Estatísticas da Wikinotícias árabe

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikinews árabe

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: maio 2018
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mai 20180%   0%   +219%      +8%
abr 2018+3%   0%   -99%      0%
mar 2018+2%   0%   -51%      0%
fev 2018+2%   +87%   +1576%      0%
jan 20180%   +3%   +11%      +1%
dez 2017+2%   +2%   -29%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mai 201869 1 7,7 k 3,5 86      447
abr 20186922 7,7 k 3,5 27      414
mar 2018671217,7 k13,5 2,6 k      414
fev 20186612 7,7 k1283,1 5,2 k      413
jan 201865 214,1 k44,6 309      413
dez 2017651314,0 k34,7 278      408
nov 201764 323,9 k34,7 390      408
out 201764 413,8 k44,7 2,7 k      402
set 201764 313,7 k24,1 310      395
ago 2017642313,6 k34,1 183      394
jul 2017621213,5 k44,2 185      386
jun 201761 113,4 k74,3 304      386
mai 2017611113,2 k74,5 295      386
abr 201760 313,0 k54,7 299      385
mar 20176014 2,8 k34,8 160      383
fev 201759 2 2,8 k14,9 40      376
jan 201759 212,7 k44,9 219      376
dez 201659 112,6 k65,1 298      369
nov 2016593412,4 k95,4 570      366
out 201656   2,1 k 5,8 9      365
set 201656 2 2,1 k 5,8 51      365
ago 20165615 2,1 k15,8 78      365
jul 20165521 2,1 k 5,9 35      364
jun 201653 1 2,1 k 5,9 15      364
mai 201653   2,1 k 5,9 5      364
abr 201653 3 2,1 k15,9 55      364
mar 201653 212,1 k25,9 154      363
fev 201653 212,0 k26 189      348
jan 201653 1 1,9 k 6,1 23      339
dez 201553 2 1,9 k 6,1 14      339
nov 201553 1 1,9 k16,1 38      339
out 201553 1 1,9 k 6,2 15      339
set 201553 4 1,9 k 6,2 40      339
ago 2015531311,9 k16,2 799      338
jul 20155222 1,9 k 5,8 29      336
jun 2015501  1,9 k15,8 29      336
mai 201549 1 1,9 k15,9 32      336
abr 201549 1 1,8 k 5,9 23      334
mar 201549 1 1,8 k 5,91624197,6 Mb548 k1,1 k70784,2 k334
fev 20154911 1,8 k 5,91625287,6 Mb547 k1,1 k70784,2 k334
jan 20154822 1,8 k 61625377,5 Mb546 k1,1 k70784,2 k333
dez 201446   1,8 k 6162937,3 Mb543 k1,1 k70784,2 k332
nov 201446 1 1,8 k 61629117,3 Mb542 k1,1 k70744,2 k332
out 201446   1,8 k 6162927,3 Mb543 k1,1 k74744,2 k332
set 201446   1,8 k 6162977,3 Mb543 k1,1 k74744,2 k332
ago 201446 1 1,8 k 61728107,6 Mb576 k1,1 k74744,2 k332
jul 20144612 1,8 k 61729317,6 Mb575 k1,1 k73734,2 k332
jun 20144511 1,8 k 61733207,5 Mb572 k1,1 k737 4,2 k331
mai 20144411 1,8 k16,11735427,5 Mb571 k1,1 k737 4,2 k330
abr 20144313 1,7 k26,11745837,4 Mb569 k1,1 k737 4,2 k329
mar 20144211 1,7 k 6,31647276,9 Mb534 k1,1 k737 4,2 k329
fev 201441   1,7 k 6,31650186,8 Mb532 k1,1 k737 4,2 k329
jan 20144111 1,7 k16,31653376,8 Mb531 k1,1 k737 4,1 k327
dez 20134011 1,6 k 6,31659166,8 Mb528 k1,1 k737 4,1 k326
nov 20133911 1,6 k 6,31659196,8 Mb527 k1,1 k737 4,1 k326
out 201338 2 1,6 k 6,31660346,8 Mb525 k1,1 k737 4,1 k325
set 201338 3 1,6 k 6,41661326,7 Mb524 k1,1 k737 4,1 k325
ago 2013381511,6 k16,416611676,7 Mb522 k1,1 k720 4,1 k325
jul 2013371311,6 k16,516571576,5 Mb512 k1,1 k686 4,0 k320
jun 201336 411,5 k16,516471916,4 Mb501 k1,1 k655 3,9 k318
mai 201336 111,5 k16,516321646,2 Mb486 k1,1 k614 3,8 k316
abr 2013361311,5 k16,516303496,1 Mb476 k1,1 k588 3,7 k314
mar 201335 111,4 k16,516292065,9 Mb461 k1,1 k515 3,6 k310
fev 2013351211,4 k16,416242615,8 Mb452 k1,1 k459 3,5 k306
jan 201334 111,4 k16,416183845,7 Mb439 k1,1 k409 3,4 k304
dez 201234 211,3 k16,316171885,5 Mb427 k1,1 k389 3,3 k298
nov 2012342211,3 k16,416142015,4 Mb415 k1,0 k353 3,2 k296
out 201232 211,3 k16,416187325,3 Mb409 k1,0 k344 3,1 k292
set 2012321411,2 k1616153195,1 Mb401 k1,0 k32013,0 k289
ago 201231 311,2 k15,916161565,0 Mb386 k99430312,9 k285
jul 2012311421,2 k25,916133414,9 Mb374 k99030012,8 k280
jun 201230 311,1 k1616082154,6 Mb353 k97028912,6 k272
mai 2012301211,0 k1616092274,4 Mb339 k96328012,5 k264
abr 20122912 1,0 k16,11618744,3 Mb326 k95126712,4 k257
mar 201228 1 982 6,11615124,2 Mb320 k935264 2,3 k257
fev 20122812 974 6,21617244,2 Mb319 k935264 2,3 k257
jan 201227111967 6,216101064,2 Mb316 k935264 2,3 k257
dez 201126   966 6,11612584,1 Mb316 k935264 2,3 k257
nov 201126 1 966 61613194,1 Mb316 k93525912,3 k256
out 20112612 956 6,11612574,1 Mb314 k935259 2,3 k256
set 201125   943 6,11626224,1 Mb313 k934238 2,3 k247
ago 201125 1 937 6,11626194,1 Mb313 k934238 2,3 k247
jul 20112512 930 6,116283124,0 Mb313 k934238 2,3 k245
jun 20112412 92415,81601594,0 Mb313 k93424042,3 k238
mai 201123 3190625,915925263,9 Mb306 k84624042,3 k234
abr 20112312 83425,713371092,8 Mb232 k2,7 k24042,2 k231
mar 20112223277126,110795292,2 Mb176 k1,4 k24041,6 k231
fev 201120 1 697 6780141,5 Mb116 k199219 880219
jan 201120   689 6780101,5 Mb116 k199218 880219
dez 201020   689 6780111,5 Mb116 k199217 880219
nov 201020   688 677831,5 Mb115 k199218 880219
out 201020   687 677921,5 Mb115 k199216 880219
set 201020   687 677921,5 Mb115 k199215 880219
ago 201020   686 677971,5 Mb115 k199215 880219
jul 201020 1 682 677881,5 Mb115 k199215 879219
jun 201020 2 681 6779401,5 Mb115 k199215 877218
mai 201020 1 674 6785471,4 Mb115 k194168 874217
abr 201020   666 6785111,4 Mb114 k193168 866215
mar 201020   665 6785 1,4 Mb114 k193169 865214
fev 2010201  665 6780111,4 Mb113 k193197 862214
jan 201019 1 663 6783111,4 Mb113 k192197 862214
dez 200919 1 661 6783131,4 Mb113 k188197 859211
nov 200919   660 6784131,4 Mb113 k188194 858211
out 200919   658 6785261,4 Mb113 k188194 858210
set 20091913 653 67813811,4 Mb112 k188194 856210
ago 20091813 64615,57861611,4 Mb111 k18619121852203
jul 20091715161525,57932421,3 Mb106 k18417221821187
jun 200916 5 56115,67742031,2 Mb93 k18116420763158
mai 200916 3 53415,57661461,1 Mb88 k18214220728154
abr 20091636349845,67527431,0 Mb81 k17912526692148
mar 200913510236365,69001,3 k788 kb63 k166982755646
fev 2009822116424,81071247411 kb32 k158521034618
jan 20096   104 5,210732254 kb19 k1044892977
dez 20086   104 5,21073 255 kb19 k1044892977
nov 20086 1 104 5,2107319255 kb19 k1044892977
out 20086   97 5,410771229 kb19 k1034892977
set 20086 1 96 5,4107734226 kb19 k1034892977
ago 20086   95 5,111901224 kb17 k1034891277
jul 20086   95 5,11190 224 kb17 k1034891277
jun 20086   95 5,111903224 kb17 k1034891277
mai 20086   95 5,11190 224 kb17 k1034091277
abr 20086   95 5,111903224 kb17 k1034091277
mar 20086   94 5,11197 223 kb17 k1034081267
fev 20086   94 5,111971223 kb17 k1034081267
jan 20086   94 5,111971223 kb17 k1034081267
dez 20076 1 94 5,1119726223 kb17 k1034081267
nov 20076 1 90 5123430215 kb16 k30408926
out 20076   89 4,812092208 kb16 k30318916
set 20076   88 4,81209 207 kb16 k30318916
ago 20076   88 4,81209 207 kb16 k30318916
jul 20076 1 88 4,8120957207 kb16 k30318916
jun 20076   88 4,110392207 kb11 k30318986
mai 2007612 88 4,1103927207 kb11 k30318986
abr 2007512 7814,31145111189 kb10 k19318766
mar 2007411 56 4128858155 kb8,9 k7318134
fev 20073   56 312804152 kb9,4 k7278142
jan 20073   55 312693149 kb9,2 k5278142
dez 20063   53 312721141 kb9,0 k5278142
nov 20063   52 3,112721140 kb9,0 k5278142
out 20063   52 31272 140 kb9,0 k5278142
set 20063   52 312722140 kb9,0 k5278142
ago 20063   51 3,1126040137 kb8,7 k5279132
jul 20063   47 2,51319 116 kb9,0 k52710132
jun 20063   47 2,513194116 kb9,0 k52710132
mai 20063   45 2,513192114 kb9,0 k52710132
abr 20063   45 2,413194114 kb9,0 k52710132
mar 20063 1 45 2,4131411113 kb8,9 k52710132
fev 20063 1 42 2,3131514107 kb8,7 k52710122
jan 20063   40 212867101 kb8,3 k52710122
dez 2005332 3811,911157486 kb7,0 k11235182
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201813312 10 24 13      32
jan 201814 14612222 4      32
out 201714 9712322 1      32
jul 201713813714424 9      32
abr 201714 9816222 10      32
jan 201714 12817522 11      32
out 201615   17 19 17      32
jul 201616516 17 19 15      32
abr 201616 8 17819 11      32
jan 201615 17 17 17 16      32
out 201515 17 17 16 18      32
jul 201515311 17 19 17      32
abr 201517 17 17 19 17      32
jan 2015173108171118141515181222311632
out 20141710208171118142315181222311632
jul 2014178139171117131515171224311632
abr 201418911517317131215171224321532
jan 2014199178171017141614171224321532
out 20132112178171317141714171224321432
jul 2013228149171116141415171224321432
abr 20132112169191516131015171224321532
jan 2013211219820121413815171227321632
out 2012211015620121413415181228321732
jul 2012211094211016131016181228321832
abr 201222101511231315131416181228321932
jan 201222112111221821211715171128321832
out 201122141814221721211915161028321732
jul 201123101611211519191015141028321532
abr 20112310191320111919161620727311532
jan 201123182715212219192722242227322432
out 201022132311211617172521242126322332
jul 201022171812211516162321242126312332
abr 20102114259201616162421242126312232
jan 201021142010181615152420211925312132
out 200920122212181615152118201924311932
jul 2009209111018914141018201923242032
abr 2009206931941313521211923222132
jan 200926172311261513132526251925232231
out 200826202112252013132525241825232230
jul 200826152014241712122524241824222530
abr 200825112010241612122324241623232429
jan 200824162116231911112423231623232229
out 200721151711221511112122211823202227
jul 20072112149211211111222211822192127
abr 20072210127211210101021212022192126
jan 200723122010211210102221212122192226
out 200623131782014992221202121182224
jul 200621111691911992020192020172122
abr 20062091591811881719181820162021
jan 2006191417111614881817171619151820
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  5  10  100  1000  10000 
mai 2018421    11  1431      111 20211        
abr 20184321       831      111 15422        
mar 2018732221111   15543     111 277543  11111
fev 201893221  1111244       111 2685521 1111 
jan 2018842221  11  18521     111 30129621      
dez 2017733321  1   16632     111 3195411      
nov 2017633322      10441     221 1465321      
out 20177544311 2211125311    22  228652211    
set 20177432211     1773221   11  33118531      
ago 20171253211      195311    111 315532  1    
jul 2017722111      11431     111 124222  111  
jun 20175211111     15321     111 185433       
mai 20174111111     621      111 1111111 1    
abr 2017973221      1111      111 1721111      
mar 201795432      114311    111 207431       
fev 201742211      92       111 17211        
jan 2017622111      711      111 172211       
dez 20166111111     8111     111 1342111      
nov 20167543211     321      111 1443211 1    
out 201631        71       111 17621        
set 201633211      911      11  105322       
ago 2016105521      145221    111 249722       
jul 20166311       52       111 1951         
jun 2016611        531      111 2142    11   
mai 201631        10        111 12332        
abr 201643311      1032      111 218531       
mar 2016432211      72       111 173221       
fev 2016642111      411      111 215211       
jan 20162111       91       111 16211        
abr 20184321       831      111 15422        
jan 2018842221  11  18521     111 30129621      
out 20177544311 2211125311    22  228652211    
jul 2017722111      11431     111 124222  111  
abr 2017973221      1111      111 1721111      
jan 2017622111      711      111 172211       
out 201631        71       111 17621        
jul 20166311       52       111 1951         
abr 201643311      1032      111 218531       
jan 20162111       91       111 16211        
out 20153111       9111     111 164211  211  
jul 20154322       73211        24511        
abr 2015621        71       222 1311    11   
jan 20155221       7311         2342         
out 20142         3            831         
jul 20144321       72111        8532   1    
abr 201421731       2            1851    1    
jan 20147311       11           11422   11   
out 2013732        41           15411   11   
jul 2013633211  1   211      11  1143211 331  
abr 201311433111 11  105411    111 21421111221  
jan 20137111111     3111     111 8321111221  
out 20126322111 111 83331    111 15533111332  
jul 2012844332      75443    11  2588632122   
abr 201263211      532      111 147531  11   
jan 2012111111               111 81111  11   
out 2011102221      32211        132          
jul 201183221  111 32221    1   134221  111  
abr 201163222      3            1843    22   
jan 2011      1   11111        1133    22   
out 20102         1            121     32   
jul 2010211                     911         
abr 201021        51111    111 144     221  
jan 2010311        111111       83321       
out 200942    11  21111        73221  1    
jul 20091255441      104321        2384441 11   
abr 200914965331 11  15753111      2698541 221  
jan 2009          4            1043         
out 20081         1            1352         
jul 2008                       7431        
abr 20081         1            51111       
jan 2008          3            41          
out 2007          2            631         
jul 200711111      11           52111       
abr 200722221  11  62222        733221 11   
jan 2007                                   
out 2006                       1           
jul 2006                       31          
abr 2006          1            4           
jan 20065         2            2           

