512         1
nov 2006551414131512         1
out 2006551414131512         1
set 2006551313131512         1
ago 2006541313131512         1
jul 2006501113131412         1
jun 200650913121411         1
mai 200648913121411         1
abr 200648913121411         1
mar 200648713121411      6  1
fev 20064571312141          1
jan 20064371212131          1
dez 2005407121213           1

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 3 الصفحة الرئيسية , 2 2 صدام حسين هل يدلي بصوته بالسجن اليوم؟ , 3 2 تحت شعار \"الدفاع عن الإسلام\" قمة مكة تختتم أعمالها , 4 1 خدام ينشق عن النظام البعثي السوري

jan 2006: 1 2 حماس تحصل على أغلبية الأصوات في الانتخابات التشريعية الفلسطينية

fev 2006: 1 1 أزمة الرسوم الكاريكاتورية المسيئة للنبي محمد

mar 2006: 1 1 الجيش الإسرائيلي يحاصر سجن أريحا لمدة 11 ساعة

fev 2007: 1 1 منتدى الحوار الأمريكي الإسلامي

mar 2007: 1 1 ضغوط أميركية لإقالة وزير الداخلية العراقي بعد فضيحة تعذيبه لمئات المعتقلين

abr 2007: 1 2 جنبلاط يدعو كل اللبنانيين لصد العدوان و تحرير الأرض , 2 2 بيان قمة مجلس التعاون الخليجي يحث سوريا على التعاون مع الأمم المتحدة , 3 1 آخر الأخبار/30 أبريل 2007

mai 2007: 1 2 آخر الأخبار/16 مايو 2007 , 2 1 مايو 2007

jun 2007: 1 1 بريطانيا ترفض عرضا إسبانيا لإدارة مطاراتها

jul 2007: 1 1 مقتل نائبين في انفجار مقهى البرلمان العراقي

nov 2007: 1 1 مؤسسة ويكيميديا من بين رواد تكنولوجيا المنتدى الاقتصادي العالمي 2008

dez 2007: 1 2 ديسمبر 2007 , 2 1 آخر الأخبار/22 ديسمبر 2007

abr 2008: 1 1 مايو 2007

ago 2008: 1 1 كوريا الشمالية توافق على تعطيل أهم مفاعل نووي

set 2008: 1 2 مصر تفتح معبر رفح للفلسطينين

out 2008: 1 1 مقتل يورج هايدر في حادث سير

nov 2008: 1 1 حزب التحرير: أمريكا لا تنتظر أكثر من ضربة قاضية تسدد لها حتى تسقط عن عرشها العالمي

fev 2009: 1 3 انفجار في حي الحسين بالقاهرة , 2 2 تحطم طائرة تركية في الأراضي الهولندية , 3 2 إيران على بعد خطوات من تشغيل محطة بوشهر النووية , 4 2 أوباما يلقي كلمة في الكونجرس ويعد بتغيير سياسي واقتصادي قريب , 5 2 اتصالات الجزائر تطلق خدمة موجات , 6 2 محكمة الجنايات الدولة ستصدر قرارها بشأن الرئيس السوداني عمر البشير , 7 2 جوجل تنفي أن تكون قد اكتشفت مدينة \"أطلانطس\" الأسطورية , 8 2 تصاعد اللهجة من جديد بين حركتي حماس و فتح , 9 2 ألمانيا تحدد شروطا لاستقبال معتقلين من غوانتنامو , 10 1 نوري المالكي يؤكد أن بإمكان قواته الحفاظ على الأمن في العراق

mar 2009: 1 3 السجن لضابط مصري بتهمة التعذيب حتى الموت , 2 3 مدعي الجنائية الدولية قدم معلومات مغلوطة عن دارفور , 3 3 مقتل أربعة في ضربة صاروخية في شمال غرب باكستان , 4 3 حماس تقول أنها استأنفت مفاوضات تبادل الأسرى , 5 3 انتهاء مواجهات أم الفحم و الإفراج عن رائد صلاح , 6 3 انتخابات اليابان قد تأتي بسياسات مناخية أكثر صرامة , 7 3 حزب العمل يصوت بالموافقة للانضمام إلى حكومة نتنياهو , 8 3 البابا يحث الزعماء الأفارقة على مساعدة المعوزين , 9 3 تحطم طائرة شحن قرب طوكيو , 10 3 إبطال مفعول قنبلة كانت في سيارة ملغمة في مركز تجاري في حيفا , 11 3 حزب التحرير يعقد ندوة سياسية في قلقيلية , 12 3 مزارعون في الأرجنتين يقيمون إضراب احتجاجا على الضرائب , 13 3 اصطدام لسفينتين حربيتين أمريكيتين في مضيق هرمز , 14 3 الاتحاد الأفريقي يحظر عضوية مدغشقر بسبب التوتر الحكومي هناك , 15 3 استعادة اللوحات المسروقة من قصر محمد علي , 16 3 اختطاف 4 عمال إغاثة في الصومال , 17 3 البرلمان الكويتي يستقيل من جديد والأمير يقبل بذلك , 18 3 انطلاق المنتدى العالمي للمياه في إسطنبول , 19 3 الإفراج عن 3 من منتسبي منظمة أطباء بلا حدود في دارفور , 20 3 اغتيال رئيس غينيا بيساو , 21 3 الصفحة الرئيسية , 22 2 دعوة الأسد للقادة العرب برفض اعتقال البشير , 23 2 البشير يتهم إسرائيل بدعم متمردي دارفور , 24 2 القذافي :الجنائية شكل جديد من \"الإرهاب الدولي\" , 25 2 مساندة البشير وتخفيف الانقسام بشأن إيران من أولويات قمة الدوحة

