Estatísticas da Wikinotícias albanês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2017
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 201710   743 4,1        24
jul 201710   743 4,1        24
jun 201710   743 4,1        24
mai 201710   743 4,1 1      24
abr 201710   743 4,1 1      24
mar 201710   743 4,1        24
fev 201710   743 4,1        24
jan 201710   743 4,1        24
dez 201610   743 4,1        24
nov 201610   743 4,1        24
out 201610   743 4,1        24
set 201610   743 4,1        24
ago 201610   743 4,1 1      24
jul 201610   743 4,1 1      24
jun 2016101  743 4,1 1      24
mai 20169   743 4,1        24
abr 20169   743 4,1        24
mar 20169   743 4,1        24
fev 20169   743 4,1        24
jan 20169   743 4,1 1      24
dez 20159   743 4,1        24
nov 20159   743 4,1        24
out 20159   743 4,1 5      24
set 20159   742 4,1 5      24
ago 20159   741 4,1 1      24
jul 20159   741 4,1        24
jun 20159   741 4,1        24
mai 20159   741 4,1 1      24
abr 20159   741 4,1 1      24
mar 20159   740 4,1135151,2 Mb167 k4811820580724
fev 20159   738 4,11351 1,2 Mb167 k4811820479424
jan 2015911 738 4,11351181,2 Mb167 k4811820479424
dez 20148   737 4,11332 1,2 Mb164 k4011819079424
nov 20148   737 4,11332 1,2 Mb164 k4011819079424
out 20148   737 4,11332 1,2 Mb164 k4011819079424
set 20148   737 4,1133251,2 Mb164 k4011819079424
ago 20148   736 4,1133131,2 Mb164 k4013519079324
jul 20148   734 4,11331 1,2 Mb164 k4013519079324
jun 20148   734 4,11331 1,2 Mb164 k4013519079324
mai 20148   734 4,11331 1,2 Mb164 k4013519079324
abr 20148   734 4,11331 1,2 Mb164 k4013519079324
mar 20148   734 4,11331 1,2 Mb164 k4013519079324
fev 20148   734 4,1133111,2 Mb164 k4013519079324
jan 20148   734 4,1133111,2 Mb164 k4013519079324
dez 20138   734 4,11331 1,2 Mb164 k4013519079324
nov 20138   734 4,11331 1,2 Mb164 k4013519079324
out 20138   734 4,11331 1,2 Mb164 k4013519079324
set 20138   734 4,11331 1,2 Mb164 k4013519079324
ago 20138   734 4,1133111,2 Mb164 k4013519079324
jul 20138   734 4,11331 1,2 Mb164 k4013619079324
jun 20138   734 4,1133131,2 Mb164 k4013619079324
mai 20138   734 4,11331 1,2 Mb164 k4013519079224
abr 20138   734 4,1133121,2 Mb164 k4013519079224
mar 20138   734 4,11331 1,2 Mb164 k4013519079224
fev 20138 1 734 4,1133151,2 Mb164 k4013519079224
jan 20138   732 4,11329 1,2 Mb163 k3913519079224
dez 20128 11732 4,113295161,2 Mb163 k3913519079224
nov 20128   731 3,41330 1,2 Mb163 k3911919079024
out 20128   731 3,4133021,2 Mb163 k3911919079024
set 20128 1 730 3,4133061,2 Mb163 k3911919078824
ago 20128   730 3,41330 1,2 Mb163 k3912219078824
jul 20128 1 730 3,4133061,2 Mb163 k3912219078824
jun 20128   729 3,31328 1,2 Mb163 k3911919078624
mai 20128 1 729 3,31328311,2 Mb163 k3911919078624
abr 20128 1 725 3,31338171,2 Mb162 k3711919078118
mar 20128 21724 3,313401101,2 Mb162 k3711719077917
fev 20128 1 715 3,21335361,1 Mb159 k3710718976217
jan 20128 1 711 3,21328311,1 Mb157 k3710718875316
dez 20118 11709 3,113291351,1 Mb157 k379518774715
nov 20118 1 706 2,9133191,1 Mb156 k378818774115
out 2011812 705 2,91330231,1 Mb156 k378818773815
set 20117   704 2,91330 1,1 Mb156 k376918773615
ago 20117 2 704 2,91330171,1 Mb156 k376918773615
jul 20117 1 700 2,91333461,1 Mb155 k376918773114
jun 20117 2 697 2,81328181,1 Mb153 k385318071113
mai 20117 3 68922,913281471,1 Mb152 k375117969513
abr 2011723162232,913481621,0 Mb141 k363017763410
mar 2011514252453,21382725892 kb121 k35301765318
fev 20114 2 372 2,5144751658 kb90 k25491463735