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1345100.0%16,833100.0%
312135.1%16,51198.1%
106819.7%16,21696.3%
32288.1%15,51292.2%
100144.1%14,53886.4%
31682.3%13,41079.7%
100061.7%12,65875.2%
316220.6%6,60139.2%

 

4 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
فيصلUC32+1926911831fev 12, 2018107----
مصعبUC62+5111331mar 14, 20174421---
MamakfjUC107+145192jan 04, 2018146----
محمد عصامUC145...3383mai 09, 201821----

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Anassalama3UC13,430nov 04, 2016572jan 30, 2018120
PICAWNUC23,171abr 17, 20122234jul 04, 20141426
علاءUC32,455ago 08, 2016660mar 10, 201881
SeHUC41,404fev 14, 20093392jun 02, 20102919
Meno25UC51,136mar 22, 20074087fev 07, 2018112
CiphersUC61,062fev 21, 20093385fev 20, 20131925
FPPUC7384abr 15, 20151141jul 29, 2016670
سمير تامرUC8368ago 15, 2017288mar 31, 201860
عماد الدين المقدسيUC9281ago 05, 20151029nov 17, 2017194
خلدون شنتوتUC10279mar 05, 20112643mai 10, 20112577
AzitonyUC11176jun 23, 20122167nov 13, 20131659
عباد ديرانيةUC12148mai 11, 20112576set 15, 20131718
Mo7amedsalimUC13142mar 02, 20093376ago 19, 20093206
روخوUC14102nov 18, 20093115jan 07, 20122335
وليد شرف الدينUC1597abr 24, 20112593mai 18, 20112569
CommonsDelinkerUC1694set 16, 20093178jan 26, 2018124
محمد أحمد عبد الفتاحUC1791dez 21, 20073813dez 03, 2017178
OsamaKUC1888abr 02, 20074076dez 24, 20073810
براق سالمUC1981mar 23, 20093355mar 30, 20093348
باسمUC2078fev 11, 20131934out 13, 2017229

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 504 edições foram feitas por usuários anônimos, de um total de 26837 edições ( 1e %)
  