abr 2009: 1 3 استطلاع: غالبية الإسرائيليين يخفون هويتهم بالخارج , 2 3 مركبة \"سويوز\" تعود إلى الأرض بعد انتهاء مهمتها , 3 3 مسلح يقتل 13 شخصا بنيويورك وينتحر , 4 3 الصفحة الرئيسية , 5 2 معاناة التجمعات البدوية في فلسطين , 6 2 انطلاق تظاهرة بيروت عاصمة للكتاب العالمي , 7 2 إطلاق قناة سورية معارضة جديدة , 8 2 السعودية تعترف باستقلال كوسوفو , 9 2 نجاد يثير موجة من الاستياء في صفوف حضور مؤتمر العنصرية في جنيف إثر حديثه عن العنصرية التي تمارسها إسرائيل في فلسطين , 10 2 إطلاق الهند قمر صناعي للتجسس اشترته من إسرائيل , 11 2 سقوط طائرة صغيرة في فلوريدا , 12 2 الأمير نايف يقول أن تنشئة الجيل الصاعد على منهج أهل السنة حماية لهم من الأهواء , 13 2 كلينتون تدعو لرفع الحظر عن جزر كوبا , 14 2 مسلمو القدس يمنعون اليهود من اقتحام المسجد الأقصى , 15 2 العثور على تمثال قناع وجه يعتقد أنه لكليوباترا , 16 2 إسرائيل و الولايات المتحدة الأمريكية تقومان بإجراء مناورات جوية في ما يبدو أنه تحذير لإيران , 17 2 إيفو مورالس ينهي إضرابه عن الطعام بعد استجابة الكونجرس البوليفي لمطالبه حول قانون الانتخاب , 18 2 حركات و دعاة إسلاميون يحذرون من اقتحام المستوطنين للمسجد الأقصى غدا , 19 2 أبو الغيط يوجه اتهامات لإيران بالتآمر لاغتيال مبارك , 20 2 بدأ مؤتمر العلاقات السورية اللبنانية في دمشق , 21 2 \"سامي شهاب\" يعتذر من نصرالله على فشله , 22 2 أوراسكوم تعرض على أورانج آخر فرصة للاتفاق بشأن موبينيل , 23 2 المعارضة الجورجية تدعو إلى نقل التظاهرات إلى مبنى الرئاسة , 24 2 هجوم على سائح إسرائيلي في سيناء , 25 2 إيفو مورالس يدخل في إضراب عن الطعام

mai 2009: 1 3 بايدن في بيروت يربط استمرار الدعم بنتائج الانتخابات , 2 3 مصرع 99 شخصا بتحطم طائرة عسكرية أندونيسية , 3 2 سوريا تنفي إلغاء صفقة طائرات حربية روسية , 4 2 توقيف أربعة أشخاص حاولوا تنفيذ هجمات في نيويورك , 5 2 وزير العدل البريطاني قدم استقالته إثر فضيحة مالية , 6 2 استقالة إيتشيرو أوزاوا زعيم المعارضة اليابانية , 7 2 شافيز يهدد بانسحاب بلاده من منظمة الدول الأمريكية , 8 1 ويكي الأخبار

jun 2009: 1 4 منظمة الصحة العالمية تعلن تحول وباء إنفلونزة الخنازير إلى وباء عالمي , 2 3 مقتل وزير الأمن الصومالي في هجوم انتحاري , 3 2 تخصيص نصف مليار دولار لإعادة إعمار غزة , 4 2 منتخب الفراعنة يقهر أبطال العالم و يفجر مفاجأة من العيار الثقيل في كأس القرات , 5 2 الخطوط الجوية البريطانية تطلب من موظفيها العمل مجانا , 6 2 إنفلونزا الخنازير تودي بأول ضحاياها في المملكة المتحدة , 7 2 في مباراة مثيرة منتخب البرازيل يفوز على مصر بفرق هدف واحد , 8 2 قطر تتعادل مع اليابان في طوكيو , 9 2 نصر الله يعترف بهزيمة قوى المعارضة في الانتخابات النيابية في لبنان , 10 1 أسعار النفط تتراجع عن مستوى 70 دولار

jul 2009: 1 3 50 فيلما من 14 بلدا تتنافس في مهرجان الهواة , 2 3 حدوث أطول كسوف للشمس خلال القرن الواحد والعشرين , 3 3 محمد ولد عبد العزيز يفوز بالانتخابات الرئاسية الموريتانية بفارق كبير عن منافسيه , 4 3 تفجيرات تستهدف فندقين في جاكرتا وتخلف أكثر من 10 قتلى و50 جريحا , 5 3 صدور كتاب جديد في نقد عبد الوهاب المسيري , 6 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 7 2 آثار معبد جوبيتير تظهر أثناء ترميم أحد البيوت , 8 2 عدة أسئلة لا تزال من دون رد بعد شهر على رحيل مايكل جاكسون , 9 2 انطلاق الانتخابات الرئاسية والبرلمانية في إقليم كردستان العراق , 10 2 مايلي سايروس \"ممنوعة\" من الخضوع لعمليات التجميل , 11 2 شيرين تتفوق على فضل أمام 14 ألف متفرج قرطاجي , 12 2 الشرطة تقتحم عيادة طبيب جاكسون , 13 2 كارول سماحة بين المغرب ومصر ولبنان , 14 2 شمال و جنوب السودان يرحبون بقرار المحكمة الدولية حول أبيي , 15 2 حركة حماس تنتج أول فيلم سينمائي في قطاع غزة , 16 2 مصر تسجل أول حالة وفاة بإنفلونزا الخنازير , 17 1 إنفجار في مايوركا في إسبانيا يودي بحياة شرطيين