jan 20114 2 35832,51453147636 kb87 k25491393584
dez 2010413227862,61576471524 kb73 k23491052724
nov 201032317933,41811256161 kb24 k14926833
out 20101   1 9146214,7 kb20974912 
set 20101   1 81463 4,7 kb20974912 
ago 20101   1 8146314,7 kb20974912 
jul 20101   1 7146314,7 kb20974912 
jun 20101   1 61463 4,7 kb20974912 
mai 20101   1 6146344,7 kb20974912 
abr 20101   1 21955 4,9 kb27812231 
mar 20101   1 21955 4,9 kb27812231 
fev 20101   1 21955 4,9 kb27812231 
jan 20101   1 21955 4,9 kb27812231 
dez 20091   1 21955 4,9 kb27812231 
nov 20091   1 21955 4,9 kb27812231 
out 20091   1 21955 4,9 kb27812231 
set 20091   1 21955 4,9 kb27812231 
ago 20091   1 21955 4,9 kb27812231 
jul 20091   1 21955 4,9 kb27812231 
jun 20091   1 2195514,9 kb27812231 
mai 20091   1 11955 4,9 kb27812231 
abr 20091   1 11955 4,9 kb27812231 
mar 20091   1 11955 4,9 kb27812231 
fev 20091   1 11955 4,9 kb27812231 
jan 20091   1 11955 4,9 kb27812231 
dez 20081   1 11955 4,9 kb27812231 
nov 20081   1 11955 4,9 kb27812231 
out 20081   1 11955 4,9 kb27812231 
set 20081   1 11955 4,9 kb27812231 
ago 20081   1 11955 4,9 kb27812231 
jul 20081   1 11955 4,9 kb27812231 
jun 200811  1 1195514,9 kb27812231 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1  3  5  10  25  5  1  3  5  10  25  100  250  5  10  100 
ago 2017            111       
jul 2017            2111   11 
jun 2017            52211     
mai 20171           2      1  
abr 20171           3         
mar 2017            1         
fev 2017            4         
jan 2017            1         
dez 2016                      
nov 2016                      
out 2016            1         
set 2016      1     1         
ago 20161     11    21        
jul 20161           1         
jun 20161           1         
mai 2016      1     1         
abr 2016                      
mar 2016            1         
fev 2016            1         
jan 20161     1               
dez 2015            21     1  
nov 2015      1     3         
out 201521    3     3      1  
set 20154     71    11        
ago 20151     2     311    11 
jul 2015      1     1         
jun 2015                   1  
mai 20151                     
abr 20151          22         
mar 201521    1    1          
fev 2015      21    51        
jan 20151111   11    21        
jul 2017            2111   11 
abr 20171           3         
jan 2017            1         
out 2016            1         
jul 20161           1         
abr 2016                      
jan 20161     1               
out 201521    3     3      1  
jul 2015      1     1         
abr 20151          22         
jan 20151111   11    21        
out 2014            2         
jul 2014                      
abr 2014            5         
jan 20141     1     41        
out 2013      1     41        
jul 2013      1     5      1  
abr 20132           5431      
jan 2013            2      11 
out 20121           521    1  
jul 2012111          5         
abr 20121111   21    222       
jan 201241111  211   522211 3  
out 20116221   3     521    11 
jul 201133111  2     831111    
abr 2011333321  41    113332  11 
jan 201132222  1     432221    
out 20101                     
jul 20101                     
abr 2010                      
jan 2010                      
out 2009                      
jul 2009                      
abr 2009                      
jan 2009            1         
out 2008                      
jul 2008                      