20 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
JarBotUC15,246mar 01, 2017455mai 17, 2018133,598-
MenoBotUC23,387ago 30, 20093195out 30, 2017212--
CipherBotUC3189mar 27, 20093351mai 05, 20112582--
XeBotUC4177mar 23, 20093355jul 18, 20093238--
YiFeiBotUC5139ago 09, 20151025set 09, 2015994--
AvocatoBotUC6116jul 28, 20112498jul 26, 20131769--
TrBotUC775mar 08, 20093370mar 15, 20093363--
OKBotUC835abr 03, 20074075dez 26, 200738081-
VolkovBotUC934abr 17, 20093330abr 15, 20131871--
SahimrobotUC1031mai 20, 20112567mai 20, 20112567--
GrondinBotUC1122mai 17, 20093300out 31, 20131672--
MjbmrbotUC1213jan 08, 20112699mar 14, 20112634--
KamikazeBotUC1312dez 17, 20112356dez 18, 20112355--
AvicBotUC1410mar 29, 2016792nov 17, 2017194--
タチコマ robotUC156fev 29, 20083743ago 23, 20131741--
JAnDbotUC163jun 13, 20131812ago 13, 20141386--
AlexbotUC172jun 06, 20083645jun 20, 20083631--
DorganBotUC181jun 07, 20083644jun 07, 20083644--
K.J.BotUC191jan 26, 20103046jan 26, 20103046--
AmirobotUC201mar 13, 20112635mar 13, 20112635--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPngSvg
mai 20188,2 k94883341568462822 k44595     121
abr 20188,1 k94483241568462822 k44593     121
mar 20188,1 k93982931568462822 k44592      21
fev 20188,1 k9288133156837288,0 k44558      21
jan 20184,5 k9167863156831283,4 k44510      21
dez 20174,4 k9007823156826283,3 k44489      21
nov 20174,3 k8837803156822283,2 k44473      21
out 20174,2 k8777783156821283,2 k44452      21
set 20174,1 k8637753156796283,1 k44437      21
ago 20174,0 k8457503156774283,1 k44429      21
jul 20173,9 k8277463156764283,0 k44416      21
jun 20173,8 k8197402156757283,0 k44411      2 
mai 20173,6 k8067392156744282,9 k44407      2 
abr 20173,4 k8007382156743282,8 k44405      2 
mar 20173,2 k7947372156741282,7 k44401      2 
fev 20173,1 k7857342156731282,6 k44394      2 
jan 20173,1 k7747332156731282,6 k44393      2 
dez 20163,0 k7677312156730282,6 k44391      2 
nov 20162,8 k7597302156728282,5 k44383      2 
out 20162,5 k7527292156728282,4 k44379      2 
set 20162,5 k7427292156728282,4 k44374      2 
ago 20162,5 k7417272156721282,4 k44371      2 
jul 20162,5 k7277042156705272,4 k44369      2 
jun 20162,5 k7227032156705272,3 k44364      2 
mai 20162,5 k7156942156703272,3 k44361      2 
abr 20162,4 k7096932156703272,3 k44357      2 
mar 20162,4 k7026902156703272,3 k44348      2 
fev 20162,3 k7006882156702272,3 k43334      2 
jan 20162,3 k7006862156699272,2 k43319      2 
dez 20152,3 k6956842156698272,2 k43315      2 
nov 20152,3 k6866842156696272,2 k43313      2 
out 20152,3 k6816832156694272,2 k42308      2 
set 20152,2 k6806822156686272,1 k42301      2 
ago 20152,2 k6716802156685272,1 k42295      2 
jul 20152,2 k6646682156679272,1 k42286      2 
jun 20152,2 k6576642156663262,1 k42284      2 
mai 20152,2 k6526592156662262,1 k42278      2 
abr 20152,2 k6516552156662262,1 k42271      2 
mar 20152,2 k6456542156662262,1 k42265    13 2 
fev 20152,2 k6396532156662262,1 k42261    28 2 
jan 20152,1 k6296512156657262,1 k41259    28 2 
dez 20142,1 k6186482156657262,1 k41252      2 
nov 20142,1 k6136472156657262,0 k41241    8 2 
out 20142,1 k6126462156657262,0 k41234    2 2 
set 20142,1 k6106462156655262,0 k41231    4 2 
ago 20142,1 k6046452156655262,0 k41228    7 2 
jul 20142,1 k6006442156653262,0 k41226    31 2 
jun 20142,1 k5986432156651262,0 k41222    19 2 
mai 20142,1 k5976422156651262,0 k41221    18 2 
abr 20142,1 k5956412156651262,0 k41221    57 2 
mar 20142,0 k5896402155651262,0 k41217    22 2 
fev 20142,0 k5866392155650262,0 k41216    18 2 
jan 20142,0 k5796342155650262,0 k41215    35 2 
dez 20132,0 k5726332155649262,0 k41214    16 2 
nov 20132,0 k5696322155649262,0 k41213    19 2 
out 20132,0 k5626312155649262,0 k41213    20 2 
set 20132,0 k5566302155649262,0 k41211    30 2 
ago 20131,9 k5406292155648262,0 k41208    160 2 
jul 20131,9 k5356282155645261,9 k41206    147 2 
jun 20131,9 k5296252155637251,9 k41206    188 2 
mai 20131,8 k5286242155629251,9 k41204    150 2 
abr 20131,8 k5256212154613251,8 k41202    313 2 
mar 20131,7 k5176172154584251,7 k41197    183 2 
fev 20131,7 k5066132149577251,7 k41195    251 2 
jan 20131,7 k4976112149563251,6 k41192    380 2 
dez 20121,6 k4936072147518251,5 k41187    187 2 
nov 20121,6 k4876012147504241,4 k41187    200 2 
out 20121,6 k4875982147497241,4 k41184    360 2 
set 20121,5 k4745812146423231,2 k41180    301 2 
ago 20121,5 k4635682143374221,2 k41175    156 2 
jul 20121,4 k4565602143359221,1 k40168    328 2 
jun 20121,4 k4485482141347211,1 k40161    210 2 
mai 20121,3 k4395452140334211,0 k40152    220 2 
abr 20121,3 k43254221403282094640143    72 2 
mar 20121,2 k42653821403272092338137    7 2 
fev 20121,2 k42453821403272092338137    21 2 
jan 20121,2 k41553821403272092238136    101 2 
dez 20111,2 k41053621402962091336136    2 2 
nov 20111,2 k40653621402962091336135    16 2 
out 20111,2 k39253621402952091336135    55 2 
set 20111,2 k38453621402952091336131    7 2 
ago 20111,2 k37753621402941991336129    17 2 
jul 20111,2 k37053621402921990036128    74 2 
jun 20111,2 k35553521402881987836126    35 2 
mai 20111,1 k34553521402861986536126    483 2 
abr 20111,1 k34253321402851885736125    104 2 
mar 20111,0 k33152921402851885235125    373 2 
fev 201191632751211402791884335124    10 1 
jan 201190832250911402791884335123      1 
dez 201090831750811402781884335123    4 1 
nov 201090731250711402781884135120    1 1 
out 201090630950711402781884135117    2 1 
set 201090630550711402781884135115    2 1 
ago 201090529950711402781884135113    4 1 
jul 201090128250511402761884133110    6 1 
jun 201089928150511402751884033109    28 1 
mai 201089125650511402751883533101    38 1 
abr 20108812554311138274188273398    4 1 
mar 20108792464291138274188253396      1 
fev 20108792404271138274188253390    6 1 
jan 20108772314091138274188213388    10 1 
dez 20098722183911133271188203385    6 1 
nov 20098712133911133271188203383    7 1 
out 20098682113291133271188203378    11 1 
set 20098632112981133271188203274    54 1 
ago 20098492042671133271188163267    137 1 
jul 20098022012631133266187963254    232 1 
jun 20097191931921131260167722134    120 1 
mai 20096881881911131254167561424    137 1 
abr 20096461831341131251167331315    699 1 
mar 20094091451331131213166801110    931 1 
fev 2009182129571122185136009     239 1 
jan 2009111115291122157101402       1 
dez 200811111329112215710139        1 
nov 200811111229112215610139      8 1 
out 20081049729112215610139      1 1 
set 20081038429112215610139      34 1 
ago 20081028029112014810123      1 1 
jul 20081027627110513610123        1 
jun 2008102762719913610123        1 
mai 2008102672714113610123        1 
abr 2008102652713213610123      2 1 
mar 2008101632712113510123        1 
fev 2008101562712113510123        1 
jan 2008101492712113510123        1 
dez 2007101472712113510123      11 1 
nov 200796402612113210123      28 1 
out 200795402612113210120        1 
set 200794392612112910120        1 
ago 200794382612112910120        1 
jul 200794362612112710120      57 1 
jun 20079435261211141117      2 1 
mai 200794352512170178      26 1 
abr 200784292512052178      90 1 
mar 20076024191152712      56 1 
fev 2007581714132412      3 1 
jan 2007571514132412        1 
dez 2006551514132412        1 
nov 2006541414132312        1 
out 2006541414131612        1 
set 2006541313131612        1 
ago 2006531313131612        1 
jul 2006491113131512        1 
jun 200649913121411        1 
mai 200647913121411        1 
abr 200647913121411        1 
mar 200647713121411      6 1 
fev 20064471312141         1 
jan 20064271212131         1 
dez 2005407121213          1 

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 3 الصفحة الرئيسية , 2 2 صدام حسين هل يدلي بصوته بالسجن اليوم؟ , 3 2 تحت شعار \"الدفاع عن الإسلام\" قمة مكة تختتم أعمالها , 4 1 خدام ينشق عن النظام البعثي السوري

jan 2006: 1 2 حماس تحصل على أغلبية الأصوات في الانتخابات التشريعية الفلسطينية

fev 2006: 1 1 أزمة الرسوم الكاريكاتورية المسيئة للنبي محمد

mar 2006: 1 1 الجيش الإسرائيلي يحاصر سجن أريحا لمدة 11 ساعة

fev 2007: 1 1 منتدى الحوار الأمريكي الإسلامي

mar 2007: 1 1 ضغوط أميركية لإقالة وزير الداخلية العراقي بعد فضيحة تعذيبه لمئات المعتقلين

abr 2007: 1 2 جنبلاط يدعو كل اللبنانيين لصد العدوان و تحرير الأرض , 2 2 بيان قمة مجلس التعاون الخليجي يحث سوريا على التعاون مع الأمم المتحدة , 3 1 آخر الأخبار/30 أبريل 2007

mai 2007: 1 2 آخر الأخبار/16 مايو 2007 , 2 1 مايو 2007

jun 2007: 1 1 بريطانيا ترفض عرضا إسبانيا لإدارة مطاراتها

jul 2007: 1 1 مقتل نائبين في انفجار مقهى البرلمان العراقي

nov 2007: 1 1 مؤسسة ويكيميديا من بين رواد تكنولوجيا المنتدى الاقتصادي العالمي 2008

dez 2007: 1 2 ديسمبر 2007 , 2 1 آخر الأخبار/22 ديسمبر 2007

abr 2008: 1 1 مايو 2007

ago 2008: 1 1 كوريا الشمالية توافق على تعطيل أهم مفاعل نووي

set 2008: 1 2 مصر تفتح معبر رفح للفلسطينين

out 2008: 1 1 مقتل يورج هايدر في حادث سير

nov 2008: 1 1 حزب التحرير: أمريكا لا تنتظر أكثر من ضربة قاضية تسدد لها حتى تسقط عن عرشها العالمي

fev 2009: 1 3 انفجار في حي الحسين بالقاهرة , 2 2 تحطم طائرة تركية في الأراضي الهولندية , 3 2 إيران على بعد خطوات من تشغيل محطة بوشهر النووية , 4 2 أوباما يلقي كلمة في الكونجرس ويعد بتغيير سياسي واقتصادي قريب , 5 2 اتصالات الجزائر تطلق خدمة موجات , 6 2 محكمة الجنايات الدولة ستصدر قرارها بشأن الرئيس السوداني عمر البشير , 7 2 جوجل تنفي أن تكون قد اكتشفت مدينة \"أطلانطس\" الأسطورية , 8 2 تصاعد اللهجة من جديد بين حركتي حماس و فتح , 9 2 ألمانيا تحدد شروطا لاستقبال معتقلين من غوانتنامو , 10 1 نوري المالكي يؤكد أن بإمكان قواته الحفاظ على الأمن في العراق