ago 2009: 1 4 ويكيبيديا الإنجليزية تتجاوز 3 ملايين مقالة , 2 2 إسكتلندا تطلق سراح عبد الباسط المقرحي لأسباب إنسانية , 3 2 المنتخب المصري لكرة اليد يحتل المركز الرابع في كأس العالم لكرة اليد للشباب , 4 2 الإعصار بيل يزيد قوة فوق الأطلنطي , 5 2 النائبة عن حزب الإينويت في البرلمان الدنماركي تطالب الحكومة بالاعتذار لجرينلاند , 6 2 افتتاح مهرجان الإسكندرية السنمائي بحضور عدد قليل من نجوم السينما , 7 2 اندلاع معركة بين جزائريين وصينيين في الجزائر العاصمة , 8 2 الإفراج عن الصحفيتين الأمريكيتين في كوريا الشمالية والإدارة الأمريكية تبارك جهود كلينتون , 9 2 تمساح بطول قدم يثير الرعب بين ركاب طائرة مصر للطيران , 10 1 سرقة حساب بنك الاحتياط الفيدرالي الأمريكي

set 2009: 1 4 1.9 مليون مواطن يترددون علي موائد الرحمن في مصر , 2 3 أدلة علي قتل مروة الشربيني عمدا، واستبعاد شبهة المرض النفسي , 3 2 المؤتمر التاسيسي لتشكيل ائتلاف العمل والإنقاذ الوطني , 4 2 انتقادات شعبية لأداء الحكومة البريطانية في أفغانستان , 5 1 وزير خارجية مصر يدعوا إسرائيل للقبول بحل الدولتين

out 2009: 1 1 استقبال حافل لأبطال أزرق الناشئين

nov 2009: 1 2 معرض الكتاب في الكويت والدور النسوي في تنمية البلد , 2 1 دورهنّ في تنمية الكويت

dez 2009: 1 1 المملكة العربية السعودية

jan 2010: 1 1 مؤتمر دولي لدعم اليمن في حربه ضد تنظيم القاعدة

fev 2010: 1 2 \"صفقة شاليط\" تنتهي بالفشل , 2 1 اعدام مدنين في نيجيريا

mar 2010: 1 1 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46

abr 2010: 1 1 ماستريو

mai 2010: 1 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 2 1 جوزيه مورينهو يوقع عقدا لتدريب ريال مدريد

jun 2010: 1 2 محكمة مصرية عليا تؤيد سحب جنسية متزوجو إسرائيليات , 2 2 استقالة رئيس الوزراء الياباني بعد تسعة أشهر من الحكم , 3 2 مهاجمة أسطول الحرية بواسطة البحرية الإسرائيلية

jul 2010: 1 2 سكر يستورد من اسرائيل ليهرب عبر المغرب ويباع في الجزائر , 2 1 حريق في فندق في السليمانية شمال العراق

ago 2010: 1 1 أغنية \"أحب طريقة كذبك\" تحطم رقم يوتيوب القياسي

set 2010: 1 1 الراسينغ الى نصف نهائي كأس النخبة للمرة الأولى

out 2010: 1 1 كاسترو يقلل من خطوات أوباما تجاه كوبا و يطالبه بالرفع النهائي للحصار

nov 2010: 1 1 تواصل محاكمة المتهم بمقتل الجندي ماجدا المقبولي في اليمن

dez 2010: 1 1 اختفاء الحزام الجنوبي لكوكب المشتري

fev 2011: 1 1 خلل في التنسيق بين إصداري مايكروسوفت أوفيس 2007 و2010

mar 2011: 1 2 أحداث يوم السبت 5/3/2011 م من ثورة 17 فبراير الليبية , 2 2 أحداث يوم الجمعة 11/3/2011 م من ثورة 17 فبراير الليبية , 3 2 أحداث يوم الثلاثاء 8/3/2011 م من ثورة 17 فبراير الليبية , 4 2 أحداث يوم الثلاثاء 1/3/2011 م من ثورة 17 فبراير الليبية , 5 2 أحداث يوم الإثنين 21/2/2011 م من ثورة 17 فبراير الليبية , 6 2 أحداث يوم الإثنين 14/3/2011 م من ثورة 17 فبراير الليبية , 7 2 أخبار زلزال اليابان 18-3-2011 22:00 , 8 1 أحداث يوم الأربعاء 9/3/2011 م من ثورة 17 فبراير الليبية

abr 2011: 1 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 2 1 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011

mai 2011: 1 4 أحداث يوم الخميس 28/4/2011 م من الاحتجاجات السورية 2011 , 2 3 أحداث يوم الجمعة 6/5/2011 م من الاحتجاجات السورية 2011 , 3 3 أحداث يوم الجمعة 29/4/2011 م من الاحتجاجات السورية 2011 , 4 3 أحداث يوم الأحد 8/5/2011 م من الاحتجاجات السورية 2011 , 5 3 أحداث يوم الأربعاء 23/2/2011 م من ثورة الشباب اليمنية , 6 3 شركة \"مايكروسوفت\" تشتري \"سكايب\" مقابل 8.5 مليار دولار , 7 2 ثورة الشباب اليمنية , 8 2 الاحتجاجات السورية 2011 , 9 2 ثورة 17 فبراير , 10 2 أحداث يوم السبت 9/4/2011 م من الاحتجاجات السورية 2011 , 11 2 أحداث يوم السبت 7/5/2011 م من الاحتجاجات السورية 2011 , 12 2 أحداث يوم السبت 30/4/2011 م من الاحتجاجات السورية 2011 , 13 2 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011 , 14 2 أحداث يوم السبت 23/4/2011 م من الاحتجاجات السورية 2011 , 15 2 أحداث يوم السبت 16/4/2011 م من الاحتجاجات السورية 2011 , 16 2 أحداث يوم الخميس 7/4/2011 م من الاحتجاجات السورية 2011 , 17 2 أحداث يوم الخميس 5/5/2011 م من الاحتجاجات السورية 2011 , 18 2 أحداث يوم الخميس 21/4/2011 م من الاحتجاجات السورية 2011 , 19 2 أحداث يوم الخميس 14/4/2011 م من الاحتجاجات السورية 2011 , 20 2 أحداث يوم الجمعة 8/4/2011 م من الاحتجاجات السورية 2011 , 21 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 22 2 أحداث يوم الجمعة 22/4/2011 م من الاحتجاجات السورية 2011 , 23 2 أحداث يوم الجمعة 15/4/2011 م من الاحتجاجات السورية 2011 , 24 2 أحداث يوم الثلاثاء 3/5/2011 م من الاحتجاجات السورية 2011 , 25 2 أحداث يوم الثلاثاء 26/4/2011 م من الاحتجاجات السورية 2011

