Estatísticas da Wikinotícias turco

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: outubro 2016
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
out 2016+2%   0%          0%
ago 2016+2%   0%          0%
jun 20160%   +1%   -61%      +2%
mai 2016+2%   +3%   +164%      +5%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 20164411 1,1 k 9,3 11      175
set 201643   1,1 k 9,3 2      175
ago 20164311 1,1 k 9,3 15      175
jul 201642   1,1 k 9,3        175
jun 201642 2 1,1 k 9,3 116      175
mai 2016421311,1 k19,3 296      172
abr 201641 211,1 k19,3 112      164
mar 201641 1 1,1 k 9,3 27      161
fev 20164112 1,1 k19,3 62      160
jan 201640   1,1 k 9,4 10      158
dez 201540 1 1,1 k 9,4 5      157
nov 201540   1,1 k 9,4 4      157
out 201540 2 1,1 k 9,5 35      157
set 201540   1,1 k 9,4        155
ago 201540   1,1 k 9,4        155
jul 201540   1,1 k 9,4 2      155
jun 201540   1,1 k 9,4 2      155
mai 201540   1,1 k 9,4 3      155
abr 201540   1,0 k 9,4 2      155
mar 201540   1,0 k 9,51381 2,2 Mb219 k961,1 k242,3 k155
fev 201540   1,0 k 9,5138142,2 Mb219 k961,1 k242,3 k155
jan 201540 1 1,0 k 9,5138172,2 Mb219 k961,1 k242,3 k155
dez 201440   1,0 k 9,4138222,2 Mb219 k961,1 k242,3 k154
nov 201440 1 1,0 k 9,51380492,1 Mb218 k961,1 k242,3 k154
out 20144022 1,0 k 9,41380682,1 Mb218 k961,1 k242,3 k154
set 201438   1,0 k 9,5138262,1 Mb216 k951,1 k242,3 k154
ago 201438   1,0 k 9,5138242,1 Mb216 k951,1 k242,3 k154
jul 201438   1,0 k 9,5138212,1 Mb216 k951,2 k242,3 k154
jun 201438   1,0 k 9,5138212,1 Mb216 k951,2 k242,3 k154
mai 201438   1,0 k 9,5138222,1 Mb216 k951,2 k242,3 k154
abr 201438   1,0 k 9,51383 2,1 Mb216 k951,2 k242,3 k154
mar 201438   1,0 k 9,5138332,1 Mb216 k951,2 k242,3 k154
fev 201438   1,0 k 9,5137912,1 Mb215 k951,2 k242,2 k154
jan 201438   1,0 k 9,5137912,1 Mb215 k951,2 k242,2 k154
dez 201338   1,0 k 9,51379 2,1 Mb215 k951,2 k242,2 k154
nov 201338   1,0 k 9,5137912,1 Mb215 k951,2 k242,2 k154
out 20133812 1,0 k 9,51379312,1 Mb215 k951,2 k242,2 k154
set 201337 1 1,0 k 9,51378102,1 Mb213 k951,1 k232,2 k152
ago 201337 1 1,0 k 9,6137372,1 Mb211 k921,1 k232,2 k152
jul 201337 1 1,0 k 9,61369252,1 Mb210 k921,1 k232,2 k152
jun 201337   1,0 k 9,6137042,1 Mb210 k921,1 k232,2 k152
mai 201337 1 1,0 k 9,61368992,1 Mb209 k921,1 k232,2 k152
abr 20133711 1,0 k 9,51368362,1 Mb209 k921,1 k232,2 k152
mar 201336   1,0 k 9,51362 2,0 Mb207 k921,1 k192,2 k142
fev 20133612 1,0 k19,51362892,0 Mb207 k921,1 k192,2 k142
jan 201335 1 964 9,81342291,9 Mb195 k881,1 k192,0 k134
dez 2012351  952 9,9133451,9 Mb190 k851,1 k192,0 k130
nov 201234 2 951 9,91337201,9 Mb190 k851,1 k192,0 k128
out 201234 2 943 101343261,9 Mb190 k831,1 k192,0 k128
set 20123412 932 10,11339571,9 Mb187 k781,1 k192,0 k127
ago 201233 4 921110,113391271,8 Mb186 k771,1 k192,0 k126
jul 20123312 904 10,21349281,8 Mb183 k771,1 k191,9 k120
jun 201232 11899 10,213481591,8 Mb182 k771,1 k191,9 k120
mai 201232   887 10,21338 1,8 Mb178 k771,1 k191,9 k118
abr 201232 2 887 10,21338361,8 Mb178 k771,1 k191,9 k118
mar 20123211 880 10,21342361,8 Mb176 k771,1 k191,9 k113
fev 201231 2 872 10,21344181,7 Mb175 k771,1 k201,9 k111
jan 201231 5 868110,313401351,7 Mb174 k761,1 k191,9 k111
dez 201131 5 847110,413541001,7 Mb167 k761,0 k161,8 k86
nov 20113115 828 10,513441531,6 Mb162 k751,0 k141,8 k82
out 201130 5 814110,513491841,6 Mb159 k751,0 k141,8 k77
set 201130 3 783110,713341281,5 Mb150 k72998141,7 k67
ago 201130461762110,813233431,5 Mb145 k67997111,6 k66
jul 201126142724310,912944901,4 Mb134 k6297781,5 k62
jun 201125 61635111,612402641,2 Mb113 k5692181,4 k56
mai 201125 1 601 11,91209121,1 Mb105 k5293981,3 k54
abr 201125 2 597 11,91206411,1 Mb104 k5193581,3 k54
mar 201125 4 592 11,91206681,1 Mb103 k5193381,2 k54
fev 20112515 58111212041271,1 Mb101 k5189781,2 k50
jan 201124161559112,311833301,0 Mb96 k5184781,2 k49
dez 20102314 519212,61158140970 kb88 k5169281,1 k49
nov 201022 3 471 13,6110327867 kb77 k5142781,1 k49
out 20102211 463 13,8109210847 kb75 k5141971,0 k49
set 201021 4 460 13,8106766828 kb73 k5141871,0 k49
ago 20102126 4491141020203785 kb68 k5141271,0 k49
jul 201019 3 408 14,9100549714 kb62 k51390393549
jun 201019 3 403 15100546706 kb61 k51390392349
mai 201019151398215,1999316696 kb60 k51386390849
abr 20101814 347116,498978611 kb52 k48350278749
mar 20101712 327 17,299036575 kb49 k43317274149
fev 201016 4 323 17,3986141567 kb48 k42315272749
jan 201016262315217,2966584545 kb47 k39296269849
dez 200914 81253119,2970361439 kb37 k32255157143
nov 200914251228119,7935319389 kb33 k25228151343
out 200912241206120,2960318351 kb29 k15313146622
set 200910252185120,8963641317 kb27 k15265142621
ago 20098242154120,89481,0 k263 kb22 k13231735612
jul 20096 41130 16,91007223232 kb18 k1231574292 
jun 20096251123116961664211 kb17 k1231571256 
mai 20094 4186215,28571,1 k131 kb10 k531668140 
abr 2009424 2617,8108017143 kb4,0 k11064955 
mar 2009211 7 4,610731311 kb1,1 k151411 
fev 20091   3 6,31299 7,6 kb53212554 
jan 20091   3 6,31299 7,6 kb53212554 