mar 2009: 1 3 السجن لضابط مصري بتهمة التعذيب حتى الموت , 2 3 مدعي الجنائية الدولية قدم معلومات مغلوطة عن دارفور , 3 3 مقتل أربعة في ضربة صاروخية في شمال غرب باكستان , 4 3 حماس تقول أنها استأنفت مفاوضات تبادل الأسرى , 5 3 انتهاء مواجهات أم الفحم و الإفراج عن رائد صلاح , 6 3 انتخابات اليابان قد تأتي بسياسات مناخية أكثر صرامة , 7 3 حزب العمل يصوت بالموافقة للانضمام إلى حكومة نتنياهو , 8 3 البابا يحث الزعماء الأفارقة على مساعدة المعوزين , 9 3 تحطم طائرة شحن قرب طوكيو , 10 3 إبطال مفعول قنبلة كانت في سيارة ملغمة في مركز تجاري في حيفا , 11 3 حزب التحرير يعقد ندوة سياسية في قلقيلية , 12 3 مزارعون في الأرجنتين يقيمون إضراب احتجاجا على الضرائب , 13 3 اصطدام لسفينتين حربيتين أمريكيتين في مضيق هرمز , 14 3 الاتحاد الأفريقي يحظر عضوية مدغشقر بسبب التوتر الحكومي هناك , 15 3 استعادة اللوحات المسروقة من قصر محمد علي , 16 3 اختطاف 4 عمال إغاثة في الصومال , 17 3 البرلمان الكويتي يستقيل من جديد والأمير يقبل بذلك , 18 3 انطلاق المنتدى العالمي للمياه في إسطنبول , 19 3 الإفراج عن 3 من منتسبي منظمة أطباء بلا حدود في دارفور , 20 3 اغتيال رئيس غينيا بيساو , 21 3 الصفحة الرئيسية , 22 2 دعوة الأسد للقادة العرب برفض اعتقال البشير , 23 2 البشير يتهم إسرائيل بدعم متمردي دارفور , 24 2 القذافي :الجنائية شكل جديد من \"الإرهاب الدولي\" , 25 2 مساندة البشير وتخفيف الانقسام بشأن إيران من أولويات قمة الدوحة

abr 2009: 1 3 استطلاع: غالبية الإسرائيليين يخفون هويتهم بالخارج , 2 3 مركبة \"سويوز\" تعود إلى الأرض بعد انتهاء مهمتها , 3 3 مسلح يقتل 13 شخصا بنيويورك وينتحر , 4 3 الصفحة الرئيسية , 5 2 معاناة التجمعات البدوية في فلسطين , 6 2 انطلاق تظاهرة بيروت عاصمة للكتاب العالمي , 7 2 إطلاق قناة سورية معارضة جديدة , 8 2 السعودية تعترف باستقلال كوسوفو , 9 2 نجاد يثير موجة من الاستياء في صفوف حضور مؤتمر العنصرية في جنيف إثر حديثه عن العنصرية التي تمارسها إسرائيل في فلسطين , 10 2 إطلاق الهند قمر صناعي للتجسس اشترته من إسرائيل , 11 2 سقوط طائرة صغيرة في فلوريدا , 12 2 الأمير نايف يقول أن تنشئة الجيل الصاعد على منهج أهل السنة حماية لهم من الأهواء , 13 2 كلينتون تدعو لرفع الحظر عن جزر كوبا , 14 2 مسلمو القدس يمنعون اليهود من اقتحام المسجد الأقصى , 15 2 العثور على تمثال قناع وجه يعتقد أنه لكليوباترا , 16 2 إسرائيل و الولايات المتحدة الأمريكية تقومان بإجراء مناورات جوية في ما يبدو أنه تحذير لإيران , 17 2 إيفو مورالس ينهي إضرابه عن الطعام بعد استجابة الكونجرس البوليفي لمطالبه حول قانون الانتخاب , 18 2 حركات و دعاة إسلاميون يحذرون من اقتحام المستوطنين للمسجد الأقصى غدا , 19 2 أبو الغيط يوجه اتهامات لإيران بالتآمر لاغتيال مبارك , 20 2 بدأ مؤتمر العلاقات السورية اللبنانية في دمشق , 21 2 \"سامي شهاب\" يعتذر من نصرالله على فشله , 22 2 أوراسكوم تعرض على أورانج آخر فرصة للاتفاق بشأن موبينيل , 23 2 المعارضة الجورجية تدعو إلى نقل التظاهرات إلى مبنى الرئاسة , 24 2 هجوم على سائح إسرائيلي في سيناء , 25 2 إيفو مورالس يدخل في إضراب عن الطعام

mai 2009: 1 3 بايدن في بيروت يربط استمرار الدعم بنتائج الانتخابات , 2 3 مصرع 99 شخصا بتحطم طائرة عسكرية أندونيسية , 3 2 سوريا تنفي إلغاء صفقة طائرات حربية روسية , 4 2 توقيف أربعة أشخاص حاولوا تنفيذ هجمات في نيويورك , 5 2 وزير العدل البريطاني قدم استقالته إثر فضيحة مالية , 6 2 استقالة إيتشيرو أوزاوا زعيم المعارضة اليابانية , 7 2 شافيز يهدد بانسحاب بلاده من منظمة الدول الأمريكية , 8 1 اكتشاف مشهد جنائزي لفارس يمتطي جوادا في منطقة قصر الحير الشرقي بتدمر

jun 2009: 1 4 منظمة الصحة العالمية تعلن تحول وباء إنفلونزة الخنازير إلى وباء عالمي , 2 3 مقتل وزير الأمن الصومالي في هجوم انتحاري , 3 2 تخصيص نصف مليار دولار لإعادة إعمار غزة , 4 2 منتخب الفراعنة يقهر أبطال العالم و يفجر مفاجأة من العيار الثقيل في كأس القرات , 5 2 الخطوط الجوية البريطانية تطلب من موظفيها العمل مجانا , 6 2 إنفلونزا الخنازير تودي بأول ضحاياها في المملكة المتحدة , 7 2 في مباراة مثيرة منتخب البرازيل يفوز على مصر بفرق هدف واحد , 8 2 قطر تتعادل مع اليابان في طوكيو , 9 2 نصر الله يعترف بهزيمة قوى المعارضة في الانتخابات النيابية في لبنان , 10 1 أسعار النفط تتراجع عن مستوى 70 دولار

jul 2009: 1 3 50 فيلما من 14 بلدا تتنافس في مهرجان الهواة , 2 3 حدوث أطول كسوف للشمس خلال القرن الواحد والعشرين , 3 3 محمد ولد عبد العزيز يفوز بالانتخابات الرئاسية الموريتانية بفارق كبير عن منافسيه , 4 3 تفجيرات تستهدف فندقين في جاكرتا وتخلف أكثر من 10 قتلى و50 جريحا , 5 3 صدور كتاب جديد في نقد عبد الوهاب المسيري , 6 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 7 2 آثار معبد جوبيتير تظهر أثناء ترميم أحد البيوت , 8 2 عدة أسئلة لا تزال من دون رد بعد شهر على رحيل مايكل جاكسون , 9 2 انطلاق الانتخابات الرئاسية والبرلمانية في إقليم كردستان العراق , 10 2 مايلي سايروس \"ممنوعة\" من الخضوع لعمليات التجميل , 11 2 شيرين تتفوق على فضل أمام 14 ألف متفرج قرطاجي , 12 2 الشرطة تقتحم عيادة طبيب جاكسون , 13 2 كارول سماحة بين المغرب ومصر ولبنان , 14 2 شمال و جنوب السودان يرحبون بقرار المحكمة الدولية حول أبيي , 15 2 حركة حماس تنتج أول فيلم سينمائي في قطاع غزة , 16 2 مصر تسجل أول حالة وفاة بإنفلونزا الخنازير , 17 1 إنفجار في مايوركا في إسبانيا يودي بحياة شرطيين

ago 2009: 1 4 ويكيبيديا الإنجليزية تتجاوز 3 ملايين مقالة , 2 2 إسكتلندا تطلق سراح عبد الباسط المقرحي لأسباب إنسانية , 3 2 المنتخب المصري لكرة اليد يحتل المركز الرابع في كأس العالم لكرة اليد للشباب , 4 2 الإعصار بيل يزيد قوة فوق الأطلنطي , 5 2 النائبة عن حزب الإينويت في البرلمان الدنماركي تطالب الحكومة بالاعتذار لجرينلاند , 6 2 افتتاح مهرجان الإسكندرية السنمائي بحضور عدد قليل من نجوم السينما , 7 2 اندلاع معركة بين جزائريين وصينيين في الجزائر العاصمة , 8 2 الإفراج عن الصحفيتين الأمريكيتين في كوريا الشمالية والإدارة الأمريكية تبارك جهود كلينتون , 9 2 تمساح بطول قدم يثير الرعب بين ركاب طائرة مصر للطيران , 10 1 سرقة حساب بنك الاحتياط الفيدرالي الأمريكي

set 2009: 1 4 1.9 مليون مواطن يترددون علي موائد الرحمن في مصر , 2 3 أدلة علي قتل مروة الشربيني عمدا، واستبعاد شبهة المرض النفسي , 3 2 المؤتمر التاسيسي لتشكيل ائتلاف العمل والإنقاذ الوطني , 4 2 انتقادات شعبية لأداء الحكومة البريطانية في أفغانستان , 5 1 وزير خارجية مصر يدعوا إسرائيل للقبول بحل الدولتين

out 2009: 1 1 استقبال حافل لأبطال أزرق الناشئين

nov 2009: 1 2 معرض الكتاب في الكويت والدور النسوي في تنمية البلد , 2 1 دورهنّ في تنمية الكويت

dez 2009: 1 1 اتفاق أمريكي روسي بشأن معاهدة ستارت

jan 2010: 1 1 مؤتمر دولي لدعم اليمن في حربه ضد تنظيم القاعدة

fev 2010: 1 2 \"صفقة شاليط\" تنتهي بالفشل , 2 1 اعدام مدنين في نيجيريا

abr 2010: 1 1 ماستريو

mai 2010: 1 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 2 1 جوزيه مورينهو يوقع عقدا لتدريب ريال مدريد

jun 2010: 1 2 محكمة مصرية عليا تؤيد سحب جنسية متزوجو إسرائيليات , 2 2 استقالة رئيس الوزراء الياباني بعد تسعة أشهر من الحكم , 3 2 مهاجمة أسطول الحرية بواسطة البحرية الإسرائيلية

jul 2010: 1 1 وفاة «ابو داود» العقل المدبر لهجوم ميونيخ

ago 2010: 1 1 أغنية \"أحب طريقة كذبك\" تحطم رقم يوتيوب القياسي

set 2010: 1 1 الراسينغ الى نصف نهائي كأس النخبة للمرة الأولى

out 2010: 1 1 كاسترو يقلل من خطوات أوباما تجاه كوبا و يطالبه بالرفع النهائي للحصار