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
146100.0%2,973100.0%
31634.8%2,93398.7%
10919.6%2,89997.5%
32613.0%2,85596.0%
100510.9%2,79393.9%
31648.7%2,60187.5%

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
OlsiUC1985abr 01, 20112343out 29, 2015671
Mikullovci11UC2797nov 26, 20102469mar 31, 20121978
LaijmovaUC3417nov 13, 20102482mar 13, 20112362
SPQRobinUC4402mar 18, 20112357mar 18, 20112357
Olsi HysaUC5192out 08, 20102518mar 08, 20112367
DardaniusUC662abr 23, 20112321ago 02, 20112220
MargottUC721ago 12, 20141114set 01, 2015729
CommonsDelinkerUC812dez 07, 20102458mai 22, 2017100
Albanian04UC911out 12, 20112149out 20, 20112141
XiglofreUC106mai 03, 20112311jul 23, 20112230
LeeturtleUC116set 01, 2015729out 27, 2015673
PlanetiUC125mar 19, 20112356mar 19, 20112356
PASSWORDUC135fev 18, 20131654fev 18, 20131654
WikiLajmUC144dez 06, 20102459dez 06, 20102459
XalDUC154out 20, 20112141dez 19, 20112081
LaslovargaUC164out 21, 20112140dez 15, 20121719
MjbmrUC173mar 21, 20112354mar 21, 20112354
RomaineUC182mai 08, 20102671jul 24, 20102594
KurreshtjaUC192nov 24, 20102471nov 24, 20102471
EuriditiUC202mai 03, 20112311mai 11, 20112303

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 41 edições foram feitas por usuários anônimos, de um total de 3034 edições ( 1e %)
  