dez 20081   3 6,31299 7,6 kb53212554 
nov 20081   3 6,31299 7,6 kb53212554 
out 20081   3 6,31299 7,6 kb53212554 
set 20081   3 6,31299 7,6 kb53212554 
ago 20081 1 3 6,3129977,6 kb53212554 
jul 20081   1 122373 5,7 kb32712341 
jun 20081   1 12237345,7 kb32712341 
mai 20081   1 8237115,7 kb32712142 
abr 20081   1 72371 5,7 kb32712142 
mar 20081   1 72371 5,7 kb32712142 
fev 20081   1 72371 5,7 kb32712142 
jan 20081   1 72371 5,7 kb32712142 
dez 20071   1 72371 5,7 kb32712142 
nov 20071   1 72371 5,7 kb32712142 
out 20071   1 7237115,7 kb32712142 
set 20071   1 62363 5,7 kb32612142 
ago 20071   1 62363 5,7 kb32612142 
jul 20071   1 6236325,7 kb32612142 
jun 200711  1 4236345,6 kb32612141 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 201615   17 7        18
abr 201615 15717117 9      18
jan 201615   17 6 16      18
out 201515 12 17 6 13      18
jul 201515   17 7 17      18
abr 201515   17 7 17      18
jan 201515615817127141617171614161718
out 201415512817117141217171613161718
jul 2014151017617117141817171616161718
abr 2014151117517126141817171616171718
jan 201415917817136141717171616161718
out 2013151015817136141717171616151618
jul 20131411181217156141717171616161618
abr 20131310171316176131717171614161618
jan 201313101812161516161717171614171618
out 201212101711161616161717171613171618
jul 201213111512161516161617171613171618
abr 20121381511161516161517171613171618
jan 201213111212161414141417171613171618
out 201113141112151414141217171613171618
jul 20111381171441313817171613171618
abr 201113101711161413131617161612171518
jan 201113131012161413131216161612171418
out 20101371610161412121616161615171418
jul 201014131311161311111416161615171418
abr 2010149118161211111216161515171618
jan 20101471041681111816161515171618
out 2009149121016121111916161714171618
jul 200915111110151211111016151614121518
abr 20091699915111111916151715121518
jan 200917131310161211111616161616141617
out 200816111211161311111516161616141616
jul 200816101310161110101516161616141616
abr 2008167129161010101616161616141616
jan 2008161014101613991516161615141616
out 200715101291511991415151515131515
jul 2007157138159991415151515131515
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  1000  5  10  100  1000 
out 2016321     1        1       1111
set 20162      1        41      2221
ago 20162111    11       4322    1111
jul 2016       21       211     1111
jun 201622221   42111    63321   2221
mai 2016763221   64321    944322  1111
abr 2016322111   31111    521111  2221
mar 20163111    2        53111   111 
fev 201622221   521      6421        
jan 2016       4        1       1111
dez 2015111     2        411     3221
nov 201521     4        4       1111
out 201532211   4        53111   3211
set 2015       6        1       4321
ago 2015       5        311     222 
jul 20151      1        31          
jun 20152      4        4       321 
mai 201511              4       1111
abr 20152      41     2271111       
mar 2015       521    1122111   2211
fev 201521     52       821     1111
jan 2015111     321      72111   2111
dez 20141      1        4       2211
nov 201411111   32       3111    1111
out 201422221   3221     1821111  1111
set 201411     5        511111  2221
ago 2014       1        83111   3311
jul 20141      3        721111  1111
jun 2014                1       3321
mai 20142      111      61      1111
abr 2014                7       111 
mar 201411     4        51      2221
fev 2014       2        511     211 
jan 20141      4        72111   2211
out 2016321     1        1       1111
jul 2016       21       211     1111
abr 2016322111   31111    521111  2221
jan 2016       4        1       1111
out 201532211   4        53111   3211
jul 20151      1        31          
abr 20152      41     2271111       
jan 2015111     321      72111   2111
out 201422221   3221     1821111  1111
jul 20141      3        721111  1111
abr 2014                7       111 
jan 20141      4        72111   2211
out 20135221    31       20742    3211
jul 20134211             1011     2211
abr 20134111             7111    2111
jan 20135111    2        5222    2211
out 20124221    3        1442     3311
jul 20123222    4        10211    2111
abr 20124221    532      622     2111
jan 2012138531   8431     156332   4311
out 2011156542   6321     146431   2211
jul 20111354432   8443     40114432  2211
abr 20118321    621      1475     3331
jan 2011876421   10332     233331   5541
out 2010211     3        6       4411
jul 201083311   7111     8211    1111
abr 201084421   5211   1 116332   321 
jan 20101176522111106332    16855321 3321
out 200912643211  138421    24986211 221 
jul 2009444211   11       4222111     
abr 200965433            42211       
jan 2009                            
out 2008                            
jul 2008                            
abr 2008                            
jan 2008                            
out 20071                           
jul 20071                           

