Estatísticas da Wikinotícias árabe

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2016
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2016+2%   +1%   +100%      0%
jul 2016+3%   +1%   -21%      0%
jun 20160%   +1%   +133%      0%
mai 20160%   +1%   -58%      0%
abr 2016+2%   +1%   -64%      0%
mar 20160%   +3%   -18%      +4%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 20166115 2,5 k15,3 88      380
jul 20166021 2,5 k15,3 44      379
jun 201658 1 2,5 k15,4 56      379
mai 201658 1 2,4 k 5,4 24      378
abr 20165813 2,4 k15,4 57      378
mar 201657 212,4 k25,4 157      377
fev 201657 212,3 k25,5 192      362
jan 201657 1 2,3 k 5,5 26      352
dez 201557 3 2,3 k 5,6 28      352
nov 201557 1 2,3 k15,6 52      352
out 201557 1 2,2 k 5,6 26      352
set 201557 3 2,2 k15,7 51      352
ago 2015571312,2 k15,7 937      351
jul 20155622 2,2 k15,3 56      349
jun 20155421 2,1 k15,4 63      349
mai 201552 1 2,1 k25,4 66      349
abr 201552 2 2,0 k15,5 60      347
mar 201552 1 2,0 k15,61624707,6 Mb548 k1,1 k70784,2 k347
fev 20155211 2,0 k15,71625537,6 Mb547 k1,1 k70784,2 k347
jan 20155122 1,9 k15,716251257,5 Mb546 k1,1 k70784,2 k346
dez 20144911 1,9 k15,81629397,3 Mb543 k1,1 k70784,2 k345
nov 201448 1 1,9 k15,81629327,3 Mb542 k1,1 k70744,2 k345
out 201448   1,9 k 5,8162997,3 Mb543 k1,1 k74744,2 k345
set 201448   1,9 k 5,91629137,3 Mb543 k1,1 k74744,2 k345
ago 201448 1 1,9 k 5,91728167,6 Mb576 k1,1 k74744,2 k345
jul 20144813 1,9 k15,91729467,6 Mb575 k1,1 k73734,2 k345
jun 20144722 1,8 k 5,91733347,5 Mb572 k1,1 k737 4,2 k344
mai 20144512 1,8 k161735587,5 Mb571 k1,1 k737 4,2 k343
abr 20144424 1,8 k3617451107,4 Mb569 k1,1 k737 4,2 k341
mar 20144211 1,7 k 6,31647286,9 Mb534 k1,1 k737 4,2 k341
fev 201441   1,7 k 6,31650246,8 Mb532 k1,1 k737 4,2 k341
jan 20144112 1,7 k16,31653396,8 Mb531 k1,1 k737 4,1 k338
dez 20134011 1,7 k 6,31659176,8 Mb528 k1,1 k737 4,1 k337
nov 20133911 1,7 k 6,31659196,8 Mb527 k1,1 k737 4,1 k337
out 20133813 1,7 k 6,41660466,8 Mb525 k1,1 k737 4,1 k336
set 201337 3 1,6 k 6,41661356,7 Mb524 k1,1 k737 4,1 k336
ago 2013371511,6 k16,416611686,7 Mb522 k1,1 k720 4,1 k336
jul 2013361311,6 k16,516571576,5 Mb512 k1,1 k686 4,0 k331
jun 201335 411,6 k16,516471916,4 Mb501 k1,1 k655 3,9 k329
mai 201335 111,5 k16,516321666,2 Mb486 k1,1 k614 3,8 k327
abr 2013351311,5 k16,616303546,1 Mb476 k1,1 k588 3,7 k325
mar 201334 111,5 k16,516292065,9 Mb461 k1,1 k515 3,6 k320
fev 2013341211,4 k16,516242635,8 Mb452 k1,1 k459 3,5 k316
jan 201333 111,4 k16,416183845,7 Mb439 k1,1 k409 3,4 k314
dez 201233 211,4 k16,316171905,5 Mb427 k1,1 k389 3,3 k308
nov 2012332211,3 k16,416142055,4 Mb415 k1,0 k353 3,2 k306
out 201231 211,3 k16,416187375,3 Mb409 k1,0 k344 3,1 k302
set 2012311411,2 k1616153255,1 Mb401 k1,0 k32013,0 k299
ago 201230 311,2 k15,916161565,0 Mb386 k99430312,9 k295
jul 2012301421,2 k2616133464,9 Mb374 k99030012,8 k290
jun 201229 311,1 k1616082184,6 Mb353 k97028912,6 k282
mai 2012291211,1 k1616092354,4 Mb339 k96328012,5 k273
abr 20122812 1,0 k16,11618744,3 Mb326 k95126712,4 k265
mar 201227 1 999 6,11615124,2 Mb320 k935264 2,3 k265
fev 20122712 991 6,11617244,2 Mb319 k935264 2,3 k265
jan 20122611 984 6,216101104,2 Mb316 k935264 2,3 k265
dez 201125   982 6,11612594,1 Mb316 k935264 2,3 k265
nov 201125 1 982 61613204,1 Mb316 k93525912,3 k264
out 20112522 971 61612574,1 Mb314 k935259 2,3 k264
set 201123   958 6,11626244,1 Mb313 k934238 2,3 k255
ago 201123 1 952 6,11626204,1 Mb313 k934238 2,3 k255
jul 201123 2 944 6,116283134,0 Mb313 k934238 2,3 k253
jun 20112312 93815,81601624,0 Mb313 k93424042,3 k246
mai 201122 3192025,915925263,9 Mb306 k84624042,3 k242
abr 20112212 84825,713371092,8 Mb232 k2,7 k24042,2 k239
mar 20112123278526,110795302,2 Mb176 k1,4 k24041,6 k239
fev 201119 1 711 6780141,5 Mb116 k199219 880227
jan 201119   703 6780131,5 Mb116 k199218 880227
dez 201019   703 6780121,5 Mb116 k199217 880227
nov 201019   702 677851,5 Mb115 k199218 880227
out 201019   701 677921,5 Mb115 k199216 880227
set 201019   701 677921,5 Mb115 k199215 880227
ago 201019   700 677991,5 Mb115 k199215 880227
jul 201019 1 694 6778111,5 Mb115 k199215 879227
jun 201019 2 691 6779421,5 Mb115 k199215 877226
mai 201019 1 684 6785481,4 Mb115 k194168 874225
abr 201019   676 6785131,4 Mb114 k193168 866223
mar 201019   675 678511,4 Mb114 k193169 865222
fev 2010191  675 6780121,4 Mb113 k193197 862222
jan 201018 1 672 6783121,4 Mb113 k192197 862222
dez 200918 1 669 6783151,4 Mb113 k188197 859219
nov 200918   668 6784131,4 Mb113 k188194 858218
out 200918   666 6785281,4 Mb113 k188194 858217
set 20091813 661 67813831,4 Mb112 k188194 856217
ago 20091713 65415,57861611,4 Mb111 k18619121852210
jul 20091614 62325,57932421,3 Mb106 k18417221821194
jun 200915 4 56915,67742031,2 Mb93 k18116420763165
mai 200915 3 54215,57661481,1 Mb88 k18214220728161
abr 20091538350655,67527721,0 Mb81 k17912526692154
mar 200912410236875,69001,3 k788 kb63 k166982755648
fev 2009822116624,91071247411 kb32 k158521034619
jan 20096   106 5,310732254 kb19 k1044892978
dez 20086   106 5,31073 255 kb19 k1044892978
nov 20086 1 106 5,3107319255 kb19 k1044892978
out 20086   99 5,410771229 kb19 k1034892978
set 20086 1 98 5,5107734226 kb19 k1034892978
ago 20086   97 5,211902224 kb17 k1034891278
jul 20086   97 5,21190 224 kb17 k1034891278
jun 20086   97 5,211903224 kb17 k1034891278
mai 20086   97 5,11190 224 kb17 k1034091278
abr 20086   97 5,111903224 kb17 k1034091278
mar 20086   96 5,21197 223 kb17 k1034081268
fev 20086   96 5,211971223 kb17 k1034081268
jan 20086   96 5,111971223 kb17 k1034081268
dez 20076 1 96 5,1119726223 kb17 k1034081268
nov 20076 1 92 5,1123430215 kb16 k30408927
out 20076   91 4,812092208 kb16 k30318917
set 20076   90 4,81209 207 kb16 k30318917
ago 20076   90 4,81209 207 kb16 k30318917
jul 20076 1 90 4,8120959207 kb16 k30318917
jun 20076   90 4,210392207 kb11 k30318987
mai 2007611 90 4,2103927207 kb11 k30318987
abr 2007512 8014,31145117189 kb10 k19318767
mar 2007411 58 4128860155 kb8,9 k7318134
fev 20073   58 2,912804152 kb9,4 k7278142
jan 20073   57 2,912693149 kb9,2 k5278142
dez 20063   55 312721141 kb9,0 k5278142
nov 20063   54 312721140 kb9,0 k5278142
out 20063   54 31272 140 kb9,0 k5278142
set 20063   54 312722140 kb9,0 k5278142
ago 20063   53 3126041137 kb8,7 k5279132
jul 20063   49 2,41319 116 kb9,0 k52710132
jun 20063   49 2,413194116 kb9,0 k52710132
mai 20063   47 2,413192114 kb9,0 k52710132
abr 20063   47 2,413194114 kb9,0 k52710132
mar 20063 1 47 2,3131411113 kb8,9 k52710132
fev 20063 1 44 2,2131514107 kb8,7 k52710122
jan 20063   42 212868101 kb8,3 k52710122
dez 2005332 3911,911157586 kb7,0 k11235182
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 201612516 151017 14      20
abr 20161268 15917 11      20
jan 201612 15 15 16 14      20
out 201512 14 15 16 15      20
jul 201513412 15917 11      20
abr 201513 14 151016 13      20
jan 2015133128151116111014151118201520
out 20141410188151116111814151118201520
jul 2014148127151016111414141118201520
abr 201416510515216111014141118201420
jan 2014168147151016111413141118201420
out 2013177108151215111413141118201320
jul 2013189139151115111313141118201320
abr 2013171015915141510913141118201320
jan 20131710161016131410813141120201420
out 201217914716131310413151120201420
jul 2012178941691410913151120201520
abr 20121771310171314101313151120201620
jan 201217111812161516161512141020201520
out 2011178171216151616171213920201420
jul 20111811161015141414101212920201220
abr 201118816111491414141315619201220
jan 201118141813141514141816171619201820
out 20101781710141413131715171618201720
jul 201016111511141313131515171618191720
abr 20101611187141213131815171618191620
jan 20101612158141213131715171518191620
out 200916111711141313131615171518191620
jul 20091611111014813131015171518171620
abr 2009166831541212517171517161720
jan 200917141710171312121717171517161719
out 200817141512171512121717171517161719
jul 200817121713171411111817171517161719
abr 2008179159171311111717171316161719
jan 200816131713161610101716161316161619
out 200716111410161310101416161416141617
jul 20071610139161110101116161416141617
abr 20071691271611991016161516141616
jan 200716101691611991616161616141616
out 200616101461611881516161616141616
jul 200616101481610881516161616141616
abr 200615101381510771515151415131516
jan 2006141314101312771413141214121415
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  5  10  100  1000 
ago 2016115531    165221    111 249722      
jul 201610311     62       111 2051        
jun 20161211      741      111 2342    11  
mai 2016921      111       111 15432       
abr 201643311    1143      111 229431      
mar 2016532111    82       111 184221      
fev 2016732111    411      111 226211      
jan 20164111     121       111 19211       
dez 2015733      92       111 1773        
nov 201593111    10        111 18332       
out 20156111     9111     111 164211  211 
set 20151553      1453111   111 2210421  31  
ago 201515633211111197422111111  3186221 1111
jul 201516322     73211        256111      
jun 201513411     63111        14441       
mai 201513211     4            1621        
abr 20151352      71       222 1321    11  
mar 20151331      101       111 19421       
fev 201515311     102           257421      
jan 201514321     7311         2642        
dez 201410111     521111       1431        
nov 20141211      31           111         
out 201471      3            931        
set 20144       41           111         
ago 2014411      3            175321  211 
jul 20146432     73111        9532   1   
jun 20146222     211111       9221   21  
mai 20147321     1            112         
abr 2014281042     2            1851    1   
mar 20146211     522          1022    11  
fev 201484      51           1353    11  
jan 20147321     11           11422   11  
jul 201610311     62       111 2051        
abr 201643311    1143      111 229431      
jan 20164111     121       111 19211       
out 20156111     9111     111 164211  211 
jul 201516322     73211        256111      
abr 20151352      71       222 1321    11  
jan 201514321     7311         2642        
out 201471      3            931        
jul 20146432     73111        9532   1   
abr 2014281042     2            1851    1   
jan 20147321     11           11422   11  
out 20138431     41           15511   11  
jul 2013633211 1  211      11  1243211 331 
abr 20131143311 11 105411    111 21421111221 
jan 20137111111   3111     111 8321111221 
out 2012622211111183331    111 15533111332 
jul 2012844332    75443    11  2588632122  
abr 201263211    532      111 147531  11  
jan 201222111             111 81111  11  
out 201110222     32211        132         
jul 201183211 11132221    1   134221  111 
abr 201163222    3            1843    22  
jan 2011     11 11111    11  1133    22  
out 20102       1            121     32  
jul 2010411                   911        
abr 201011      51111    111 144     221 
jan 2010311      111111       83331      
out 200943   11 21111        83221  1   
jul 2009125443    114321        2384441 11  
abr 20091598533111 15753111      2698541 221 
jan 2009        4            1043        
out 20081       1            1352        
jul 2008                     7431       
abr 20081       1            51111      
jan 2008        3            41         
out 2007        2            631        
jul 200711111    11           52111      
abr 200722221 11 62222        733221 11  
jan 2007                                
out 2006                     1          
jul 2006                     31         
abr 2006        1            4          
jan 20064       2            2          