8 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
GrondinBotUC16out 24, 20112137dez 16, 20121718--
VolkovBotUC23jun 15, 20112268abr 16, 20121962--
タチコマ robotUC33jan 10, 20122059mai 23, 20121925--
DexbotUC43set 01, 20141094set 01, 20141094--
MjbmrbotUC52mar 24, 20112351mar 24, 20112351--
KamikazeBotUC61out 19, 20112142out 19, 20112142--
CarsracBotUC71jan 21, 20122048jan 21, 20122048--
JAnDbotUC81jun 13, 20131539jun 13, 20131539--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
ago 201776722367 632671774287     
jul 201776722367 632671769287     
jun 201776722367 632671754287     
mai 201776722267 632671728287     
abr 201776722267 632671728287     
mar 201776722267 632671728287     
fev 201776722267 632671728287     
jan 201776722067 632671728287     
dez 201676722067 632671728287     
nov 201676722067 632671728287     
out 201676722067 632671728287     
set 201676722067 632671728287     
ago 201676721967 632671728287     
jul 201676721867 632671728287     
jun 201676721867 632671728287     
mai 201676721867 632671728287     
abr 201676721767 632671728287     
mar 201676721767 632671728287     
fev 201676721767 632671728287     
jan 201676721767 632671728287     
dez 201576721767 632671728287     
nov 201576721567 632671728287     
out 201576721567 632671728287     
set 201576621567 632601728287     
ago 201576521567 632601728287     
jul 201576521067 632591728287     
jun 201576520967 632591728287     
mai 201576520967 632591728287     
abr 201576520967 632591728287     
mar 201576420967 632591728287    5
fev 201576220967 632591728287     
jan 201576220467 632591728287    15
dez 201476120167 632591728287     
nov 201476120167 632591728287     
out 201476119967 632591728287     
set 201476119867 632591728287    2
ago 201476019467 632591728287    3
jul 201475819267 632591728287     
jun 201475819267 632591728287     
mai 201475819267 632591728287     
abr 201475819267 632591728287     
mar 201475819066 632591728287     
fev 201475818766 632591728287    1
jan 201475818466 632591728287    1
dez 201375818066 632591728287     
nov 201375818066 632591728287     
out 201375817566 632591728286     
set 201375817166 632591728286     
ago 201375815866 632591728286    1
jul 201375815666 632591728286     
jun 201375815466 632591728286     
mai 201375815365 632441728286     
abr 201375815265 632441728286    2
mar 201375815065 632441726286     
fev 201375814565 632441726285    5
jan 201375613965 632441726285     
dez 201275613765 632441726285    511
nov 201275513263 602401724284     
out 201275513263 602401724284    2
set 201275412863 602401722284    6
ago 201275412463 602391722284     
jul 201275411963 602381721284    6
jun 201275311863 592381720284     
mai 201275311063 592371720284    29
abr 201274310763 582371719282    16
mar 201274110263 582371717282    109
fev 201273210059 582251707282    32
jan 20127279047 562201704282    28
dez 20117248346 481991691282    133
nov 20117217844 381911688282    9
out 20117206727 251821642212    21
set 20117196127 251811641212     
ago 20117195627 251811641212    15
jul 20117145427 25181 605212    44
jun 20117104621 6152 599201    16
mai 20117024020 6147 550191    144
abr 20116323218 6113 48218     162
mar 20115322117 6101 45916     721
fev 2011377 4  67 4129     51
jan 2011362 4  66 3359     146
dez 2010282 3  47 2479     463
nov 201082 3  31 306     249
out 20101    2 1      1
set 20101    2 1       
ago 20101    2 1      1
jul 20101    2 1      1
jun 20101    2 1       
mai 20101    2 1      1
abr 20101    2 1       
mar 20101    2 1       
fev 20101    2 1       
jan 20101    2 1       
dez 20091    2 1       
nov 20091    2 1       
out 20091    2 1       
set 20091    2 1       
ago 20091    2 1       
jul 20091    2 1       
jun 20091    2 1      1
mai 20091    2 1       
abr 20091    2 1       
mar 20091    2 1       
fev 20091    2 1       
jan 20091    2 1       
dez 20081    1 1       
nov 20081    1 1       
out 20081    1 1       
set 20081    1 1       
ago 20081    1 1       
jul 20081    1 1       
jun 20081    1 1      1

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2008: 1 1 Faqja kryesore

jun 2009: 1 1 Faqja kryesore

mai 2010: 1 1 Faqja kryesore

jul 2010: 1 1 Faqja kryesore

ago 2010: 1 1 Faqja kryesore

out 2010: 1 1 Faqja kryesore

nov 2010: 1 4 Faqja kryesore , 2 3 Facebook po na njeh gjithnjë e më shumë , 3 2 Zvicer, 45 milione dollare per diamantin e kuq , 4 2 Vritet gabimisht qeni-hero , 5 2 Vizat, Basha: Agjencitë të bëjnë kujdes , 6 2 Tragjedi në Fratar , 7 2 Topalli: Progresi i Shqipërisë , 8 2 Tiranë, në pranga gjashtë grabitës , 9 2 Tiranë, festohet 66 vjetori i çlirimit , 10 2 Studentët: Bëni transparencën , 11 2 Shqipëria, e 58-ta në renditjen e FIFA , 12 2 Shqipëri- Maqedoni , 13 2 Shkatërrohet organizata italo-shqiptare , 14 2 Sekuestrohen ushqime të skaduara në supermarkete , 15 2 Rrugët, mblidhen ministrat e rajonit , 16 2 Rama letër Berishës: Hetim materialeve zgjedhore, jo fletëve , 17 2 Rama: Xhami e re në Tiranë , 18 2 Rama: Berisha e ka ofertën e socialistëve , 19 2 Nën paralajmërimet për terror - Konferenca e ministrave të Brendshëm në Hamburg , 20 1 Livadhi