jun 2011: 1 2 البيضاء (ليبيا) , 2 1 الاهلي يتوج بطلا لكاس السعودية

jul 2011: 1 3 انفجار وإطلاق رصاص في النرويج , 2 2 ملثمون يثيرون الذعر في العريش , 3 2 العثور على جثة من زلزل عرش ميردوخ , 4 2 شرف يعلن تشكيل الحكومة اليوم، وبقاء وزراء الثقافة والتربية والعدل والسياحة والداخلية , 5 2 حاخام يهودي يقول أن وجود الأقصى مسألة وقت والهيكل سيبنى , 6 1 ملثمون يثيرون الذعر فى العريش

ago 2011: 1 3 مقتل قائد المعارضة الليبية , 2 2 استشهاد ضابط ومجندين في إطلاق نار على الحدود المصرية الإسرائيلية , 3 1 صحيفة لي فيغارو الفرنسية:\" إيران قد أدارت ظهرها فعلاً للرئيس السوري بشار الأسد\"

set 2011: 1 1 وفاة النجل الأكبر لجمال عبد الناصر في بعد تدهور حالته بإحدى مستشفيات القاهرة

out 2011: 1 4 مقتل معمر القذافي , 2 2 وفاة ولي العهد السعودي الأمير سلطان بن عبد العزيز , 3 1 الولايات المتحدة الأمريكية تقطع مساعداتها المالية لليونسكو إثر منحها مقعداً لفلسطين

nov 2011: 1 1 الملاكم فراس زيداني من الناصرة يستعد للمشاركة في بطولة عالمية في المانيا

dez 2011: 1 1 1.9 مليون مواطن يترددون علي موائد الرحمن فى مصر

jan 2012: 1 1 مسيرة بميدان التحرير للمطالبة بالقصاص من قتلة الثوار

fev 2012: 1 1 الامم المتحدة: عدد القتلى المدنيين في سوريا \"أعلى بكثير من 7500

mar 2012: 1 2 التلفزيون السوري: سكان باب عمرو بدأوا العودة , 2 1 بوينج وايرباص ،،، تجدد أزمة الدعم

abr 2012: 1 2 نقل مكوك الفضاء «ديسكفري» إلى المتحف الجوي , 2 2 تحطم طائرة ركاب قرب مطار إسلام آباد , 3 1 حملة الدعاية الانتخابية تنطلق رسمياً في مصر

mai 2012: 1 3 مقتل أكثر من خمسين جندي في تفجير انتحاري بصنعاء , 2 2 41 قتيلا بسوريا ومهلة للنظام , 3 2 إعلان نتائج الانتخابات الرئاسية المصرية 2012 , 4 2 عشرات القتلى في مجزرة الحولة بسوريا , 5 2 النتائج غير الرسمية لانتخابات الرئاسة المصرية , 6 2 انطلاق انتخابات الرئاسة المصرية لأول مرة عقب ثورة 25 يناير وسقوط نظام حسني مبارك , 7 2 وفاة وردة الجزائرية , 8 2 الأردن تبعد 50 لاجئاً سورياً , 9 2 فرانسوا أولاند يتسلم رئاسة فرنسا من ساركوزي , 10 2 فرانسوا أولاند يتقدم على ساركوزي في النتائج المبدئية للانتخابات الرئاسية , 11 2 سكان الحدود التونسية يخترقون الحدود الجزائرية , 12 2 حزب التحرير: من يترقب الفرج من نتائج انتخابات العدو كمن يترقب الماء من النار , 13 1 ميدان السبعين 2012/5/21

jun 2012: 1 4 إعلان محمد مرسي رئيسًا لمصر , 2 3 صدور حكم على مبارك ووزير داخليته بالسجن المؤبد , 3 2 مسيرة شموع في الكرك , 4 2 الحكومة الأردنية تعتقل ناشطين سوريين , 5 2 وفاة السلحفاة العملاقة لونسام جورج , 6 2 تونس تسلم ليبيا رئيس الوزراء السابق , 7 2 فرار ثلاثة طيارين سوريين منشقين إلى الأردن , 8 2 محمد مرسي رئيسًا لجمهورية مصر العربية بعد الثورة , 9 2 الرئيس الأسد يشكل الحكومة السورية الجديدة برئاسة رياض حجاب , 10 2 طائرة مقاتلة تركية تختفي فوق المياه السورية , 11 2 أسانج يطلب اللجوء السياسي في سفارة الإكوادور بلندن , 12 2 الجيش الليبي يدخل بلدات غربي البلاد لوقف الاشتباكات , 13 2 النتائج غير الرسمية لجولة الإعادة في الانتخابات الرئاسية المصرية تظهر تقدم مرسي , 14 1 اليونسكو تضيف كنيسة المهد إلى قائمة التراث العالمي