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1412100.0%10,454100.0%
311828.6%10,05296.2%
106114.8%9,73693.1%
32235.6%9,04886.6%
100102.4%8,19478.4%
31651.2%7,34570.3%
100041.0%6,96066.6%
316210.2%3,19930.6%

 

11 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
CommonsDelinkerUC21 044225-set 16, 20092540----
عدنان حليمUC22+3804342141135jun 13, 20167854--
IzoozoUC23+133312120119jul 15, 201646155--
Marwa Ahmed AtiaUC40+202010115jun 15, 20167685--
جبار محسنUC72+33476--jun 30, 2016611---
Mohamed MF007UC73...77--ago 08, 20162255--
ع و س ج مUC82+186123-jun 24, 201667----
WqazsxUC139+5031--ago 09, 201538731--
علاءUC202...2221ago 08, 201622----
أنسUC411...1155ago 20, 20161011--
AKHBAR4UC412...111-ago 21, 2016911--

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
PICAWNUC13,199abr 17, 20121596jul 04, 2014788
SeHUC21,418fev 14, 20092754jun 02, 20102281
Meno25UC31,274mar 22, 20073449fev 11, 2016201
CiphersUC41,069fev 21, 20092747fev 20, 20131287
FPPUC5385abr 15, 2015503jul 29, 201632
خلدون شنتوتUC6279mar 05, 20112005mai 10, 20111939
AzitonyUC7177jun 23, 20121529nov 13, 20131021
عباد ديرانيةUC8148mai 11, 20111938set 15, 20131080
Mo7amedsalimUC9142mar 02, 20092738ago 19, 20092568
روخوUC10103nov 18, 20092477jan 07, 20121697
وليد شرف الدينUC1197abr 24, 20111955mai 18, 20111931
OsamaKUC1292abr 02, 20073438dez 24, 20073172
محمد أحمد عبد الفتاحUC1390dez 21, 20073175mar 15, 2016168
براق سالمUC1481mar 23, 20092717mar 30, 20092710
عماد الدين المقدسيUC1580ago 05, 2015391dez 09, 2015265
Mr. IbrahemUC1673mai 14, 20131204nov 19, 2015285
باسمUC1762fev 11, 20131296nov 14, 2015290
لا روساUC1857set 05, 20131090nov 13, 2015291
Ash2005~arwikinewsUC1951dez 13, 20053913dez 20, 20053906
AvocatoUC2051mai 12, 20111937ago 11, 20121480

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 769 edições foram feitas por usuários anônimos, de um total de 13270 edições ( 5e %)
  