dez 2010: 1 3 Faqja kryesore , 2 2 NBA All Star Game: Wade shkëlqen në fitoren e Lindjes , 3 2 Moti në Shqipëri , 4 2 Moti në Maqedoni , 5 1 Zvicer, 45 milione dollare per diamantin e kuq

jan 2011: 1 2 Obama pergezon popullin sudanez , 2 2 Analizë e re gjaku që dallon qelizat kanceroze , 3 2 Faqja kryesore , 4 1 Stamboll: Ulje e detyruar e avionit

fev 2011: 1 2 Shqipëria noton në ujë zgjerohet përmbytja , 2 2 Shkodër 10 mijë ha tokë nën ujë Berisha: Banorët të evakuohen , 3 2 Rëndohet situata nga përmbytjet , 4 1 Zona verilndore:Situate e akseve rrugore eshte permiresuar

mar 2011: 1 4 Faqja kryesore , 2 2 Aurela Gaçe dërgon veri, jug dhe Çamëri në \"Eurosong\" , 3 2 Gjilanasit në Ulqin për karate , 4 2 Pacolli mbështet idenë e minishengenit , 5 2 Wilshere: Do ta fitojmë Ligën e Kampionëve , 6 2 Vizat, Basha: Agjencitë të bëjnë kujdes , 7 2 Vejusha gazmore së shpejti në skenën e Teatrit të Operas , 8 2 Tsunami shkatërron Japoninë, 337 viktima qindra kufoma në plazhe , 9 2 Tri shfaqje ne Teatrin Kombetar , 10 2 Tragjedi në Fratar , 11 2 Topalli: Progresi i Shqipërisë , 12 2 Tiranë, rihapet kinema Agimi , 13 2 Tiranë, në pranga gjashtë grabitës , 14 2 Tiranë, festohet 66 vjetori i çlirimit , 15 2 Studentët: Bëni transparencën , 16 2 Shqiptarët hyjnë në 2011 me çmime të çmendura , 17 2 Shqiptarët duan referendum në Mal të Zi , 18 2 Shkatërrohet organizata italo-shqiptare , 19 2 ShBA: Obama i kërkon Sarkozysë dhe Cameronit një strategji për Libinë , 20 2 Sekuestrohen ushqime të skaduara në supermarkete , 21 2 Rusi, Zeniti fiton Superkupën, mund 1-0 CSKA Moskën , 22 2 Rritja ekonomike, Shqipëria e para , 23 2 Rritet prania ushtarake rreth Libisë 2 luftanije USA, në Kretë , 24 2 Rooney paralajmëron Unitedin: Kujdes nga Arsenali , 25 2 Rikthehen Tre tenorët në Pallatin e Kongreseve

abr 2011: 1 2 Rinis beteja në Misratë, \"Stalingradin\" e Libisë , 2 2 Funeral i përgjakur në Siri: Së paku 8 të vrarë , 3 2 Trupat e Gadafit po tërhiqen nga Misrata , 4 2 Rama: Projektet për Kombinatin i mban peng Iliri e Saliu , 5 2 Pacolli: I gatshëm të respektojë plotësisht aktgykimin e kushtetueses , 6 1 Mposhtet Reali në \"Santiago Bernabeu\"

mai 2011: 1 7 Vritet Osama bin Laden , 2 3 Rezultatet e zgjedhjeve vendore 2011 në Shqipëri/Vlorë , 3 1 Rama: Drejtësia të japë drejtësi