nov 2010: 1 1 تواصل محاكمة المتهم بمقتل الجندي ماجدا المقبولي في اليمن

dez 2010: 1 1 اختفاء الحزام الجنوبي لكوكب المشتري

fev 2011: 1 1 خلل في التنسيق بين إصداري مايكروسوفت أوفيس 2007 و2010

mar 2011: 1 2 أحداث يوم السبت 5/3/2011 م من ثورة 17 فبراير الليبية , 2 2 أحداث يوم الجمعة 11/3/2011 م من ثورة 17 فبراير الليبية , 3 2 أحداث يوم الثلاثاء 8/3/2011 م من ثورة 17 فبراير الليبية , 4 2 أحداث يوم الثلاثاء 1/3/2011 م من ثورة 17 فبراير الليبية , 5 2 أحداث يوم الإثنين 21/2/2011 م من ثورة 17 فبراير الليبية , 6 2 أحداث يوم الإثنين 14/3/2011 م من ثورة 17 فبراير الليبية , 7 2 أخبار زلزال اليابان 18-3-2011 22:00 , 8 1 أحداث يوم الأربعاء 9/3/2011 م من ثورة 17 فبراير الليبية

abr 2011: 1 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 2 1 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011

mai 2011: 1 4 أحداث يوم الخميس 28/4/2011 م من الاحتجاجات السورية 2011 , 2 3 أحداث يوم الجمعة 6/5/2011 م من الاحتجاجات السورية 2011 , 3 3 أحداث يوم الجمعة 29/4/2011 م من الاحتجاجات السورية 2011 , 4 3 أحداث يوم الأحد 8/5/2011 م من الاحتجاجات السورية 2011 , 5 3 أحداث يوم الأربعاء 23/2/2011 م من ثورة الشباب اليمنية , 6 3 شركة \"مايكروسوفت\" تشتري \"سكايب\" مقابل 8.5 مليار دولار , 7 2 ثورة الشباب اليمنية , 8 2 الاحتجاجات السورية 2011 , 9 2 ثورة 17 فبراير , 10 2 أحداث يوم السبت 9/4/2011 م من الاحتجاجات السورية 2011 , 11 2 أحداث يوم السبت 7/5/2011 م من الاحتجاجات السورية 2011 , 12 2 أحداث يوم السبت 30/4/2011 م من الاحتجاجات السورية 2011 , 13 2 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011 , 14 2 أحداث يوم السبت 23/4/2011 م من الاحتجاجات السورية 2011 , 15 2 أحداث يوم السبت 16/4/2011 م من الاحتجاجات السورية 2011 , 16 2 أحداث يوم الخميس 7/4/2011 م من الاحتجاجات السورية 2011 , 17 2 أحداث يوم الخميس 5/5/2011 م من الاحتجاجات السورية 2011 , 18 2 أحداث يوم الخميس 21/4/2011 م من الاحتجاجات السورية 2011 , 19 2 أحداث يوم الخميس 14/4/2011 م من الاحتجاجات السورية 2011 , 20 2 أحداث يوم الجمعة 8/4/2011 م من الاحتجاجات السورية 2011 , 21 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 22 2 أحداث يوم الجمعة 22/4/2011 م من الاحتجاجات السورية 2011 , 23 2 أحداث يوم الجمعة 15/4/2011 م من الاحتجاجات السورية 2011 , 24 2 أحداث يوم الثلاثاء 3/5/2011 م من الاحتجاجات السورية 2011 , 25 2 أحداث يوم الثلاثاء 26/4/2011 م من الاحتجاجات السورية 2011

jun 2011: 1 2 البيضاء (ليبيا) , 2 1 الاهلي يتوج بطلا لكاس السعودية

jul 2011: 1 3 انفجار وإطلاق رصاص في النرويج , 2 2 ملثمون يثيرون الذعر في العريش , 3 2 العثور على جثة من زلزل عرش ميردوخ , 4 2 شرف يعلن تشكيل الحكومة اليوم، وبقاء وزراء الثقافة والتربية والعدل والسياحة والداخلية , 5 2 حاخام يهودي يقول أن وجود الأقصى مسألة وقت والهيكل سيبنى , 6 1 ملثمون يثيرون الذعر فى العريش

ago 2011: 1 3 مقتل قائد المعارضة الليبية , 2 2 استشهاد ضابط ومجندين في إطلاق نار على الحدود المصرية الإسرائيلية , 3 1 صحيفة لي فيغارو الفرنسية:\" إيران قد أدارت ظهرها فعلاً للرئيس السوري بشار الأسد\"

set 2011: 1 1 وفاة النجل الأكبر لجمال عبد الناصر في بعد تدهور حالته بإحدى مستشفيات القاهرة

out 2011: 1 4 مقتل معمر القذافي , 2 2 وفاة ولي العهد السعودي الأمير سلطان بن عبد العزيز , 3 1 الولايات المتحدة الأمريكية تقطع مساعداتها المالية لليونسكو إثر منحها مقعداً لفلسطين

nov 2011: 1 1 الملاكم فراس زيداني من الناصرة يستعد للمشاركة في بطولة عالمية في المانيا

dez 2011: 1 1 1.9 مليون مواطن يترددون علي موائد الرحمن فى مصر

jan 2012: 1 1 الشرطة تكشف عن قضية \"علي بابا\" في اللد: شبكة تجارة مخدرات وسموم وبيعها لقاصرين

fev 2012: 1 1 الامم المتحدة: عدد القتلى المدنيين في سوريا \"أعلى بكثير من 7500

mar 2012: 1 2 التلفزيون السوري: سكان باب عمرو بدأوا العودة , 2 1 بوينج وايرباص ،،، تجدد أزمة الدعم

abr 2012: 1 2 نقل مكوك الفضاء «ديسكفري» إلى المتحف الجوي , 2 2 تحطم طائرة ركاب قرب مطار إسلام آباد , 3 1 حملة الدعاية الانتخابية تنطلق رسمياً في مصر

mai 2012: 1 3 مقتل أكثر من خمسين جندي في تفجير انتحاري بصنعاء , 2 2 41 قتيلا بسوريا ومهلة للنظام , 3 2 إعلان نتائج الانتخابات الرئاسية المصرية 2012 , 4 2 عشرات القتلى في مجزرة الحولة بسوريا , 5 2 النتائج غير الرسمية لانتخابات الرئاسة المصرية , 6 2 انطلاق انتخابات الرئاسة المصرية لأول مرة عقب ثورة 25 يناير وسقوط نظام حسني مبارك , 7 2 وفاة وردة الجزائرية , 8 2 الأردن تبعد 50 لاجئاً سورياً , 9 2 فرانسوا أولاند يتسلم رئاسة فرنسا من ساركوزي , 10 2 فرانسوا أولاند يتقدم على ساركوزي في النتائج المبدئية للانتخابات الرئاسية , 11 2 سكان الحدود التونسية يخترقون الحدود الجزائرية , 12 2 حزب التحرير: من يترقب الفرج من نتائج انتخابات العدو كمن يترقب الماء من النار , 13 1 ميدان السبعين 2012/5/21

jun 2012: 1 4 إعلان محمد مرسي رئيسًا لمصر , 2 3 صدور حكم على مبارك ووزير داخليته بالسجن المؤبد , 3 2 مسيرة شموع في الكرك , 4 2 الحكومة الأردنية تعتقل ناشطين سوريين , 5 2 وفاة السلحفاة العملاقة لونسام جورج , 6 2 تونس تسلم ليبيا رئيس الوزراء السابق , 7 2 فرار ثلاثة طيارين سوريين منشقين إلى الأردن , 8 2 محمد مرسي رئيسًا لجمهورية مصر العربية بعد الثورة , 9 2 الرئيس الأسد يشكل الحكومة السورية الجديدة برئاسة رياض حجاب , 10 2 طائرة مقاتلة تركية تختفي فوق المياه السورية , 11 2 أسانج يطلب اللجوء السياسي في سفارة الإكوادور بلندن , 12 2 الجيش الليبي يدخل بلدات غربي البلاد لوقف الاشتباكات , 13 2 النتائج غير الرسمية لجولة الإعادة في الانتخابات الرئاسية المصرية تظهر تقدم مرسي , 14 1 اليونسكو تضيف كنيسة المهد إلى قائمة التراث العالمي

jul 2012: 1 4 بدء الاقتراع بأول انتخابات ليبية منذ أكثر من نصف قرن , 2 3 تفجير مبنى الأمن القومي بدمشق يودي بحياة قادة أمنيين , 3 3 الرئيس المصري يعيد البرلمان المنحل , 4 2 تفاقم الأزمة بين بغداد وأربيل , 5 2 المرشح الجمهوري ميت رومني في إسرائيل وإيران على رأس المباحثات , 6 2 سيدا في أبو ظبي والمجلس الوطني يبحث تشكيل حكومة انتقالية , 7 2 أردوغان: من حق تركيا ملاحقة حزب العمال الكردستاني على الأراضي السورية , 8 2 واشنطن تتخوف من مجزرة في حلب , 9 2 الاتحاد الأوروبي: حزب الله ليس تنظيماً إرهابياً , 10 2 تركيا تستدعي قنصلها في حلب للتشاور , 11 2 بعد البوكمال، الجيش السوري الحر يسيطر على معبر ربيعة الحدودي بين سوريا والعراق , 12 2 جوبا تتهم الخرطوم بالاعتداء على أراضيها , 13 2 تمديد عمل بعثة المراقبيين في سوريا , 14 2 تعيين العماد فهد جاسم الفريج وزيرًا للدفاع السوري , 15 2 الحكومة السورية ترفع سعر زيت التدفئة (الديزل) , 16 2 الإمارات بدأت بشحن النفط بعيداً عن مضيق هرمز , 17 2 استمرار تهديد إيران بإغلاق مضيق هرمز , 18 2 الأركان التركية تستبعد أن المقاتلة أسقطها صاروخ سوري , 19 2 الإخوان المسلمون بالأردن يقاطعون الانتخابات البرلمانية , 20 2 أكثر من 200 قتيل في مجزرة التريمسة بسوريا , 21 2 هيومن رايتس واتش تشتبه باستخدام قنابل عنقودية في سوريا , 22 1 خلية طوارئ بالعراق لمساعدة اللاجئين السوريين