17 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
MenoBotUC11,166set 29, 20092527jan 23, 2014950--
CipherBotUC2191mar 27, 20092713mai 05, 20111944--
XeBotUC3179mar 23, 20092717jul 18, 20092600--
YiFeiBotUC4139ago 09, 2015387set 09, 2015356--
AvocatoBotUC5118jul 28, 20111860jul 26, 20131131--
TrBotUC676mar 08, 20092732mar 15, 20092725--
OKBotUC737abr 03, 20073437dez 26, 200731701-
VolkovBotUC834abr 17, 20092692abr 15, 20131233--
SahimrobotUC931mai 20, 20111929mai 20, 20111929--
GrondinBotUC1022mai 17, 20092662out 31, 20131034--
MjbmrbotUC1115nov 12, 20102118mar 14, 20111996--
KamikazeBotUC1212dez 17, 20111718dez 18, 20111717--
JAnDbotUC134jun 13, 20131174ago 13, 2014748--
AlexbotUC142jun 06, 20083007jun 20, 20082993--
DorganBotUC151jun 07, 20083006jun 07, 20083006--
K.J.BotUC161jan 26, 20102408jan 26, 20102408--
AmirobotUC171mar 13, 20111997mar 13, 20111997--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPng
ago 20162,9 k7667415170727292,4 k44483     212
jul 20162,9 k7527155170711282,4 k44481     212
jun 20162,8 k7477145170710282,4 k44475     212
mai 20162,8 k7397055170709282,3 k44470     212
abr 20162,8 k7327045170708282,3 k44462     212
mar 20162,8 k7247005170708282,3 k44448     212
fev 20162,7 k7226965170707282,3 k43431     212
jan 20162,6 k7226945170704282,2 k43414     212
dez 20152,6 k7166925170702282,2 k43407     212
nov 20152,6 k7066925170699282,2 k43403     212
out 20152,6 k7016915170697282,2 k42390     212
set 20152,6 k7006905170688282,1 k42381     212
ago 20152,5 k6916885170687282,1 k42372     212
jul 20152,5 k6846765170681282,1 k42356     212
jun 20152,5 k6766705170665272,1 k42349     212
mai 20152,4 k6716635170664272,1 k42339     212
abr 20152,4 k6706595170664272,1 k42328     212
mar 20152,4 k6646585170664272,1 k42313    27212
fev 20152,3 k6576575170664272,1 k42302    38212
jan 20152,3 k6476555170659272,1 k41293    41212
dez 20142,3 k6366525170659272,1 k41277    20212
nov 20142,2 k6306495170658272,1 k41266    18212
out 20142,2 k6276485170658272,0 k41255    9212
set 20142,2 k6246485170656272,0 k41252    6212
ago 20142,2 k6176475170656272,0 k41248    10212
jul 20142,2 k6136465170654272,0 k41246    45212
jun 20142,2 k6116455170652262,0 k41242    33212
mai 20142,2 k6106445170652262,0 k41241    31212
abr 20142,1 k6086435170652262,0 k41241    77212
mar 20142,0 k6026425169652262,0 k41235    23212
fev 20142,0 k5986415169651262,0 k41234    23212
jan 20142,0 k5916335169651262,0 k41232    37212
dez 20132,0 k5846325169650262,0 k41231    16212
nov 20132,0 k5816315169650262,0 k41230    19212
out 20132,0 k5736305169649262,0 k41230    31212
set 20132,0 k5676295169649262,0 k41225    32212
ago 20132,0 k5516285169648262,0 k41222    160212
jul 20131,9 k5466275169645261,9 k41220    147212
jun 20131,9 k5406245169637251,9 k41220    188212
mai 20131,9 k5396235169629251,9 k41218    152212
abr 20131,8 k5366205167613251,8 k41214    317212
mar 20131,8 k5286165166584251,7 k41209    183212
fev 20131,7 k5176125161578251,7 k41207    253212
jan 20131,7 k5086105161564251,6 k41203    380212
dez 20121,7 k5046065159519251,5 k41198    189212
nov 20121,6 k4986005159505241,4 k41198    204212
out 20121,6 k4975975159498241,4 k41195    361212
set 20121,5 k4845805158424231,2 k41191    303212
ago 20121,5 k4725675155373221,2 k41185    156212
jul 20121,5 k4655595155358221,1 k40178    333212
jun 20121,4 k4575474153346211,1 k40171    213112
mai 20121,3 k4485444152333211,0 k40162    228112
abr 20121,3 k44154141523272094640153    72112
mar 20121,3 k43553741523262092338147    7112
fev 20121,3 k43353741523262092338147    21112
jan 20121,2 k42453741523262092238146    105112
dez 20111,2 k41953541522952091336146    2112
nov 20111,2 k41553541522952091336145    16112
out 20111,2 k40153541522942091336144    55112
set 20111,2 k39353541522942091336140    8112
ago 20111,2 k38653541522941991336138    17112
jul 20111,2 k37953541522921990036137    74112
jun 20111,2 k36453441522881987836135    37112
mai 20111,2 k35453441522861986536135    483112
abr 20111,1 k35053241522851885736134    104112
mar 20111,0 k33852841522851885235134    373112
fev 201193833451131522791884335132    10111
jan 201193032950831522791884335131     111
dez 201093032450731522781884335130    4111
nov 201092931950631522781884135127    1111
out 201092831650631522781884135124    2111
set 201092831250631522781884135122    2111
ago 201092730550631522781884135120    5111
jul 201092128850431522761884133116    9111
jun 201091728750431522751884033115    29111
mai 201090925950431522751883533107    38111
abr 201089925843031502741882733104    4111
mar 201089724942831502741882533102    1111
fev 20108972434263150274188253396    6111
jan 20108942344083150274188213393    11111
dez 20098882193903143270188203390    8111
nov 20098862143903143270188203388    7111
out 20098832123283143270188203383    12111
set 20098782122973143270188203278    55111
ago 20098642052661143270188163271    137  1
jul 20098172022621143265187963255    232  1
jun 20097341941911141259167722135    120  1
mai 20097031891901141254167561425    139  1
abr 20096601841331141251167331315    725  1
mar 20094161461321141204166801110    938  1
fev 2009185130571132176136009     239  1
jan 2009114116291132148101402        1
dez 200811411429113214810139         1
nov 200811411329113214710139      8  1
out 20081079829113214710139      1  1
set 20081068529113214710139      34  1
ago 20081058129112913910123      2  1
jul 20081057627110912710123         1
jun 20081057627110112710123         1
mai 2008105672714312710123         1
abr 2008105652713312710123      2  1
mar 2008104632712212610123         1
fev 2008104562712212610123         1
jan 2008104492712212610123         1
dez 2007104472712212610123      11  1
nov 200799402612212310123      28  1
out 200798402612212310120         1
set 200797392612212010120         1
ago 200797382612212010120         1
jul 200797362612211910120      59  1
jun 20079735261221061117      2  1
mai 200797352512261178      26  1
abr 200787292512143178      94  1
mar 20076224191151812      58  1
fev 2007601714131512      3  1
jan 2007591514131512         1
dez 2006571514131512         1
nov 2006561414131512         1
out 2006561414131512         1
set 2006561313131512         1
ago 2006551313131512         1
jul 2006511113131412         1
jun 200651913121411         1
mai 200649913121411         1
abr 200649913121411         1
mar 200649713121411      6  1
fev 20064671312141          1
jan 20064471212131          1
dez 2005417121213           1