jul 2012: 1 4 بدء الاقتراع بأول انتخابات ليبية منذ أكثر من نصف قرن , 2 3 تفجير مبنى الأمن القومي بدمشق يودي بحياة قادة أمنيين , 3 3 الرئيس المصري يعيد البرلمان المنحل , 4 2 تفاقم الأزمة بين بغداد وأربيل , 5 2 المرشح الجمهوري ميت رومني في إسرائيل وإيران على رأس المباحثات , 6 2 سيدا في أبو ظبي والمجلس الوطني يبحث تشكيل حكومة انتقالية , 7 2 أردوغان: من حق تركيا ملاحقة حزب العمال الكردستاني على الأراضي السورية , 8 2 واشنطن تتخوف من مجزرة في حلب , 9 2 الاتحاد الأوروبي: حزب الله ليس تنظيماً إرهابياً , 10 2 تركيا تستدعي قنصلها في حلب للتشاور , 11 2 بعد البوكمال، الجيش السوري الحر يسيطر على معبر ربيعة الحدودي بين سوريا والعراق , 12 2 جوبا تتهم الخرطوم بالاعتداء على أراضيها , 13 2 تمديد عمل بعثة المراقبيين في سوريا , 14 2 تعيين العماد فهد جاسم الفريج وزيرًا للدفاع السوري , 15 2 الحكومة السورية ترفع سعر زيت التدفئة (الديزل) , 16 2 الإمارات بدأت بشحن النفط بعيداً عن مضيق هرمز , 17 2 استمرار تهديد إيران بإغلاق مضيق هرمز , 18 2 الأركان التركية تستبعد أن المقاتلة أسقطها صاروخ سوري , 19 2 الإخوان المسلمون بالأردن يقاطعون الانتخابات البرلمانية , 20 2 أكثر من 200 قتيل في مجزرة التريمسة بسوريا , 21 2 هيومن رايتس واتش تشتبه باستخدام قنابل عنقودية في سوريا , 22 2 إيقاف التمويل الحكومي لعلاج اللاجئين في لبنان , 23 1 خلية طوارئ بالعراق لمساعدة اللاجئين السوريين

ago 2012: 1 3 انشقاق رئيس مجلس الوزراء عن نظام الأسد والمجلس الوطني يرحب , 2 3 اندلاع الاشتباكات الأعنف بين الجيشين السوري والأردني , 3 2 بورما تعلن إلغاء الرقابة على الإعلام , 4 2 سقوط طائرة مقاتلة للقوات الجوية السورية في المنطقة الشرقية , 5 2 إسرائيل توافق على طلب مصر بإدخال مروحيات قتالية إلى سيناء , 6 2 مجهولون يدمرون مسجداً بأمريكا , 7 1 الانتخابات العامة في أنغولا، والحزب الحاكم الأوفر حظاً

set 2012: 1 3 مقتل السفير الأمريكي في ليبيا بعد هجوم محتجين مسلحين على القنصلية في بنغازي , 2 3 سلسلة من التفجيرات في العراق تودي بحياة اكثر من 100 شخص , 3 3 «الحزب الكيبيكي» يفوز في الانتخابات البرلمانية العامة في ولاية كيبيك الكندية , 4 2 سيارة ذاتية القيادة في شوارع كاليفورنيا , 5 2 تايوان تدخل على الخط و تعمق الأزمة في الجزر المتنازع عليها بين الصين واليابان , 6 2 صدور مذكرات سلمان رشدي , 7 2 السجن 3 سنوات لأحمد نظيف بتهمة الكسب غير المشروع , 8 2 وفاة رائد الفضاء الأمريكي نيل آرمسترونغ عن 82 سنة , 9 2 الصفحة الرئيسية , 10 1 تركيا تهدد سوريا في حال تكرار النظام السوري تعديه على الحدود معها

out 2012: 1 3 انفجار في حي الأشرفية في قلب بيروت يوقع ثمانية قتلى على الأقل , 2 2 المعارضة الليتوانية تبدأ تشكيل الحكومة بعد فوزها في الانتخابات , 3 2 مقتل 41 شخصا على الأقل في تفجير انتحاري في مسجد في أفغانستان , 4 2 هيومن رايتس ووتش: قوات الأسد تستخدم الأسلحة العنقودية المحرمة دولياً , 5 2 جائزة نوبل للسلام يأخذها الاتحاد الأوروبي , 6 2 أمير الكويت يحل مجلس الأمة المعاد ويفتح الطريق لانتخابات برلمانية للمرة الثانية هذا العام , 7 2 البرلمان التركي يجيز التدخل العسكري في سوريا , 8 2 تفجيرات تهز حلب عاصمة سوريا الاقتصادية ووقوع أربعين قتيلاً , 9 2 مقتل قائد عمليات حزب الله في سوريا مع مجموعة من عناصره , 10 1 حكومة علي زيدان تنال ثقة المؤتمر الوطني العام الليبي

nov 2012: 1 3 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 تحطم طائرة عسكرية في صنعاء , 3 2 إسرائيل تقصف غزة , 4 2 خبراء يتوقعون ارتفاع معدلات الإصابة بسرطان الرئة بين النساء في بريطانيا , 5 2 الاتحاد الأوروبي يمنح مصر مساعدات بقيمة 6 مليار دولار , 6 2 فئران مدربة لضبط الممنوعات , 7 2 15 قتيلاً و80 جريحاً في تفجيرات في العراق , 8 1 الجمهوريون يعارضون تعيين سوزان رايس وزيرة للخارجية

dez 2012: 1 2 بارك كون هيه تفوز برئاسة كوريا الجنوبية , 2 2 إعلان الحداد في الولايات المتحدة بعد مجزرة نيوتاون , 3 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 4 2 الإعلان عن نتائج انتخابات الكويت , 5 1 هيلاري كلينتون في المستشفى إثر اشتباه إصابتها بخثرة دماغية