ago 2012: 1 3 انشقاق رئيس مجلس الوزراء عن نظام الأسد والمجلس الوطني يرحب , 2 3 اندلاع الاشتباكات الأعنف بين الجيشين السوري والأردني , 3 2 بورما تعلن إلغاء الرقابة على الإعلام , 4 2 سقوط طائرة مقاتلة للقوات الجوية السورية في المنطقة الشرقية , 5 2 إسرائيل توافق على طلب مصر بإدخال مروحيات قتالية إلى سيناء , 6 2 مجهولون يدمرون مسجداً بأمريكا , 7 1 الانتخابات العامة في أنغولا، والحزب الحاكم الأوفر حظاً

set 2012: 1 3 مقتل السفير الأمريكي في ليبيا بعد هجوم محتجين مسلحين على القنصلية في بنغازي , 2 3 سلسلة من التفجيرات في العراق تودي بحياة اكثر من 100 شخص , 3 3 «الحزب الكيبيكي» يفوز في الانتخابات البرلمانية العامة في ولاية كيبيك الكندية , 4 2 سيارة ذاتية القيادة في شوارع كاليفورنيا , 5 2 تايوان تدخل على الخط و تعمق الأزمة في الجزر المتنازع عليها بين الصين واليابان , 6 2 صدور مذكرات سلمان رشدي , 7 2 السجن 3 سنوات لأحمد نظيف بتهمة الكسب غير المشروع , 8 2 وفاة رائد الفضاء الأمريكي نيل آرمسترونغ عن 82 سنة , 9 2 الصفحة الرئيسية , 10 1 تركيا تهدد سوريا في حال تكرار النظام السوري تعديه على الحدود معها

out 2012: 1 3 انفجار في حي الأشرفية في قلب بيروت يوقع ثمانية قتلى على الأقل , 2 2 المعارضة الليتوانية تبدأ تشكيل الحكومة بعد فوزها في الانتخابات , 3 2 مقتل 41 شخصا على الأقل في تفجير انتحاري في مسجد في أفغانستان , 4 2 هيومن رايتس ووتش: قوات الأسد تستخدم الأسلحة العنقودية المحرمة دولياً , 5 2 جائزة نوبل للسلام يأخذها الاتحاد الأوروبي , 6 2 أمير الكويت يحل مجلس الأمة المعاد ويفتح الطريق لانتخابات برلمانية للمرة الثانية هذا العام , 7 2 البرلمان التركي يجيز التدخل العسكري في سوريا , 8 2 تفجيرات تهز حلب عاصمة سوريا الاقتصادية ووقوع أربعين قتيلاً , 9 2 مقتل قائد عمليات حزب الله في سوريا مع مجموعة من عناصره , 10 1 حكومة علي زيدان تنال ثقة المؤتمر الوطني العام الليبي

nov 2012: 1 2 تحطم طائرة عسكرية في صنعاء , 2 2 إسرائيل تقصف غزة , 3 2 خبراء يتوقعون ارتفاع معدلات الإصابة بسرطان الرئة بين النساء في بريطانيا , 4 2 الاتحاد الأوروبي يمنح مصر مساعدات بقيمة 6 مليار دولار , 5 2 فئران مدربة لضبط الممنوعات , 6 2 15 قتيلاً و80 جريحاً في تفجيرات في العراق , 7 1 الجمهوريون يعارضون تعيين سوزان رايس وزيرة للخارجية

dez 2012: 1 2 بارك كون هيه تفوز برئاسة كوريا الجنوبية , 2 2 إعلان الحداد في الولايات المتحدة بعد مجزرة نيوتاون , 3 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 4 2 الإعلان عن نتائج انتخابات الكويت , 5 1 هيلاري كلينتون في المستشفى إثر اشتباه إصابتها بخثرة دماغية

jan 2013: 1 3 صندوق النقد العربي يمنح السودان قرضاً لإجراء إصلاحات على القطاع المالي للحكومة , 2 2 حريق في ناد ليلي في البرازيل يقضي على أكثر من 200 شخص , 3 2 محمود عباس يوقع مراسيم باعتماد تسمية «دولة فلسطين» رسمياً , 4 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 5 2 النتائج الأولية للانتخابات الرئاسية في المكسيك , 6 1 الخارجية الإسرائيلية تسحب شريطاً دعائياً يظهر اختفاء قبة الصخرة

fev 2013: 1 5 تنحي بابا الكنيسة الكاثوليكية بندكت السادس عشر , 2 3 انفجار نيزك فوق مدينة تشيليابينسك بوسط روسيا , 3 3 تعيين خالد بن بندر أميرًا للرياض , 4 3 اغتيال المعارض التونسي شكري بلعيد : ترجيحات متعددة , 5 2 مقتل 19 شخصاً في سقوط منطاد في الأقصر من ارتفاع 300 متر , 6 2 فوز فيلم آرغو بجائزة أفضل فيلم في حفل الأوسكار لعام 2013 , 7 1 البرلمان السلوفيني يسحب الثقة من الحكومة ويكلف ألينكا براتوشيك بتشكيل حكومة جديدة

mar 2013: 1 3 مقتل الشيخ سعيد رمضان البوطي و49 آخرين بينهم حفيده في تفجير انتحاري في دمشق , 2 3 الكردينال الأرجنتيني خورخه ماريو بيرغوليو يصبح أول بابا من خارج أوروبا باسم فرنسيس الأول , 3 2 سامسونج تعلن عن هاتفها الذكي الجديد جالكسي إس 4 , 4 2 تشافيز يعلن عن نكسة السرطان ويسمي خليفة محتملاً , 5 1 ميشيل دجوتوديا يقطع عهداً بتسليم السلطة في 2016

abr 2013: 1 4 وفاة رئيسة وزراء المملكة المتحدة السابقة مارغريت تاتشر , 2 3 مقتل شخصين وإصابة 22 آخرين في انفجارين قرب نهاية خط ماراثون بوسطن , 3 3 مادورو يفوز برئاسة فنزويلا بفارق طفيف، وكابريليس يطالب بإعادة فرز الأصوات , 4 3 ظهور فيديو يُظهر لحظة اغتيال محمد رمضان البوطي , 5 3 إيران تدشن مجمعات لمعالجة أكسيد اليورانيوم , 6 3 إسرائيل تواجه أكبر عمليَّة قرصنة إلكترونيَّة يشنها نشطاء فلسطينيّون , 7 2 الروائي الكويتي سعود السنعوسي يفوز بالجائزة العالمية للرواية العربية عن روايته «ساق البامبو» , 8 2 الجيش السوري الإلكتروني يتبنى مسؤولية نشر خبر كاذب عن إصابة أوباما بجروح , 9 2 القضاء الفرنسي يفتح تحقيقاً في تهمة تلقي ساركوزي تمويلاً غير قانوني من القذافي , 10 1 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليام ألكسندر

mai 2013: 1 2 مقتل 46 في انفجار سيارتين في تركيا والقبض على 9 مشتبه بهم , 2 2 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليم ألكساندر , 3 2 وفاة الأسير الفلسطيني ميسرة أبو حمدية في مستشفى سوروكا الإسرائيلي , 4 1 مجلس الأمن يضم «جبهة النصرة لأهل الشام» إلى قائمة المنظمات الإرهابية

jun 2013: 1 3 أمير قطر يسلم السلطة لنجله , 2 2 اكتشاف ستة كواكب منها ثلاثة على الأقل صالحة للسكنى , 3 2 رفض محكمة فرنسية ادعاء التلاعب في شريط استشهاد الطفل محمد الدرة , 4 2 الجيش اللبناني يعلن سيطرته على مسجد بلال بن رباح والمربع الأمني للشيخ أحمد الأسير , 5 2 إشتباكات مسلحة بين الجيش اللبناني وأنصار الشيخ أحمد الأسير وعناصر من حزب الله , 6 2 بشار الأسد يصدر مرسومين بزيادة رواتب العاملين المدنيين والعسكريين ومعاشات المتقاعدين , 7 2 ديلما روسيف تعد بالإصلاحات ومكافحة الفساد استجابةً للاحتجاجات

jul 2013: 1 3 قطاع غزة يترنح بعد إغلاق مصر 80% من الأنفاق , 2 2 استئناف المفاوضات الفلسطينية الإسرائيلية , 3 2 العثور على تمساح نيل يافع في نهر بيروت , 4 2 توقيف المرافق الشخصي للشيخ أحمد الأسير , 5 2 العثور على مقابر جماعية لمقاتلي حزب الله في سوريا , 6 2 الأمير ويليام وزوجته الأميرة كيت يُرزقان بمولود ذكر , 7 2 علماء آثار إسرائيليّون يعتقدون باكتشافهم قصر النبي داود , 8 2 انفجار في موكب تابع لحزب الله على طريق بيروت-دمشق الدولية , 9 2 بنما توقف سفينة كورية شمالية للاشتباه بنقلها مكونات صواريخ , 10 2 تعيين محمد البرادعي رئيسًا للوزراء في مصر

ago 2013: 1 3 مجزرة كيميائية مُسنَدَة إلى القوات النظامية السورية في غوطة دمشق , 2 3 وفاة الداعية الإسلامي الكويتي عبد الرحمن السميط , 3 2 وزير الدفاع البريطاني يعلن عدم مشاركة بريطانيا في أي عمل عسكري في سوريا , 4 2 تداعيات وردود أفعال على مقتل 3 شبان فلسطينيين في مخيم قلنديا , 5 2 وكالة الاستخبارات المركزية الأمريكية تعترف بدورها في انقلاب إيران 1953 , 6 2 نائب الحاكم العسكري بمصر يأمر بوضع مبارك قيد الإقامة الجبرية , 7 2 اكتشاف نوع جديد من الثدييات في الأنديز , 8 2 انفجار يهز الضاحية الجنوبية لبيروت , 9 2 اختتام مؤتمر ويكيمانيا 2013 في هونغ كونغ , 10 1 سكايب يعمل على توفير خدمة المحادثة ثلاثية الأبعاد

set 2013: 1 2 خروج قطار بضائع عن القضبان واصصدامه بالرصيف بعد تجاوزه السرعة المقررة , 2 2 فوياجر 1 تجتاز حافة النظام الشمسي , 3 2 مصرع 3 موظفين بإحدى شركات الاتصالات وإصابة 8 في حادث تصادم بـالصحراوي , 4 1 اكتشاف أقدم معبد فينيقي في مدينة صور بلبنان