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 3 الصفحة الرئيسية , 2 2 صدام حسين هل يدلي بصوته بالسجن اليوم؟ , 3 2 تحت شعار \"الدفاع عن الإسلام\" قمة مكة تختتم أعمالها , 4 1 خدام ينشق عن النظام البعثي السوري

jan 2006: 1 2 حماس تحصل على أغلبية الأصوات في الانتخابات التشريعية الفلسطينية

fev 2006: 1 1 أزمة الرسوم الكاريكاتورية المسيئة للنبي محمد

mar 2006: 1 1 الجيش الإسرائيلي يحاصر سجن أريحا لمدة 11 ساعة

fev 2007: 1 1 منتدى الحوار الأمريكي الإسلامي

mar 2007: 1 1 ضغوط أميركية لإقالة وزير الداخلية العراقي بعد فضيحة تعذيبه لمئات المعتقلين

abr 2007: 1 2 جنبلاط يدعو كل اللبنانيين لصد العدوان و تحرير الأرض , 2 2 بيان قمة مجلس التعاون الخليجي يحث سوريا على التعاون مع الأمم المتحدة , 3 1 آخر الأخبار/30 أبريل 2007

mai 2007: 1 2 آخر الأخبار/16 مايو 2007 , 2 1 مايو 2007

jun 2007: 1 1 بريطانيا ترفض عرضا إسبانيا لإدارة مطاراتها

jul 2007: 1 1 مقتل نائبين في انفجار مقهى البرلمان العراقي

nov 2007: 1 1 مؤسسة ويكيميديا من بين رواد تكنولوجيا المنتدى الاقتصادي العالمي 2008

dez 2007: 1 2 ديسمبر 2007 , 2 1 آخر الأخبار/22 ديسمبر 2007

abr 2008: 1 1 مايو 2007

ago 2008: 1 1 كوريا الشمالية توافق على تعطيل أهم مفاعل نووي

set 2008: 1 2 مصر تفتح معبر رفح للفلسطينين

out 2008: 1 1 مقتل يورج هايدر في حادث سير

nov 2008: 1 1 حزب التحرير: أمريكا لا تنتظر أكثر من ضربة قاضية تسدد لها حتى تسقط عن عرشها العالمي

fev 2009: 1 3 انفجار في حي الحسين بالقاهرة , 2 2 تحطم طائرة تركية في الأراضي الهولندية , 3 2 إيران على بعد خطوات من تشغيل محطة بوشهر النووية , 4 2 أوباما يلقي كلمة في الكونجرس ويعد بتغيير سياسي واقتصادي قريب , 5 2 اتصالات الجزائر تطلق خدمة موجات , 6 2 محكمة الجنايات الدولة ستصدر قرارها بشأن الرئيس السوداني عمر البشير , 7 2 جوجل تنفي أن تكون قد اكتشفت مدينة \"أطلانطس\" الأسطورية , 8 2 تصاعد اللهجة من جديد بين حركتي حماس و فتح , 9 2 ألمانيا تحدد شروطا لاستقبال معتقلين من غوانتنامو , 10 1 نوري المالكي يؤكد أن بإمكان قواته الحفاظ على الأمن في العراق

mar 2009: 1 3 السجن لضابط مصري بتهمة التعذيب حتى الموت , 2 3 مدعي الجنائية الدولية قدم معلومات مغلوطة عن دارفور , 3 3 مقتل أربعة في ضربة صاروخية في شمال غرب باكستان , 4 3 حماس تقول أنها استأنفت مفاوضات تبادل الأسرى , 5 3 انتهاء مواجهات أم الفحم و الإفراج عن رائد صلاح , 6 3 انتخابات اليابان قد تأتي بسياسات مناخية أكثر صرامة , 7 3 حزب العمل يصوت بالموافقة للانضمام إلى حكومة نتنياهو , 8 3 البابا يحث الزعماء الأفارقة على مساعدة المعوزين , 9 3 تحطم طائرة شحن قرب طوكيو , 10 3 إبطال مفعول قنبلة كانت في سيارة ملغمة في مركز تجاري في حيفا , 11 3 حزب التحرير يعقد ندوة سياسية في قلقيلية , 12 3 مزارعون في الأرجنتين يقيمون إضراب احتجاجا على الضرائب , 13 3 اصطدام لسفينتين حربيتين أمريكيتين في مضيق هرمز , 14 3 الاتحاد الأفريقي يحظر عضوية مدغشقر بسبب التوتر الحكومي هناك , 15 3 استعادة اللوحات المسروقة من قصر محمد علي , 16 3 اختطاف 4 عمال إغاثة في الصومال , 17 3 البرلمان الكويتي يستقيل من جديد والأمير يقبل بذلك , 18 3 انطلاق المنتدى العالمي للمياه في إسطنبول , 19 3 الإفراج عن 3 من منتسبي منظمة أطباء بلا حدود في دارفور , 20 3 اغتيال رئيس غينيا بيساو , 21 3 الصفحة الرئيسية , 22 2 دعوة الأسد للقادة العرب برفض اعتقال البشير , 23 2 البشير يتهم إسرائيل بدعم متمردي دارفور , 24 2 القذافي :الجنائية شكل جديد من \"الإرهاب الدولي\" , 25 2 مساندة البشير وتخفيف الانقسام بشأن إيران من أولويات قمة الدوحة

abr 2009: 1 3 استطلاع: غالبية الإسرائيليين يخفون هويتهم بالخارج , 2 3 مركبة \"سويوز\" تعود إلى الأرض بعد انتهاء مهمتها , 3 3 مسلح يقتل 13 شخصا بنيويورك وينتحر , 4 3 الصفحة الرئيسية , 5 2 معاناة التجمعات البدوية في فلسطين , 6 2 انطلاق تظاهرة بيروت عاصمة للكتاب العالمي , 7 2 إطلاق قناة سورية معارضة جديدة , 8 2 السعودية تعترف باستقلال كوسوفو , 9 2 نجاد يثير موجة من الاستياء في صفوف حضور مؤتمر العنصرية في جنيف إثر حديثه عن العنصرية التي تمارسها إسرائيل في فلسطين , 10 2 إطلاق الهند قمر صناعي للتجسس اشترته من إسرائيل , 11 2 سقوط طائرة صغيرة في فلوريدا , 12 2 الأمير نايف يقول أن تنشئة الجيل الصاعد على منهج أهل السنة حماية لهم من الأهواء , 13 2 كلينتون تدعو لرفع الحظر عن جزر كوبا , 14 2 مسلمو القدس يمنعون اليهود من اقتحام المسجد الأقصى , 15 2 العثور على تمثال قناع وجه يعتقد أنه لكليوباترا , 16 2 إسرائيل و الولايات المتحدة الأمريكية تقومان بإجراء مناورات جوية في ما يبدو أنه تحذير لإيران , 17 2 إيفو مورالس ينهي إضرابه عن الطعام بعد استجابة الكونجرس البوليفي لمطالبه حول قانون الانتخاب , 18 2 حركات و دعاة إسلاميون يحذرون من اقتحام المستوطنين للمسجد الأقصى غدا , 19 2 أبو الغيط يوجه اتهامات لإيران بالتآمر لاغتيال مبارك , 20 2 بدأ مؤتمر العلاقات السورية اللبنانية في دمشق , 21 2 \"سامي شهاب\" يعتذر من نصرالله على فشله , 22 2 أوراسكوم تعرض على أورانج آخر فرصة للاتفاق بشأن موبينيل , 23 2 المعارضة الجورجية تدعو إلى نقل التظاهرات إلى مبنى الرئاسة , 24 2 هجوم على سائح إسرائيلي في سيناء , 25 2 إيفو مورالس يدخل في إضراب عن الطعام

mai 2009: 1 3 بايدن في بيروت يربط استمرار الدعم بنتائج الانتخابات , 2 3 مصرع 99 شخصا بتحطم طائرة عسكرية أندونيسية , 3 2 سوريا تنفي إلغاء صفقة طائرات حربية روسية , 4 2 توقيف أربعة أشخاص حاولوا تنفيذ هجمات في نيويورك , 5 2 وزير العدل البريطاني قدم استقالته إثر فضيحة مالية , 6 2 استقالة إيتشيرو أوزاوا زعيم المعارضة اليابانية , 7 2 شافيز يهدد بانسحاب بلاده من منظمة الدول الأمريكية , 8 1 ويكي الأخبار

jun 2009: 1 4 منظمة الصحة العالمية تعلن تحول وباء إنفلونزة الخنازير إلى وباء عالمي , 2 3 مقتل وزير الأمن الصومالي في هجوم انتحاري , 3 2 تخصيص نصف مليار دولار لإعادة إعمار غزة , 4 2 منتخب الفراعنة يقهر أبطال العالم و يفجر مفاجأة من العيار الثقيل في كأس القرات , 5 2 الخطوط الجوية البريطانية تطلب من موظفيها العمل مجانا , 6 2 إنفلونزا الخنازير تودي بأول ضحاياها في المملكة المتحدة , 7 2 في مباراة مثيرة منتخب البرازيل يفوز على مصر بفرق هدف واحد , 8 2 قطر تتعادل مع اليابان في طوكيو , 9 2 نصر الله يعترف بهزيمة قوى المعارضة في الانتخابات النيابية في لبنان , 10 1 أسعار النفط تتراجع عن مستوى 70 دولار