jan 2013: 1 3 صندوق النقد العربي يمنح السودان قرضاً لإجراء إصلاحات على القطاع المالي للحكومة , 2 2 حريق في ناد ليلي في البرازيل يقضي على أكثر من 200 شخص , 3 2 محمود عباس يوقع مراسيم باعتماد تسمية «دولة فلسطين» رسمياً , 4 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 5 2 النتائج الأولية للانتخابات الرئاسية في المكسيك , 6 1 الخارجية الإسرائيلية تسحب شريطاً دعائياً يظهر اختفاء قبة الصخرة

fev 2013: 1 5 تنحي بابا الكنيسة الكاثوليكية بندكت السادس عشر , 2 3 انفجار نيزك فوق مدينة تشيليابينسك بوسط روسيا , 3 3 تعيين خالد بن بندر أميرًا للرياض , 4 3 اغتيال المعارض التونسي شكري بلعيد : ترجيحات متعددة , 5 2 مقتل 19 شخصاً في سقوط منطاد في الأقصر من ارتفاع 300 متر , 6 2 فوز فيلم آرغو بجائزة أفضل فيلم في حفل الأوسكار لعام 2013 , 7 2 فوز نيكوس آناستاسياديس برئاسة قبرص , 8 1 البرلمان السلوفيني يسحب الثقة من الحكومة ويكلف ألينكا براتوشيك بتشكيل حكومة جديدة

mar 2013: 1 3 مقتل الشيخ سعيد رمضان البوطي و49 آخرين بينهم حفيده في تفجير انتحاري في دمشق , 2 3 الكردينال الأرجنتيني خورخه ماريو بيرغوليو يصبح أول بابا من خارج أوروبا باسم فرنسيس الأول , 3 2 سامسونج تعلن عن هاتفها الذكي الجديد جالكسي إس 4 , 4 2 تشافيز يعلن عن نكسة السرطان ويسمي خليفة محتملاً , 5 1 ميشيل دجوتوديا يقطع عهداً بتسليم السلطة في 2016

abr 2013: 1 4 وفاة رئيسة وزراء المملكة المتحدة السابقة مارغريت تاتشر , 2 3 مقتل شخصين وإصابة 22 آخرين في انفجارين قرب نهاية خط ماراثون بوسطن , 3 3 مادورو يفوز برئاسة فنزويلا بفارق طفيف، وكابريليس يطالب بإعادة فرز الأصوات , 4 3 ظهور فيديو يُظهر لحظة اغتيال محمد رمضان البوطي , 5 3 إيران تدشن مجمعات لمعالجة أكسيد اليورانيوم , 6 3 إسرائيل تواجه أكبر عمليَّة قرصنة إلكترونيَّة يشنها نشطاء فلسطينيّون , 7 2 الروائي الكويتي سعود السنعوسي يفوز بالجائزة العالمية للرواية العربية عن روايته «ساق البامبو» , 8 2 الجيش السوري الإلكتروني يتبنى مسؤولية نشر خبر كاذب عن إصابة أوباما بجروح , 9 2 القضاء الفرنسي يفتح تحقيقاً في تهمة تلقي ساركوزي تمويلاً غير قانوني من القذافي , 10 1 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليام ألكسندر

mai 2013: 1 2 مقتل 46 في انفجار سيارتين في تركيا والقبض على 9 مشتبه بهم , 2 2 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليم ألكساندر , 3 2 وفاة الأسير الفلسطيني ميسرة أبو حمدية في مستشفى سوروكا الإسرائيلي , 4 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 5 1 مجلس الأمن يضم «جبهة النصرة لأهل الشام» إلى قائمة المنظمات الإرهابية

jun 2013: 1 3 أمير قطر يسلم السلطة لنجله , 2 2 اكتشاف ستة كواكب منها ثلاثة على الأقل صالحة للسكنى , 3 2 رفض محكمة فرنسية ادعاء التلاعب في شريط استشهاد الطفل محمد الدرة , 4 2 الجيش اللبناني يعلن سيطرته على مسجد بلال بن رباح والمربع الأمني للشيخ أحمد الأسير , 5 2 إشتباكات مسلحة بين الجيش اللبناني وأنصار الشيخ أحمد الأسير وعناصر من حزب الله , 6 2 بشار الأسد يصدر مرسومين بزيادة رواتب العاملين المدنيين والعسكريين ومعاشات المتقاعدين , 7 2 ديلما روسيف تعد بالإصلاحات ومكافحة الفساد استجابةً للاحتجاجات

jul 2013: 1 3 قطاع غزة يترنح بعد إغلاق مصر 80% من الأنفاق , 2 2 استئناف المفاوضات الفلسطينية الإسرائيلية , 3 2 العثور على تمساح نيل يافع في نهر بيروت , 4 2 توقيف المرافق الشخصي للشيخ أحمد الأسير , 5 2 العثور على مقابر جماعية لمقاتلي حزب الله في سوريا , 6 2 الأمير ويليام وزوجته الأميرة كيت يُرزقان بمولود ذكر , 7 2 علماء آثار إسرائيليّون يعتقدون باكتشافهم قصر النبي داود , 8 2 انفجار في موكب تابع لحزب الله على طريق بيروت-دمشق الدولية , 9 2 بنما توقف سفينة كورية شمالية للاشتباه بنقلها مكونات صواريخ , 10 2 تعيين محمد البرادعي رئيسًا للوزراء في مصر