out 2013: 1 1 محافظ ينبع.. اثناء زيارته للمخيمات الشاطئية ينبع لاتقدر من يضيع وقته بالكلام

nov 2013: 1 2 الاتحاد الأوروبي يقرر تخفيض العقوبات على إيران , 2 2 الفيفا يقترب لحسم قراره بخصوص مونديال قطر , 3 1 الإتحاد الأوروبي يقرر تخفيض العقوبات على إيران

dez 2013: 1 2 ظهور جزيرة في بحر العرب بفعل زلزال الباكستان , 2 1 انفجار مديرية الأمن بالمنصورة

jan 2014: 1 2 فليتشر: لا نخاف من تشيلسي , 2 1 اليجري يرفض عرضا للتدريب في انجلترا

fev 2014: 1 2 الجيش الإسرائيلي يكشف نفقا يمتد من داخل القطاع الى الأراضي الإسرائيلية , 2 1 فيسبوك تستحوذ على تطبيق واتس آب مقابل 19 مليار دولار

mar 2014: 1 2 السعودية والإمارات والبحرين تسحب سفرائها من الدوحة

abr 2014: 1 2 بدء الانتخابات الرئاسية في أفغانستان , 2 1 \"إعلام الأزهر\"تنفذ مشروعاً عن\"النيل\"

mai 2014: 1 1 هجوم على منزل رئيس الوزراء الليبي

jun 2014: 1 1 الحزب الحاكم في يخسر الانتخابات العامة بالهند

jul 2014: 1 1 عيد الفطر 1435هـ

ago 2014: 1 1 بعثات من ناسا لدراسة آثار التغيرات المناخية في القطب الشمالي

set 2014: 1 1 الصحفي نت

out 2014: 1 1 واشنطن تأمل في استئناف مفاوضات السلام بين الفلسطينيين والإسرائيليين (دبلوماسيون)

nov 2014: 1 1 الشوق الى ادمان المخدرات

jan 2015: 1 2 طبخ أكبر طبق كشري في العالم , 2 1 القاعدة تعلن تشكيل فرع جديد لها وهو تنظيم القاعدة الالكتروني

fev 2015: 1 1 تقرير أممي: عبدالله صالح جمع أكثر من 60 مليار دولار من ممارسات فاسدة

mar 2015: 1 3 القاعدة تعلن تشكيل فرع جديد لها وهو تنظيم القاعدة الالكتروني , 2 1 معاون وزير الصحة في اليوم العالمي لمكافحة السل : انخفاض نسبة انتشار السل في سورية

abr 2015: 1 1 مصادر رسمية عراقية تعلن مقتل نائب رئيس الجمهورية العراقي السابق عزت الدوري

mai 2015: 1 1 افتتاح متحف «السيرة الهلالية» في ذكرى الأربعين لرحيل «الأبنودي» بقنا

jun 2015: 1 2 برهامي: لم نحسم أمرنا من دعم مرشح بعينه للانتخابات الرئاسية.. وسنختار الأكثر تدينًا , 2 1 السماح بزواج المثليين في الولايات المتحدة

jul 2015: 1 1 مستوطنون متطرفون يضرمون النار بمنزلين في نابلس، ووفاة رضيع محترقاً وإصابة أسرته بحروق بالغة.

ago 2015: 1 2 إسرائيل وراء تنظيم داعش (وثيقة سرية) , 2 2 مقتل أكثر من 100 مدني بقصف النظام السوري سوقاً في دوما , 3 2 الصفحة الرئيسية , 4 1 11 قتيلاً في حريق شرقي السعودية

set 2015: 1 3 عشرات القتلى بسقوط رافعة في الحرم المكي , 2 2 عشرات الوفيات ومئات الإصابات في سقوط رافعة بالحرم المكي , 3 1 بعد زوج عمته \"كيم جونغ أون\" يعدم وزير الدفاع

out 2015: 1 1 سقوط طائرة ركاب روسية في سيناء وأنباء عن وفاة جميع أفرادها

nov 2015: 1 1 إجراء أول اختبار ناجح في التاريخ لصاروخ حامل متعدد الاستعمالات ويهبط بنجاح

dez 2015: 1 1 مقتل 4اطفال و2مراتان على يد سفاح

jan 2016: 1 2 علماء فلك: لدينا أدلة قوية على وجود كوكب تاسع , 2 2 ميسي يفوز بجائزة الكرة الذهبية كأفضل لاعب في سنة 2015 , 3 1 اليابان تفوز بكأس آسيا لكرة القدم تحت 23 سنة وتتأهل برفقة كوريا الجنوبية والعراق إلى الألعاب الأولمبية

fev 2016: 1 3 انفجار في أنقرة يخلف ما بين 90 قتيل وجريح , 2 3 الانتخابات الأمريكية في نيو هامبشير: نصر لترامب وخيبة أمل لكلينتون , 3 2 إكتشاف حالتي إصابة بفيروس زيكا في فنلندا , 4 2 رئيس وزراء كندا جستن ترودو يعلن أن بلاده ستنهي عملياتها العسكرية ضد داعش في مطلع يوم 22 فبراير , 5 1 حفل جوائز الأوسكار ال88: ليوناردو دي كابريو يكسر عقدته ويفوز بجائزة أوسكار لأفضل ممثل، وسبوت لايت يفوز بجائزة أفضل فيلم

mar 2016: 1 2 الممثلة الفرنسية صوفي مارسو ترفض استلام وسام الشرف الفرنسي بسبب منحه لولي العهد السعودي محمد بن نايف , 2 2 ريال مدريد يعود لاكتساح منافسيه ويفوز على سلتا فيغو بنتيجة 7-1 , 3 2 اشتباكات في شمال الأردن بين الجيش ومسلحين إسلاميين يودي بعدة قتلى وجرحى , 4 2 الانتخابات الأمريكية: تقدم كل من هيلاري كلينتون ودونالد ترامب في انتخابات يوم الثلاثاء الكبير , 5 1 وفاة المهندسة المعمارية العراقية الأصل زها حديد عن عمر يناهز 65 سنة

abr 2016: 1 2 مصر تتنازل عن جزيرتي الصنافير وتيران للسعودية بعد توقيع إتفاقية بينهما , 2 2 تظاهرات في بريطانيا تطالب بإستقالة رئيس الوزراء البريطاني ديفيد كاميرون وإنتقادات للبي بي سي لعدم تغطيتها للمظاهرات , 3 2 مقتل عمال سوريين على يد تنظيم داعش , 4 1 دوري أبطال أوروبا: أتلتيكو مدريد يفوز على بايرن ميونخ في مباراة بهدف دون رد

mai 2016: 1 1 سيطرة الجيش السوري على مساحات واسعة من الغوطة الشرقية

jun 2016: 1 1 تدمير رتل لتنظيم داعش مكون من 150 عجلة

jul 2016: 1 2 فشل محاولة الانقلاب العسكري في تركيا، والتي قام بها مجموعة من الجيش التركي. , 2 1 تيريزا ماي تتولى رئاسة وزراء المملكة المتحدة خلفاً لديفيد كاميرون المستقيل.

ago 2016: 1 2 حملة فيسبوكية تطالب مومو بإرجاع الوسام , 2 2 رئيس حملة دونالد ترامب الانتخابية يعلن استقالته , 3 2 هداية ملاك تفوز بميدالية في أوليمبياد ريو , 4 2 استقالة أصغر وزيرة سويدية بعد ضبطها تقود تحت تأثير الخمر , 5 2 الطائرة العاملة بالطاقة الشمسيَّة سولار إمپلس تحط في أبو ظبي مُكملةً رحلتها حول الأرض , 6 2 انطلاق أعمال دورة تدريب مدربات في مجال التمكين السياسي للمرأة بالعاصمة اللبنانية بيروت , 7 1 زلزال يضرب وسط إيطاليا

set 2016: 1 1 بقنابل فسفورية

out 2016: 1 1 ياسمين نيار في الإستودي تسجل : راني مودرة

nov 2016: 1 2 الآثار في قطاع غزة.. الشاهد الأول على جذور التاريخ , 2 2 شركة \"IMI\" .. مصنعة ذخائر القتل والبتر , 3 2 جامعة الطائف: المدير التقى «المعترضين».. وعملية «التصحيح» تمت بشكل «حازم» , 4 2 \"خضوري\": الاحتلال الإسرائيلي اقتحم الجامعة 85 مرة , 5 2 غزة .. دعوات شبابية لاستمرار انتفاضة القدس , 6 2 أكثر من ربع \"الإسرائيليين\" يتهربون من الخدمة العسكرية , 7 2 مؤتمر بغزة يدعو لتعزيز صمود المقدسيين في وجه سياسة التهويد , 8 2 وقفة تضامنية مع شقيق الأسير مرعي أمام \"الخارجية الأردنية\" , 9 2 ليبرمان: يجب علينا التنسيق مع إدارة ترامب , 10 2 وزارة الأشغال الفلسطينية: تحركات خفية تعطل إعمار غزة , 11 1 اختراق بث القناتين العبريتين الثانية والعاشرة وإذاعة مقطع للأذان

dez 2016: 1 2 فنانة تشكيلية هولندية تحول منزلاً مدمراً إلى تحفة فنية بخانيونس , 2 2 400 ألف نازح من مدينة حلب , 3 1 جماهير \"الصفاقسي التونسي\" ترفع صورًا لـ\"الزواري\"

jan 2017: 1 2 بُعيد لقاء هنية.. أمير قطر يوعز بخطوات عملية لحل أزمة الكهرباء بغزة , 2 1 علماء: نقل سفارة أمريكا للقدس يأتي في سياق تهويد المدينة

fev 2017: 1 1 انطلاق عملية عسكرية لاستعادة الحديدة في اليمن

mar 2017: 1 2 توقيف 14 شخصا على خلفية الأحداث التي شهدها مركزا إمزورن وبني بوعياش بإقليم الحسيمة , 2 2 الاحتلال الإسرائيلي يغتال قيادياً بالقسام في غزة , 3 1 غزة تشتاق لمكة .. هاشتاج دعماً لحجاج ومعتمري غزة المحاصرين