jul 2009: 1 3 50 فيلما من 14 بلدا تتنافس في مهرجان الهواة , 2 3 حدوث أطول كسوف للشمس خلال القرن الواحد والعشرين , 3 3 محمد ولد عبد العزيز يفوز بالانتخابات الرئاسية الموريتانية بفارق كبير عن منافسيه , 4 3 تفجيرات تستهدف فندقين في جاكرتا وتخلف أكثر من 10 قتلى و50 جريحا , 5 3 صدور كتاب جديد في نقد عبد الوهاب المسيري , 6 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 7 2 آثار معبد جوبيتير تظهر أثناء ترميم أحد البيوت , 8 2 عدة أسئلة لا تزال من دون رد بعد شهر على رحيل مايكل جاكسون , 9 2 انطلاق الانتخابات الرئاسية والبرلمانية في إقليم كردستان العراق , 10 2 مايلي سايروس \"ممنوعة\" من الخضوع لعمليات التجميل , 11 2 شيرين تتفوق على فضل أمام 14 ألف متفرج قرطاجي , 12 2 الشرطة تقتحم عيادة طبيب جاكسون , 13 2 كارول سماحة بين المغرب ومصر ولبنان , 14 2 شمال و جنوب السودان يرحبون بقرار المحكمة الدولية حول أبيي , 15 2 حركة حماس تنتج أول فيلم سينمائي في قطاع غزة , 16 2 مصر تسجل أول حالة وفاة بإنفلونزا الخنازير , 17 1 إنفجار في مايوركا في إسبانيا يودي بحياة شرطيين

ago 2009: 1 4 ويكيبيديا الإنجليزية تتجاوز 3 ملايين مقالة , 2 2 إسكتلندا تطلق سراح عبد الباسط المقرحي لأسباب إنسانية , 3 2 المنتخب المصري لكرة اليد يحتل المركز الرابع في كأس العالم لكرة اليد للشباب , 4 2 الإعصار بيل يزيد قوة فوق الأطلنطي , 5 2 النائبة عن حزب الإينويت في البرلمان الدنماركي تطالب الحكومة بالاعتذار لجرينلاند , 6 2 افتتاح مهرجان الإسكندرية السنمائي بحضور عدد قليل من نجوم السينما , 7 2 اندلاع معركة بين جزائريين وصينيين في الجزائر العاصمة , 8 2 الإفراج عن الصحفيتين الأمريكيتين في كوريا الشمالية والإدارة الأمريكية تبارك جهود كلينتون , 9 2 تمساح بطول قدم يثير الرعب بين ركاب طائرة مصر للطيران , 10 1 سرقة حساب بنك الاحتياط الفيدرالي الأمريكي

set 2009: 1 4 1.9 مليون مواطن يترددون علي موائد الرحمن في مصر , 2 3 أدلة علي قتل مروة الشربيني عمدا، واستبعاد شبهة المرض النفسي , 3 2 المؤتمر التاسيسي لتشكيل ائتلاف العمل والإنقاذ الوطني , 4 2 انتقادات شعبية لأداء الحكومة البريطانية في أفغانستان , 5 1 وزير خارجية مصر يدعوا إسرائيل للقبول بحل الدولتين

out 2009: 1 1 استقبال حافل لأبطال أزرق الناشئين

nov 2009: 1 2 معرض الكتاب في الكويت والدور النسوي في تنمية البلد , 2 1 دورهنّ في تنمية الكويت

dez 2009: 1 1 المملكة العربية السعودية

jan 2010: 1 1 مؤتمر دولي لدعم اليمن في حربه ضد تنظيم القاعدة

fev 2010: 1 2 \"صفقة شاليط\" تنتهي بالفشل , 2 1 اعدام مدنين في نيجيريا

mar 2010: 1 1 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46

abr 2010: 1 1 ماستريو

mai 2010: 1 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 2 1 جوزيه مورينهو يوقع عقدا لتدريب ريال مدريد

jun 2010: 1 2 محكمة مصرية عليا تؤيد سحب جنسية متزوجو إسرائيليات , 2 2 استقالة رئيس الوزراء الياباني بعد تسعة أشهر من الحكم , 3 2 مهاجمة أسطول الحرية بواسطة البحرية الإسرائيلية

jul 2010: 1 2 سكر يستورد من اسرائيل ليهرب عبر المغرب ويباع في الجزائر , 2 1 حريق في فندق في السليمانية شمال العراق

ago 2010: 1 1 الضغط يتصاعد ضد كنيسة فلوريدا التي تخطط لحرق القرآن

set 2010: 1 1 الراسينغ الى نصف نهائي كأس النخبة للمرة الأولى

out 2010: 1 1 كاسترو يقلل من خطوات أوباما تجاه كوبا و يطالبه بالرفع النهائي للحصار

nov 2010: 1 1 تواصل محاكمة المتهم بمقتل الجندي ماجدا المقبولي في اليمن

dez 2010: 1 1 اختفاء الحزام الجنوبي لكوكب المشتري

fev 2011: 1 1 خلل في التنسيق بين إصداري مايكروسوفت أوفيس 2007 و2010

mar 2011: 1 2 أحداث يوم السبت 5/3/2011 م من ثورة 17 فبراير الليبية , 2 2 أحداث يوم الجمعة 11/3/2011 م من ثورة 17 فبراير الليبية , 3 2 أحداث يوم الثلاثاء 8/3/2011 م من ثورة 17 فبراير الليبية , 4 2 أحداث يوم الثلاثاء 1/3/2011 م من ثورة 17 فبراير الليبية , 5 2 أحداث يوم الإثنين 21/2/2011 م من ثورة 17 فبراير الليبية , 6 2 أحداث يوم الإثنين 14/3/2011 م من ثورة 17 فبراير الليبية , 7 2 أخبار زلزال اليابان 18-3-2011 22:00 , 8 1 أحداث يوم الأربعاء 9/3/2011 م من ثورة 17 فبراير الليبية

abr 2011: 1 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 2 1 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011

mai 2011: 1 4 أحداث يوم الخميس 28/4/2011 م من الاحتجاجات السورية 2011 , 2 3 أحداث يوم الجمعة 6/5/2011 م من الاحتجاجات السورية 2011 , 3 3 أحداث يوم الجمعة 29/4/2011 م من الاحتجاجات السورية 2011 , 4 3 أحداث يوم الأحد 8/5/2011 م من الاحتجاجات السورية 2011 , 5 3 أحداث يوم الأربعاء 23/2/2011 م من ثورة الشباب اليمنية , 6 3 شركة \"مايكروسوفت\" تشتري \"سكايب\" مقابل 8.5 مليار دولار , 7 2 ثورة الشباب اليمنية , 8 2 الاحتجاجات السورية 2011 , 9 2 ثورة 17 فبراير , 10 2 أحداث يوم السبت 9/4/2011 م من الاحتجاجات السورية 2011 , 11 2 أحداث يوم السبت 7/5/2011 م من الاحتجاجات السورية 2011 , 12 2 أحداث يوم السبت 30/4/2011 م من الاحتجاجات السورية 2011 , 13 2 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011 , 14 2 أحداث يوم السبت 23/4/2011 م من الاحتجاجات السورية 2011 , 15 2 أحداث يوم السبت 16/4/2011 م من الاحتجاجات السورية 2011 , 16 2 أحداث يوم الخميس 7/4/2011 م من الاحتجاجات السورية 2011 , 17 2 أحداث يوم الخميس 5/5/2011 م من الاحتجاجات السورية 2011 , 18 2 أحداث يوم الخميس 21/4/2011 م من الاحتجاجات السورية 2011 , 19 2 أحداث يوم الخميس 14/4/2011 م من الاحتجاجات السورية 2011 , 20 2 أحداث يوم الجمعة 8/4/2011 م من الاحتجاجات السورية 2011 , 21 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 22 2 أحداث يوم الجمعة 22/4/2011 م من الاحتجاجات السورية 2011 , 23 2 أحداث يوم الجمعة 15/4/2011 م من الاحتجاجات السورية 2011 , 24 2 أحداث يوم الثلاثاء 3/5/2011 م من الاحتجاجات السورية 2011 , 25 2 أحداث يوم الثلاثاء 26/4/2011 م من الاحتجاجات السورية 2011

jun 2011: 1 2 البيضاء (ليبيا) , 2 1 الاهلي يتوج بطلا لكاس السعودية

jul 2011: 1 3 انفجار وإطلاق رصاص في النرويج , 2 2 ملثمون يثيرون الذعر في العريش , 3 2 العثور على جثة من زلزل عرش ميردوخ , 4 2 شرف يعلن تشكيل الحكومة اليوم، وبقاء وزراء الثقافة والتربية والعدل والسياحة والداخلية , 5 2 حاخام يهودي يقول أن وجود الأقصى مسألة وقت والهيكل سيبنى , 6 1 ملثمون يثيرون الذعر فى العريش