ago 2013: 1 3 مجزرة كيميائية مُسنَدَة إلى القوات النظامية السورية في غوطة دمشق , 2 3 وفاة الداعية الإسلامي الكويتي عبد الرحمن السميط , 3 2 وزير الدفاع البريطاني يعلن عدم مشاركة بريطانيا في أي عمل عسكري في سوريا , 4 2 تداعيات وردود أفعال على مقتل 3 شبان فلسطينيين في مخيم قلنديا , 5 2 وكالة الاستخبارات المركزية الأمريكية تعترف بدورها في انقلاب إيران 1953 , 6 2 نائب الحاكم العسكري بمصر يأمر بوضع مبارك قيد الإقامة الجبرية , 7 2 اكتشاف نوع جديد من الثدييات في الأنديز , 8 2 انفجار يهز الضاحية الجنوبية لبيروت , 9 2 اختتام مؤتمر ويكيمانيا 2013 في هونغ كونغ , 10 1 سكايب يعمل على توفير خدمة المحادثة ثلاثية الأبعاد

set 2013: 1 2 خروج قطار بضائع عن القضبان واصصدامه بالرصيف بعد تجاوزه السرعة المقررة , 2 2 فوياجر 1 تجتاز حافة النظام الشمسي , 3 2 مصرع 3 موظفين بإحدى شركات الاتصالات وإصابة 8 في حادث تصادم بـالصحراوي , 4 1 عقيدة المصريين عن اخر الايام

out 2013: 1 1 محافظ ينبع.. اثناء زيارته للمخيمات الشاطئية ينبع لاتقدر من يضيع وقته بالكلام

nov 2013: 1 2 الاتحاد الأوروبي يقرر تخفيض العقوبات على إيران , 2 2 الفيفا يقترب لحسم قراره بخصوص مونديال قطر , 3 1 الإتحاد الأوروبي يقرر تخفيض العقوبات على إيران

dez 2013: 1 2 ظهور جزيرة في بحر العرب بفعل زلزال الباكستان , 2 1 انفجار مديرية الأمن بالمنصورة

jan 2014: 1 2 فليتشر: لا نخاف من تشيلسي , 2 1 اليجري يرفض عرضا للتدريب في انجلترا

fev 2014: 1 2 بوتفليقة يترشح لعهدة انتخابية رابعة , 2 2 الجيش الإسرائيلي يكشف نفقا يمتد من داخل القطاع الى الأراضي الإسرائيلية , 3 1 بوتفليقة يترشح لعهدة إنتخابية رابعة

mar 2014: 1 2 السعودية والإمارات والبحرين تسحب سفرائها من الدوحة

abr 2014: 1 2 بدء الانتخابات الرئاسية في أفغانستان , 2 1 إرتفاع الاسعار بالأسواق المصرية بشكل جنونى

mai 2014: 1 1 تحوّل إجابات Google للقراءة فقط

jun 2014: 1 3 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 أزمات المنطقة محور لقاء العاهل السعودي والسيسي

jul 2014: 1 1 17شهيد فى جريمة جديدة فى شجاعية

ago 2014: 1 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 بعثات من ناسا لدراسة آثار التغيرات المناخية في القطب الشمالي

set 2014: 1 1 الصحفي نت

out 2014: 1 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 مفاوضات مباشرة بين الحكومة النيجيرية و\"بوكو حرام\" في تشاد لإطلاق الفتيات المختطفا

nov 2014: 1 4 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 المغرب يفوز على نمبي ب6 ل1 , 3 1 الشوق الى ادمان المخدرات

dez 2014: 1 5 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 محافظ الديوانية يؤكد تخطي الديوانية لباقي المحافظات استثماريا ويعلن قرب تنفيذ \"عين الديوانية\" الاستثماري السكني

jan 2015: 1 5 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 طبخ أكبر طبق كشري في العالم , 3 1 افتتاح معرض القاهرة الدولى للكتاب الدورة 46

fev 2015: 1 1 تقرير أممي: عبدالله صالح جمع أكثر من 60 مليار دولار من ممارسات فاسدة

mar 2015: 1 3 القاعدة تعلن تشكيل فرع جديد لها وهو تنظيم القاعدة الالكتروني , 2 1 تغيير وزاري محدود بمصر

abr 2015: 1 1 حمَاس: زيارة بيريز للمغرب ستجّمل وجه إسرائيل أمام العالَـم

mai 2015: 1 1 ملك المملكة المغربية

jun 2015: 1 2 فيلم اثار غضب المغاربة , 2 2 برهامي: لم نحسم أمرنا من دعم مرشح بعينه للانتخابات الرئاسية.. وسنختار الأكثر تدينًا , 3 1 السماح بزواج المثليين في الولايات المتحدة

jul 2015: 1 2 نصائح عامة , 2 1 مستوطنون متطرفون يضرمون النار بمنزلين في نابلس، ووفاة رضيع محترقاً وإصابة أسرته بحروق بالغة.

ago 2015: 1 2 إسرائيل وراء تنظيم داعش (وثيقة سرية) , 2 2 مقتل أكثر من 100 مدني بقصف النظام السوري سوقاً في دوما , 3 2 الصفحة الرئيسية , 4 1 11 قتيلاً في حريق شرقي السعودية

set 2015: 1 3 عشرات القتلى بسقوط رافعة في الحرم المكي , 2 2 عشرات الوفيات ومئات الإصابات في سقوط رافعة بالحرم المكي , 3 1 بعد زوج عمته \"كيم جونغ أون\" يعدم وزير الدفاع

out 2015: 1 1 سقوط طائرة ركاب روسية في سيناء وأنباء عن وفاة جميع أفرادها

nov 2015: 1 1 إجراء أول اختبار ناجح في التاريخ لصاروخ حامل متعدد الاستعمالات ويهبط بنجاح

dez 2015: 1 1 وفاة أشهر القوادات الفرنسيات \"مدام كلود\"

jan 2016: 1 2 علماء فلك: لدينا أدلة قوية على وجود كوكب تاسع , 2 2 ميسي يفوز بجائزة الكرة الذهبية كأفضل لاعب في سنة 2015 , 3 1 اليابان تفوز بكأس آسيا لكرة القدم تحت 23 سنة وتتأهل برفقة كوريا الجنوبية والعراق إلى الألعاب الأولمبية