abr 2017: 1 3 فوز مثير لريال مدريد على مضيفه بايرن ميونيخ في مباراة الذهاب لدوري الثمانية في دوري أبطال أوروبا , 2 2 إضراب في فلسطين تضامناً مع الأسرى , 3 2 الاحتلال الإسرائيلي يعتقل 14 فلسطينياً , 4 2 مستوطنون يعتدون على فلسطيني في جنين , 5 2 حملة لمطالبة بريطانيا بالاعتذار عن \"وعد بلفور\" , 6 2 مواجهات عنيفة مع الاحتلال الإسرائيلي في القدس , 7 2 83 مستوطناً يقتحمون المسجد الأقصى , 8 2 10 أيام على معركة \"الحرية والكرامة\" , 9 1 الصين تغزو القمر بـ\"قرية البشر\"

mai 2017: 1 2 توم كروز يكشف عن فيلم \"توب غان 2\" , 2 2 ترمب يقرّ بكشفه معلومات لروسيا , 3 1 عشرات المستوطنين يقتحمون الأقصى بحراسة جنود الاحتلال

jun 2017: 1 2 رفع أسعار الوقود للمرة الثانية في مصر منذ أقل من عام , 2 1 المانجا وأوراقها علاج للعديد من الأمراض

jul 2017: 1 2 في عام 2060.. الإسلام الأكثر انتشاراً في العالم , 2 2 الاتحاد العالمي لعلماء المسلمين يدعو إلى \"ثورة\" انتصاراً للأقصى , 3 2 تفاصيل ميدانية خطيرة تحدث بالمسجد الأقصى , 4 2 قطر تستنكر منع الاحتلال \"الإسرائيلي\" صلاة الجمعة في المسجد الأقصى , 5 1 روسيا تطرد 755 دبلوماسياً أميركياً

ago 2017: 1 3 الأطعمة التي لا تفسد أبداً , 2 3 مصر تغلق معبر رفح بعد فتحه استثنائيّاً للحجاج , 3 2 إهانات وسب الرسول والإسلام وعربدة للمستوطنين بالخليل , 4 2 القطعة النقدية التي جعلت نتنياهو سخرية , 5 2 تحذير من الوقوع في مصيدة شبكات \"واي فاي\" المجانية , 6 2 حجاج بيت الله يتوافدون على منى لقضاء يوم التروية

set 2017: 1 3 حملة في إفريقيا ضد التطبيع مع الاحتلال الإسرائيلي , 2 2 قصف روسي/سوري يودي بحياة عشرات المدنيين بسوريا , 3 2 برشلونة تؤكد أنها ستجري انتخابات الاستقلال حتى دون صناديق , 4 2 روبوت ذكي يساعد على اتخاذ القرارات السياسية , 5 2 مايكروسوفت وفيسبوك تمدان كابل إنترنت بحري ضخم , 6 2 أنجيلا ميركل تدعو إلى تصنيف دول المغرب العربي دولا آمنة , 7 2 مغنية \"إسرائيلية\" تستعد للمشاركة بحفل \"طنجة جاز\" بالمغرب , 8 2 البرلمان الأوروبي يدعو إلى وقف أعمال العنف ضد الروهينغا , 9 1 بعد 18 عاماً.. السودان يعود إلى التوقيت الدولي

out 2017: 1 3 الاحتلال يعتقل أكثر من 50 فلسطينياً شرق القدس , 2 2 قوة \"إسرائيلية\" خاصة تخطتف شابين شمال القدس المحتلة , 3 2 7 شهداء في قصف \"إسرائيلي\" على غزة , 4 2 الاحتلال يعتقل فتى وفتاة من الخليل والقدس , 5 2 رسالة للمستخدمين الجدد , 6 2 تايلاند تمنع التدخين على شواطئها , 7 2 دخول رتل من القوات الخاصة التركية إلى إدلب , 8 2 الكويت تأمل بحل الأزمة الخليجية قبل القمة المقبلة , 9 2 جيش الاحتلال يدرب الدلافين على مهمات عسكرية , 10 2 الاحتلال يمنع رفع الأذان في مسجد بالخليل , 11 2 مخطط \"إسرائيلي\" لبناء آلاف الوحدات الاستيطانية في فلسطين , 12 2 إصابة 17 فلسطينياً في مواجهات مع الاحتلال بالضفة وغزة , 13 2 \"ناسا\" تسند إدارة مشروع اكتشاف زحل لـ عالمة فلسطينية , 14 2 حكومة إسبانيا تعتذر رسميا للمصابين في استفتاء كاتالونيا , 15 2 الاحتلال الإسرائيلي يقوم بحملة اعتقالات بالضفة والقدس , 16 1 استشهاد فلسطيني وإصابة شقيقته برصاص الاحتلال قرب رام الله

nov 2017: 1 3 قتلى وجرحى بزلزال على الحدود الإيرانية العراقية , 2 3 السعودية تعلن اعتقال أكثر من مئتين واختلاس 100 مليار دولار , 3 3 إصابة فلسطينيين برصاص الاحتلال شرق غزة , 4 2 \"الوزاري العربي\" يدين حزب الله ويحيل ملف إيران لمجلس الأمن , 5 2 \"أونروا\" تزيل صور القدس وخارطة فلسطين من مدارسها , 6 2 تعرف على كيفية قراءة الرسائل المحذوفة على واتس آب , 7 2 الإليزيه: الحريري يصل باريس غداً السبت , 8 2 ترامب: كل الخيارات مطروحة للتعامل مع كوريا الشمالية , 9 2 الإعلان عن فتح معبر رفح لمدة 3 أيام الأسبوع القادم , 10 2 حكم ثاني بالمؤبد ضد مرشد الإخوان بمصر , 11 1 تحذير أممي من كارثة إنسانية في اليمن

dez 2017: 1 3 مقتل علي عبدالله صالح , 2 3 قانون \"إسرائيلي\" يتيح مقاضاة من يكشف انتهاكاتهم ضد الفلسطينيين , 3 2 مجلس الأمن يقر عقوبات جديدة ضد بيونغ يانغ , 4 2 شهيد جديد خلال مواجهات مع الاحتلال \"الإسرائيلي\" شمال غزة , 5 2 ثلثا دول العالم تصوت لصالح القدس , 6 1 فعاليات في جامعات ماليزية نصرة للقدس

jan 2018: 1 3 مقتل 19 امرأة في تدافع أثناء توزيع مساعدات بالمغرب , 2 2 رئيس حزب الغد ينضم لسباق الرئاسيات المصرية , 3 2 توقف مشافي غزة عن العمل بسبب نفاد الوقود , 4 2 وفاة والدة رئيس الإمارات , 5 2 13 مليون جنيه تكلفة نقل تمثال مصري , 6 2 السعودية تغلق ملف التسويات المتعلقة بقضايا الفساد قريباً , 7 2 جزائرية تدخل موسوعة غينيس بتأليف أضخم كتاب , 8 1 رهبان تيبحيرين شهداء لدى الفاتيكان

fev 2018: 1 3 تتويج المنتخب المغربي بكأس بطولة إفريقيا للاعبين المحليين , 2 2 الجزائر: عبد العزيز بوتفليقة يعين أحمد أويحيى رئيسا للحكومة خلفا لعبد المجيد تبون , 3 1 اضطرابات جوية على أنحاء العالم العربي

mar 2018: 1 2 إذاعة للأمهات العازبات في المغرب , 2 2 اعتقال قائد عمليات تنظيم داعش في أفغانستان , 3 2 لمواجهة الوحش السيبيري الشرقي، المملكة المتحدة تستدعي الجيش , 4 2 أبو ماجد كرمان، عم الثورة التي رواها بدماء عائلته واختطفته النصرة , 5 2 أذربيجان: فرصة نادرة لشباب المعارضة للاحتجاج , 6 2 أشياء مريبة تحدث على فيسبوك! , 7 2 أزمة الأطفال في سوريا: طرق المساعدة , 8 2 أطلال قرية يمنية يهودية مهجورة , 9 2 آراء أفريقية في فيلم “تمبكتو” الذي صوّر الحياة تحت حكم المتشددين الإسلاميين , 10 2 أحمد الموسى، الصحفي المستقل الفائز بجوائز، يلقى حتفه في إدلب بسوريا , 11 2 أردوغان يتوعد بالقضاء على تويتر في تركيا , 12 2 26 أكتوبر: يوم لكسر الحظر السعودية على قيادة النساء , 13 2 أضرار تحلّ بأكبر بحيرة في إثيوبيا بسبب عشب مائي يهدّد بقاءها كمصدر رزق طبيعي للحياة , 14 2 أستراليا: القبض على صحفي من أجل صورة على فيسبوك , 15 2 FreeAccess Plus!: التفاف على الحجب , 16 2 3 سنوات سجن لمصري سخر من السيسي بتصويره كميكي ماوس , 17 2 هندية تصنع هدايا ورقية صديقة للبيئة تتحول لنباتات , 18 2 أرض بلا صاحب: خطف الصحفيين يزداد سوء في سوريا , 19 2 أرز ممزوج بالكادميوم في فضيحة غذائية أخرى في الصين , 20 2 أرمينيا: مباراة كرة قدم غير مسبوقة , 21 2 أبجد: مبادرة تعليمية لتعويض طلاب مدارس اليمن ما فاتهم بسبب الحرب , 22 2 أزمة في صباح بعد اشتباك ماليزيا مع قوات فلبينية مسلحة , 23 2 Put It On: منافسة عالمية على الانترنت لصناع الأفلام , 24 2 أبيتا – فيلم رسوم متحركة قصير عن أطفال فوكوشيما , 25 2 أطفال فنانون في أكبر مخيم للاجئين السوريين

abr 2018: 1 2 تحطم طائرة عسكرية في بوفاريك قرب العاصمة , 2 2 فيسبوك يوفر ميزة العثور على إنترنت مجاني للمستخدمين , 3 1 نجوم الدبليو دبليو إي سيحضرون في السعودية

mai 2018: 1 2 فوز مثير لريال مدريد على مضيفه بايرن ميونيخ في مباراة الذهاب لدوري الثمانية في دوري أبطال أوروبا , 2 1 أوروبا

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 9 de junho 2018 12:07

Dump file arwikinews-20180601-stub-meta-history.xml.gz (edits only), size 5.9 Mb as gz -> 48 Mb
Dump processed till May 31, 2018, on server stat1005, ready at Sat-02/06/2018-22:50 after 22 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.