jun 2011: 1 1 Më 6 korrik beteja e fundit ligjore për Tiranën

jul 2011: 1 2 Sudani i Jugut fiton pavarësinë , 2 1 Në plazhin e Durrësit mbytet një 70-vjeçar

ago 2011: 1 2 Arrihet marrëveshja mes KFOR-it dhe palës serbe , 2 2 Berisha me rekord të ri në not , 3 2 Thaçi: Kufiri, çështje ekzistenciale për Kosovën

out 2011: 1 5 Vritet Gadafi , 2 2 Faqja kryesore

nov 2011: 1 1 Kapet i gjallë djali i Gadafit

dez 2011: 1 2 Shuhet Václav Havel , 2 1 Gianni De Biasi zyrtarisht trajneri i kombëtares shqiptare

jan 2012: 1 4 Wikipedia në gjuhën angleze mbyllet për 24 orë , 2 1 Rama: Të hetohen Berisha dhe Basha

fev 2012: 1 2 Livadhi , 2 1 Kandahar, vriten 2 komando shqiptare

mar 2012: 1 2 Francë, 4 viktima në një shkollë hebraike , 2 1 DASH reagon ndaj arrestimeve të fundit në Kosovë dhe Serbi

abr 2012: 1 1 Serbi, Presidenti Tadiç deklaron largimin nga posti; hapet rruga për zgjedhje

mai 2012: 1 1 Tragjedi në Himarë, 14 të vdekur e 19 të plagosur

jul 2012: 1 1 Sipas një studimi, pasiviteti është po aq vdekjeprurës sa duhani

set 2012: 1 1 Sipas një studimi, pasiviteti është po aq vdekjeprurës sa duhani

out 2012: 1 1 Tiranë: Disa grevistë në gjendje të rëndë

dez 2012: 1 5 Dhjetëra të vdekur në një shkollë në SHBA

fev 2013: 1 1 Kivi, mrekullia ekzotike per shendetin

abr 2013: 1 2 Hapësirë, \"Endeavour\" mbyll me sukses udhëtimin e fundit në Orbit

ago 2013: 1 1 Faqja kryesore

jan 2014: 1 1 Rehn: Kriza e Euros kerkon veprime te shpejta

fev 2014: 1 1 Zemërim në Bukuresht - Grindje për hyrjen në Shengen të Rumanisë dhe Bullgarisë

ago 2014: 1 1 I merret fryma Shkollës \"Foto Puka\" Lushnje

set 2014: 1 1 Fyle: PD, jo politikë në rrugë

jan 2015: 1 1 U zhvillua në Kiev Wikimedia CEE Meeting 2014

mar 2015: 1 1 Wiki Women Camp

abr 2015: 1 1 Lejme te reja

mai 2015: 1 1 Zbulohet sekreti i unazave të Saturnit

ago 2015: 1 1 Kosovë-Maqedoni së shpejti lëvizja vetëm me letërnjoftime

set 2015: 1 4 Rifillon konkursi Wiki Loves Monuments 2015

out 2015: 1 2 Wikipedia Weekend Tirana 2015

jan 2016: 1 1 Libia është e gatshme për negociata dhe reforma politike

jun 2016: 1 1 Shqipëria noton në ujë zgjerohet përmbytja

jul 2016: 1 1 Qeshni 10 minuta në ditë për të humbur në peshë

ago 2016: 1 1 Bashkimi Evropian, Projekt 1 milion euro për Bankën e Shqipërisë

abr 2017: 1 1 Faqja kryesore

mai 2017: 1 1 Pacolli: Shqiptarët në Maqedoni duhet të jenë unikë

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de setembro 2017 18:00

Dump file sqwikinews-20170920-stub-meta-history.xml.gz (edits only), size 504 kb as gz -> 3.7 Mb
Dump processed till Aug 31, 2017, on server stat1005, ready at Thu-21/09/2017-06:05 after 7 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.