ago 2011: 1 3 مقتل قائد المعارضة الليبية , 2 2 استشهاد ضابط ومجندين في إطلاق نار على الحدود المصرية الإسرائيلية , 3 1 صحيفة لي فيغارو الفرنسية:\" إيران قد أدارت ظهرها فعلاً للرئيس السوري بشار الأسد\"

set 2011: 1 1 وفاة النجل الأكبر لجمال عبد الناصر في بعد تدهور حالته بإحدى مستشفيات القاهرة

out 2011: 1 4 مقتل معمر القذافي , 2 2 وفاة ولي العهد السعودي الأمير سلطان بن عبد العزيز , 3 1 الولايات المتحدة الأمريكية تقطع مساعداتها المالية لليونسكو إثر منحها مقعداً لفلسطين

nov 2011: 1 1 الملاكم فراس زيداني من الناصرة يستعد للمشاركة في بطولة عالمية في المانيا

dez 2011: 1 1 1.9 مليون مواطن يترددون علي موائد الرحمن فى مصر

jan 2012: 1 1 مسيرة بميدان التحرير للمطالبة بالقصاص من قتلة الثوار

fev 2012: 1 1 الامم المتحدة: عدد القتلى المدنيين في سوريا \"أعلى بكثير من 7500

mar 2012: 1 2 التلفزيون السوري: سكان باب عمرو بدأوا العودة , 2 1 بوينج وايرباص ،،، تجدد أزمة الدعم

abr 2012: 1 2 نقل مكوك الفضاء «ديسكفري» إلى المتحف الجوي , 2 2 تحطم طائرة ركاب قرب مطار إسلام آباد , 3 1 حملة الدعاية الانتخابية تنطلق رسمياً في مصر

mai 2012: 1 3 مقتل أكثر من خمسين جندي في تفجير انتحاري بصنعاء , 2 2 41 قتيلا بسوريا ومهلة للنظام , 3 2 إعلان نتائج الانتخابات الرئاسية المصرية 2012 , 4 2 عشرات القتلى في مجزرة الحولة بسوريا , 5 2 النتائج غير الرسمية لانتخابات الرئاسة المصرية , 6 2 انطلاق انتخابات الرئاسة المصرية لأول مرة عقب ثورة 25 يناير وسقوط نظام حسني مبارك , 7 2 وفاة وردة الجزائرية , 8 2 الأردن تبعد 50 لاجئاً سورياً , 9 2 فرانسوا أولاند يتسلم رئاسة فرنسا من ساركوزي , 10 2 فرانسوا أولاند يتقدم على ساركوزي في النتائج المبدئية للانتخابات الرئاسية , 11 2 سكان الحدود التونسية يخترقون الحدود الجزائرية , 12 2 حزب التحرير: من يترقب الفرج من نتائج انتخابات العدو كمن يترقب الماء من النار , 13 1 ميدان السبعين 2012/5/21

jun 2012: 1 4 إعلان محمد مرسي رئيسًا لمصر , 2 3 صدور حكم على مبارك ووزير داخليته بالسجن المؤبد , 3 2 مسيرة شموع في الكرك , 4 2 الحكومة الأردنية تعتقل ناشطين سوريين , 5 2 وفاة السلحفاة العملاقة لونسام جورج , 6 2 تونس تسلم ليبيا رئيس الوزراء السابق , 7 2 فرار ثلاثة طيارين سوريين منشقين إلى الأردن , 8 2 محمد مرسي رئيسًا لجمهورية مصر العربية بعد الثورة , 9 2 الرئيس الأسد يشكل الحكومة السورية الجديدة برئاسة رياض حجاب , 10 2 طائرة مقاتلة تركية تختفي فوق المياه السورية , 11 2 أسانج يطلب اللجوء السياسي في سفارة الإكوادور بلندن , 12 2 الجيش الليبي يدخل بلدات غربي البلاد لوقف الاشتباكات , 13 2 النتائج غير الرسمية لجولة الإعادة في الانتخابات الرئاسية المصرية تظهر تقدم مرسي , 14 1 اليونسكو تضيف كنيسة المهد إلى قائمة التراث العالمي

jul 2012: 1 4 بدء الاقتراع بأول انتخابات ليبية منذ أكثر من نصف قرن , 2 3 تفجير مبنى الأمن القومي بدمشق يودي بحياة قادة أمنيين , 3 3 الرئيس المصري يعيد البرلمان المنحل , 4 2 تفاقم الأزمة بين بغداد وأربيل , 5 2 المرشح الجمهوري ميت رومني في إسرائيل وإيران على رأس المباحثات , 6 2 سيدا في أبو ظبي والمجلس الوطني يبحث تشكيل حكومة انتقالية , 7 2 أردوغان: من حق تركيا ملاحقة حزب العمال الكردستاني على الأراضي السورية , 8 2 واشنطن تتخوف من مجزرة في حلب , 9 2 الاتحاد الأوروبي: حزب الله ليس تنظيماً إرهابياً , 10 2 تركيا تستدعي قنصلها في حلب للتشاور , 11 2 بعد البوكمال، الجيش السوري الحر يسيطر على معبر ربيعة الحدودي بين سوريا والعراق , 12 2 جوبا تتهم الخرطوم بالاعتداء على أراضيها , 13 2 تمديد عمل بعثة المراقبيين في سوريا , 14 2 تعيين العماد فهد جاسم الفريج وزيرًا للدفاع السوري , 15 2 الحكومة السورية ترفع سعر زيت التدفئة (الديزل) , 16 2 الإمارات بدأت بشحن النفط بعيداً عن مضيق هرمز , 17 2 استمرار تهديد إيران بإغلاق مضيق هرمز , 18 2 الأركان التركية تستبعد أن المقاتلة أسقطها صاروخ سوري , 19 2 الإخوان المسلمون بالأردن يقاطعون الانتخابات البرلمانية , 20 2 أكثر من 200 قتيل في مجزرة التريمسة بسوريا , 21 2 هيومن رايتس واتش تشتبه باستخدام قنابل عنقودية في سوريا , 22 2 إيقاف التمويل الحكومي لعلاج اللاجئين في لبنان , 23 1 خلية طوارئ بالعراق لمساعدة اللاجئين السوريين

ago 2012: 1 3 انشقاق رئيس مجلس الوزراء عن نظام الأسد والمجلس الوطني يرحب , 2 3 اندلاع الاشتباكات الأعنف بين الجيشين السوري والأردني , 3 2 بورما تعلن إلغاء الرقابة على الإعلام , 4 2 سقوط طائرة مقاتلة للقوات الجوية السورية في المنطقة الشرقية , 5 2 إسرائيل توافق على طلب مصر بإدخال مروحيات قتالية إلى سيناء , 6 2 مجهولون يدمرون مسجداً بأمريكا , 7 1 الانتخابات العامة في أنغولا، والحزب الحاكم الأوفر حظاً

set 2012: 1 3 مقتل السفير الأمريكي في ليبيا بعد هجوم محتجين مسلحين على القنصلية في بنغازي , 2 3 سلسلة من التفجيرات في العراق تودي بحياة اكثر من 100 شخص , 3 3 «الحزب الكيبيكي» يفوز في الانتخابات البرلمانية العامة في ولاية كيبيك الكندية , 4 2 سيارة ذاتية القيادة في شوارع كاليفورنيا , 5 2 تايوان تدخل على الخط و تعمق الأزمة في الجزر المتنازع عليها بين الصين واليابان , 6 2 صدور مذكرات سلمان رشدي , 7 2 السجن 3 سنوات لأحمد نظيف بتهمة الكسب غير المشروع , 8 2 وفاة رائد الفضاء الأمريكي نيل آرمسترونغ عن 82 سنة , 9 2 الصفحة الرئيسية , 10 1 تركيا تهدد سوريا في حال تكرار النظام السوري تعديه على الحدود معها