fev 2016: 1 3 انفجار في أنقرة يخلف ما بين 90 قتيل وجريح , 2 3 الانتخابات الأمريكية في نيو هامبشير: نصر لترامب وخيبة أمل لكلينتون , 3 2 إكتشاف حالتي إصابة بفيروس زيكا في فنلندا , 4 2 رئيس وزراء كندا جستن ترودو يعلن أن بلاده ستنهي عملياتها العسكرية ضد داعش في مطلع يوم 22 فبراير , 5 1 حفل جوائز الأوسكار ال88: ليوناردو دي كابريو يكسر عقدته ويفوز بجائزة أوسكار لأفضل ممثل، وسبوت لايت يفوز بجائزة أفضل فيلم

mar 2016: 1 2 الممثلة الفرنسية صوفي مارسو ترفض استلام وسام الشرف الفرنسي بسبب منحه لولي العهد السعودي محمد بن نايف , 2 2 ريال مدريد يعود لاكتساح منافسيه ويفوز على سلتا فيغو بنتيجة 7-1 , 3 2 اشتباكات في شمال الأردن بين الجيش ومسلحين إسلاميين يودي بعدة قتلى وجرحى , 4 2 الانتخابات الأمريكية: تقدم كل من هيلاري كلينتون ودونالد ترامب في انتخابات يوم الثلاثاء الكبير , 5 1 وفاة المهندسة المعمارية العراقية الأصل زها حديد عن عمر يناهز 65 سنة

abr 2016: 1 2 مصر تتنازل عن جزيرتي الصنافير وتيران للسعودية بعد توقيع إتفاقية بينهما , 2 2 تظاهرات في بريطانيا تطالب بإستقالة رئيس الوزراء البريطاني ديفيد كاميرون وإنتقادات للبي بي سي لعدم تغطيتها للمظاهرات , 3 2 مقتل عمال سوريين على يد تنظيم داعش , 4 1 دوري أبطال أوروبا: أتلتيكو مدريد يفوز على بايرن ميونخ في مباراة بهدف دون رد

mai 2016: 1 1 سيطرة الجيش السوري على مساحات واسعة من الغوطة الشرقية

jun 2016: 1 1 تدمير رتل لتنظيم داعش مكون من 150 عجلة

jul 2016: 1 2 فشل محاولة الانقلاب العسكري في تركيا، والتي قام بها مجموعة من الجيش التركي. , 2 1 تيريزا ماي تتولى رئاسة وزراء المملكة المتحدة خلفاً لديفيد كاميرون المستقيل.

ago 2016: 1 2 حملة فيسبوكية تطالب مومو بإرجاع الوسام , 2 2 رئيس حملة دونالد ترامب الانتخابية يعلن استقالته , 3 2 هداية ملاك تفوز بميدالية في أوليمبياد ريو , 4 2 استقالة أصغر وزيرة سويدية بعد ضبطها تقود تحت تأثير الخمر , 5 2 الطائرة العاملة بالطاقة الشمسيَّة سولار إمپلس تحط في أبو ظبي مُكملةً رحلتها حول الأرض , 6 2 انطلاق أعمال دورة تدريب مدربات في مجال التمكين السياسي للمرأة بالعاصمة اللبنانية بيروت , 7 1 زلزال يضرب وسط إيطاليا

set 2016: 1 1 بقنابل فسفورية

out 2016: 1 1 ياسمين نيار في حوار جريء لـ الدستور

nov 2016: 1 2 الآثار في قطاع غزة.. الشاهد الأول على جذور التاريخ , 2 2 شركة \"IMI\" .. مصنعة ذخائر القتل والبتر , 3 2 جامعة الطائف: المدير التقى «المعترضين».. وعملية «التصحيح» تمت بشكل «حازم» , 4 2 \"خضوري\": الاحتلال الإسرائيلي اقتحم الجامعة 85 مرة , 5 2 غزة .. دعوات شبابية لاستمرار انتفاضة القدس , 6 2 أكثر من ربع \"الإسرائيليين\" يتهربون من الخدمة العسكرية , 7 2 مؤتمر بغزة يدعو لتعزيز صمود المقدسيين في وجه سياسة التهويد , 8 2 وقفة تضامنية مع شقيق الأسير مرعي أمام \"الخارجية الأردنية\" , 9 2 ليبرمان: يجب علينا التنسيق مع إدارة ترامب , 10 2 وزارة الأشغال الفلسطينية: تحركات خفية تعطل إعمار غزة , 11 2 الاحتلال الإسرائيلي يمنع أهالي غزة من الصلاة في الأقصى , 12 1 اختراق بث القناتين العبريتين الثانية والعاشرة وإذاعة مقطع للأذان

dez 2016: 1 2 فنانة تشكيلية هولندية تحول منزلاً مدمراً إلى تحفة فنية بخانيونس , 2 2 400 ألف نازح من مدينة حلب , 3 1 سؤال المحير في الجزائر !! عاجل

jan 2017: 1 2 بُعيد لقاء هنية.. أمير قطر يوعز بخطوات عملية لحل أزمة الكهرباء بغزة , 2 1 علماء: نقل سفارة أمريكا للقدس يأتي في سياق تهويد المدينة

fev 2017: 1 1 انطلاق عملية عسكرية لاستعادة الحديدة في اليمن

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 21 de março 2017 13:21

Dump file arwikinews-20170301-stub-meta-history.xml.gz (edits only), size 3.7 Mb as gz -> 28 Mb
Dump processed till Feb 28, 2017, on server stat1002, ready at Fri-10/03/2017-15:13 after 20 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.