out 2012: 1 3 انفجار في حي الأشرفية في قلب بيروت يوقع ثمانية قتلى على الأقل , 2 2 المعارضة الليتوانية تبدأ تشكيل الحكومة بعد فوزها في الانتخابات , 3 2 مقتل 41 شخصا على الأقل في تفجير انتحاري في مسجد في أفغانستان , 4 2 هيومن رايتس ووتش: قوات الأسد تستخدم الأسلحة العنقودية المحرمة دولياً , 5 2 جائزة نوبل للسلام يأخذها الاتحاد الأوروبي , 6 2 أمير الكويت يحل مجلس الأمة المعاد ويفتح الطريق لانتخابات برلمانية للمرة الثانية هذا العام , 7 2 البرلمان التركي يجيز التدخل العسكري في سوريا , 8 2 تفجيرات تهز حلب عاصمة سوريا الاقتصادية ووقوع أربعين قتيلاً , 9 2 مقتل قائد عمليات حزب الله في سوريا مع مجموعة من عناصره , 10 1 حكومة علي زيدان تنال ثقة المؤتمر الوطني العام الليبي

nov 2012: 1 3 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 تحطم طائرة عسكرية في صنعاء , 3 2 إسرائيل تقصف غزة , 4 2 خبراء يتوقعون ارتفاع معدلات الإصابة بسرطان الرئة بين النساء في بريطانيا , 5 2 الاتحاد الأوروبي يمنح مصر مساعدات بقيمة 6 مليار دولار , 6 2 فئران مدربة لضبط الممنوعات , 7 2 15 قتيلاً و80 جريحاً في تفجيرات في العراق , 8 1 الجمهوريون يعارضون تعيين سوزان رايس وزيرة للخارجية

dez 2012: 1 2 بارك كون هيه تفوز برئاسة كوريا الجنوبية , 2 2 إعلان الحداد في الولايات المتحدة بعد مجزرة نيوتاون , 3 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 4 2 الإعلان عن نتائج انتخابات الكويت , 5 1 هيلاري كلينتون في المستشفى إثر اشتباه إصابتها بخثرة دماغية

jan 2013: 1 3 صندوق النقد العربي يمنح السودان قرضاً لإجراء إصلاحات على القطاع المالي للحكومة , 2 2 حريق في ناد ليلي في البرازيل يقضي على أكثر من 200 شخص , 3 2 محمود عباس يوقع مراسيم باعتماد تسمية «دولة فلسطين» رسمياً , 4 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 5 2 النتائج الأولية للانتخابات الرئاسية في المكسيك , 6 1 الخارجية الإسرائيلية تسحب شريطاً دعائياً يظهر اختفاء قبة الصخرة

fev 2013: 1 5 تنحي بابا الكنيسة الكاثوليكية بندكت السادس عشر , 2 3 انفجار نيزك فوق مدينة تشيليابينسك بوسط روسيا , 3 3 تعيين خالد بن بندر أميرًا للرياض , 4 3 اغتيال المعارض التونسي شكري بلعيد : ترجيحات متعددة , 5 2 مقتل 19 شخصاً في سقوط منطاد في الأقصر من ارتفاع 300 متر , 6 2 فوز فيلم آرغو بجائزة أفضل فيلم في حفل الأوسكار لعام 2013 , 7 2 فوز نيكوس آناستاسياديس برئاسة قبرص , 8 1 البرلمان السلوفيني يسحب الثقة من الحكومة ويكلف ألينكا براتوشيك بتشكيل حكومة جديدة

mar 2013: 1 3 مقتل الشيخ سعيد رمضان البوطي و49 آخرين بينهم حفيده في تفجير انتحاري في دمشق , 2 3 الكردينال الأرجنتيني خورخه ماريو بيرغوليو يصبح أول بابا من خارج أوروبا باسم فرنسيس الأول , 3 2 سامسونج تعلن عن هاتفها الذكي الجديد جالكسي إس 4 , 4 2 تشافيز يعلن عن نكسة السرطان ويسمي خليفة محتملاً , 5 1 ميشيل دجوتوديا يقطع عهداً بتسليم السلطة في 2016

abr 2013: 1 4 وفاة رئيسة وزراء المملكة المتحدة السابقة مارغريت تاتشر , 2 3 مقتل شخصين وإصابة 22 آخرين في انفجارين قرب نهاية خط ماراثون بوسطن , 3 3 مادورو يفوز برئاسة فنزويلا بفارق طفيف، وكابريليس يطالب بإعادة فرز الأصوات , 4 3 ظهور فيديو يُظهر لحظة اغتيال محمد رمضان البوطي , 5 3 إيران تدشن مجمعات لمعالجة أكسيد اليورانيوم , 6 3 إسرائيل تواجه أكبر عمليَّة قرصنة إلكترونيَّة يشنها نشطاء فلسطينيّون , 7 2 الروائي الكويتي سعود السنعوسي يفوز بالجائزة العالمية للرواية العربية عن روايته «ساق البامبو» , 8 2 الجيش السوري الإلكتروني يتبنى مسؤولية نشر خبر كاذب عن إصابة أوباما بجروح , 9 2 القضاء الفرنسي يفتح تحقيقاً في تهمة تلقي ساركوزي تمويلاً غير قانوني من القذافي , 10 1 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليام ألكسندر

mai 2013: 1 2 مقتل 46 في انفجار سيارتين في تركيا والقبض على 9 مشتبه بهم , 2 2 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليم ألكساندر , 3 2 وفاة الأسير الفلسطيني ميسرة أبو حمدية في مستشفى سوروكا الإسرائيلي , 4 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 5 1 مجلس الأمن يضم «جبهة النصرة لأهل الشام» إلى قائمة المنظمات الإرهابية

jun 2013: 1 3 أمير قطر يسلم السلطة لنجله , 2 2 اكتشاف ستة كواكب منها ثلاثة على الأقل صالحة للسكنى , 3 2 رفض محكمة فرنسية ادعاء التلاعب في شريط استشهاد الطفل محمد الدرة , 4 2 الجيش اللبناني يعلن سيطرته على مسجد بلال بن رباح والمربع الأمني للشيخ أحمد الأسير , 5 2 إشتباكات مسلحة بين الجيش اللبناني وأنصار الشيخ أحمد الأسير وعناصر من حزب الله , 6 2 بشار الأسد يصدر مرسومين بزيادة رواتب العاملين المدنيين والعسكريين ومعاشات المتقاعدين , 7 2 ديلما روسيف تعد بالإصلاحات ومكافحة الفساد استجابةً للاحتجاجات

jul 2013: 1 3 قطاع غزة يترنح بعد إغلاق مصر 80% من الأنفاق , 2 2 استئناف المفاوضات الفلسطينية الإسرائيلية , 3 2 العثور على تمساح نيل يافع في نهر بيروت , 4 2 توقيف المرافق الشخصي للشيخ أحمد الأسير , 5 2 العثور على مقابر جماعية لمقاتلي حزب الله في سوريا , 6 2 الأمير ويليام وزوجته الأميرة كيت يُرزقان بمولود ذكر , 7 2 علماء آثار إسرائيليّون يعتقدون باكتشافهم قصر النبي داود , 8 2 انفجار في موكب تابع لحزب الله على طريق بيروت-دمشق الدولية , 9 2 بنما توقف سفينة كورية شمالية للاشتباه بنقلها مكونات صواريخ , 10 2 تعيين محمد البرادعي رئيسًا للوزراء في مصر

ago 2013: 1 3 مجزرة كيميائية مُسنَدَة إلى القوات النظامية السورية في غوطة دمشق , 2 3 وفاة الداعية الإسلامي الكويتي عبد الرحمن السميط , 3 2 وزير الدفاع البريطاني يعلن عدم مشاركة بريطانيا في أي عمل عسكري في سوريا , 4 2 تداعيات وردود أفعال على مقتل 3 شبان فلسطينيين في مخيم قلنديا , 5 2 وكالة الاستخبارات المركزية الأمريكية تعترف بدورها في انقلاب إيران 1953 , 6 2 نائب الحاكم العسكري بمصر يأمر بوضع مبارك قيد الإقامة الجبرية , 7 2 اكتشاف نوع جديد من الثدييات في الأنديز , 8 2 انفجار يهز الضاحية الجنوبية لبيروت , 9 2 اختتام مؤتمر ويكيمانيا 2013 في هونغ كونغ , 10 1 سكايب يعمل على توفير خدمة المحادثة ثلاثية الأبعاد

set 2013: 1 2 خروج قطار بضائع عن القضبان واصصدامه بالرصيف بعد تجاوزه السرعة المقررة , 2 2 فوياجر 1 تجتاز حافة النظام الشمسي , 3 2 مصرع 3 موظفين بإحدى شركات الاتصالات وإصابة 8 في حادث تصادم بـالصحراوي , 4 1 عقيدة المصريين عن اخر الايام

out 2013: 1 1 محافظ ينبع.. اثناء زيارته للمخيمات الشاطئية ينبع لاتقدر من يضيع وقته بالكلام

nov 2013: 1 2 الاتحاد الأوروبي يقرر تخفيض العقوبات على إيران , 2 2 الفيفا يقترب لحسم قراره بخصوص مونديال قطر , 3 1 الإتحاد الأوروبي يقرر تخفيض العقوبات على إيران

dez 2013: 1 2 ظهور جزيرة في بحر العرب بفعل زلزال الباكستان , 2 1 انفجار مديرية الأمن بالمنصورة

jan 2014: 1 2 فليتشر: لا نخاف من تشيلسي , 2 1 اليجري يرفض عرضا للتدريب في انجلترا

fev 2014: 1 2 بوتفليقة يترشح لعهدة انتخابية رابعة , 2 2 الجيش الإسرائيلي يكشف نفقا يمتد من داخل القطاع الى الأراضي الإسرائيلية , 3 1 بوتفليقة يترشح لعهدة إنتخابية رابعة

mar 2014: 1 2 السعودية والإمارات والبحرين تسحب سفرائها من الدوحة

abr 2014: 1 2 بدء الانتخابات الرئاسية في أفغانستان , 2 1 إرتفاع الاسعار بالأسواق المصرية بشكل جنونى

mai 2014: 1 1 تحوّل إجابات Google للقراءة فقط

jun 2014: 1 3 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 أزمات المنطقة محور لقاء العاهل السعودي والسيسي

jul 2014: 1 1 17شهيد فى جريمة جديدة فى شجاعية

ago 2014: 1 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 بعثات من ناسا لدراسة آثار التغيرات المناخية في القطب الشمالي

set 2014: 1 1 الصحفي نت

out 2014: 1 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 مفاوضات مباشرة بين الحكومة النيجيرية و\"بوكو حرام\" في تشاد لإطلاق الفتيات المختطفا

nov 2014: 1 4 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 المغرب يفوز على نمبي ب6 ل1 , 3 1 الشوق الى ادمان المخدرات

dez 2014: 1 5 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 Diwaniyah / Iraq

jan 2015: 1 5 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 طبخ أكبر طبق كشري في العالم , 3 1 افتتاح معرض القاهرة الدولى للكتاب الدورة 46

fev 2015: 1 1 تقرير أممي: عبدالله صالح جمع أكثر من 60 مليار دولار من ممارسات فاسدة

mar 2015: 1 3 القاعدة تعلن تشكيل فرع جديد لها وهو تنظيم القاعدة الالكتروني , 2 1 تغيير وزاري محدود بمصر

abr 2015: 1 1 حمَاس: زيارة بيريز للمغرب ستجّمل وجه إسرائيل أمام العالَـم

mai 2015: 1 1 ملك المملكة المغربية

jun 2015: 1 2 فيلم اثار غضب المغاربة , 2 2 برهامي: لم نحسم أمرنا من دعم مرشح بعينه للانتخابات الرئاسية.. وسنختار الأكثر تدينًا , 3 1 السماح بزواج المثليين في الولايات المتحدة

jul 2015: 1 2 نصائح عامة , 2 1 مستوطنون متطرفون يضرمون النار بمنزلين في نابلس، ووفاة رضيع محترقاً وإصابة أسرته بحروق بالغة.

ago 2015: 1 2 إسرائيل وراء تنظيم داعش (وثيقة سرية) , 2 2 مقتل أكثر من 100 مدني بقصف النظام السوري سوقاً في دوما , 3 2 الصفحة الرئيسية , 4 1 11 قتيلاً في حريق شرقي السعودية

set 2015: 1 3 عشرات القتلى بسقوط رافعة في الحرم المكي , 2 2 عشرات الوفيات ومئات الإصابات في سقوط رافعة بالحرم المكي , 3 1 بعد زوج عمته \"كيم جونغ أون\" يعدم وزير الدفاع

out 2015: 1 1 سقوط طائرة ركاب روسية في سيناء وأنباء عن وفاة جميع أفرادها

nov 2015: 1 1 إجراء أول اختبار ناجح في التاريخ لصاروخ حامل متعدد الاستعمالات ويهبط بنجاح

dez 2015: 1 1 وفاة أشهر القوادات الفرنسيات \"مدام كلود\"

jan 2016: 1 2 علماء فلك: لدينا أدلة قوية على وجود كوكب تاسع , 2 2 ميسي يفوز بجائزة الكرة الذهبية كأفضل لاعب في سنة 2015 , 3 1 اليابان تفوز بكأس آسيا لكرة القدم تحت 23 سنة وتتأهل برفقة كوريا الجنوبية والعراق إلى الألعاب الأولمبية

fev 2016: 1 3 انفجار في أنقرة يخلف ما بين 90 قتيل وجريح , 2 3 الانتخابات الأمريكية في نيو هامبشير: نصر لترامب وخيبة أمل لكلينتون , 3 2 إكتشاف حالتي إصابة بفيروس زيكا في فنلندا , 4 2 رئيس وزراء كندا جستن ترودو يعلن أن بلاده ستنهي عملياتها العسكرية ضد داعش في مطلع يوم 22 فبراير , 5 1 حفل جوائز الأوسكار ال88: ليوناردو دي كابريو يكسر عقدته ويفوز بجائزة أوسكار لأفضل ممثل، وسبوت لايت يفوز بجائزة أفضل فيلم

mar 2016: 1 2 الممثلة الفرنسية صوفي مارسو ترفض استلام وسام الشرف الفرنسي بسبب منحه لولي العهد السعودي محمد بن نايف , 2 2 ريال مدريد يعود لاكتساح منافسيه ويفوز على سلتا فيغو بنتيجة 7-1 , 3 2 اشتباكات في شمال الأردن بين الجيش ومسلحين إسلاميين يودي بعدة قتلى وجرحى , 4 2 الانتخابات الأمريكية: تقدم كل من هيلاري كلينتون ودونالد ترامب في انتخابات يوم الثلاثاء الكبير , 5 1 وفاة المهندسة المعمارية العراقية الأصل زها حديد عن عمر يناهز 65 سنة

abr 2016: 1 2 مصر تتنازل عن جزيرتي الصنافير وتيران للسعودية بعد توقيع إتفاقية بينهما , 2 2 تظاهرات في بريطانيا تطالب بإستقالة رئيس الوزراء البريطاني ديفيد كاميرون وإنتقادات للبي بي سي لعدم تغطيتها للمظاهرات , 3 2 مقتل عمال سوريين على يد تنظيم داعش , 4 1 دوري أبطال أوروبا: أتلتيكو مدريد يفوز على بايرن ميونخ في مباراة بهدف دون رد

mai 2016: 1 1 سيطرة الجيش السوري على مساحات واسعة من الغوطة الشرقية

jun 2016: 1 1 تدمير رتل لتنظيم داعش مكون من 150 عجلة

jul 2016: 1 2 فشل محاولة الانقلاب العسكري في تركيا، والتي قام بها مجموعة من الجيش التركي. , 2 1 تيريزا ماي تتولى رئاسة وزراء المملكة المتحدة خلفاً لديفيد كاميرون المستقيل.

ago 2016: 1 2 حملة فيسبوكية تطالب مومو بإرجاع الوسام , 2 2 رئيس حملة دونالد ترامب الانتخابية يعلن استقالته , 3 2 هداية ملاك تفوز بميدالية في أوليمبياد ريو , 4 2 استقالة أصغر وزيرة سويدية بعد ضبطها تقود تحت تأثير الخمر , 5 2 الطائرة العاملة بالطاقة الشمسيَّة سولار إمپلس تحط في أبو ظبي مُكملةً رحلتها حول الأرض , 6 2 انطلاق أعمال دورة تدريب مدربات في مجال التمكين السياسي للمرأة بالعاصمة اللبنانية بيروت , 7 1 زلزال يضرب وسط إيطاليا

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 18 de setembro 2016 17:15

Dump file arwikinews-20160901-stub-meta-history.xml.gz (edits only), size 3.5 Mb as gz -> 27 Mb
Dump processed till Aug 31, 2016, on server stat1002, ready at Thu-08/09/2016-06:44 after 19 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.