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1131100.0%10,299100.0%
35743.5%10,18198.9%
104534.4%10,11498.2%
322015.3%9,65993.8%
1001511.5%9,40091.3%
31675.3%7,95477.2%
100021.5%5,43852.8%
316210.8%4,10539.9%

 

3 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
HakanISTUC45+71051972mai 20, 201616311--
Mahmut89UC70...33--out 18, 20161211--
CemlinkUC88...22--out 31, 2016 11--

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Reality006UC14,105abr 29, 20092741dez 29, 20111767
SeksenUC21,333nov 26, 20092530mai 25, 2016158
EmperyanUC3761dez 03, 20102158jul 12, 20131206
Koc61UC4526jan 15, 20112115dez 28, 20111768
MerhabavikiUC5467fev 17, 2016256ago 09, 201682
SrhatUC6409abr 12, 20092758jun 21, 20111958
Osmanlı98UC7353jan 09, 20102486fev 27, 20112072
Yusuf AvcıUC8310out 25, 20092562mar 26, 20102410
JosephUC9282ago 19, 20082994jan 16, 20112114
İncelemeelemaniUC10179jun 09, 20111970out 26, 20131100
OğuzhanUC11169mai 12, 20092728mai 15, 20111995
UğurkentUC12146jul 21, 2014832out 30, 2015366
SPQRobinUC13133mar 01, 20092800ago 12, 20092636
Manco CapacUC14115ago 13, 20092635jun 01, 20102343
MuratsahanUC15112abr 22, 20092748jun 16, 20092693
Urungu97UC1672mai 19, 2016164jun 08, 2016144
SzoszvUC1757dez 15, 20092511ago 06, 20111912
KibeleUC1848abr 12, 20102393mai 29, 2016154
BermanyaUC1946jan 25, 20112105set 11, 20121510
XalDUC2036ago 25, 20092623jan 02, 20121763

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 207 edições foram feitas por usuários anônimos, de um total de 10615 edições ( 1e %)
  


10 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
GrondinBotUC122ago 21, 20092627jan 22, 20121743--
JosephBotUC221jan 10, 20102485mai 18, 20102357--
VolkovBotUC320set 02, 20092615abr 15, 20131294--
CommonsDelinkerUC410jun 19, 20092690mai 26, 20161571-
BOT-SuperzerocoolUC510nov 06, 20092550fev 21, 2014982--
DexbotUC65ago 31, 2014791set 01, 2014790--
AmirobotUC74jul 20, 20111929jul 27, 20111922--
CarsracBotUC83set 13, 20102239jan 21, 20121744--
MjbmrbotUC92mar 13, 20112058mar 14, 20112057--
JAnDbotUC102jun 13, 20131235ago 13, 20148091-

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
out 20161,3 k5192,9 k109065032,3 k106      28
set 20161,3 k5192,9 k108965032,3 k106      28
ago 20161,3 k5172,8 k108964932,2 k106      28
jul 20161,3 k5152,8 k108964832,2 k106      28
jun 20161,3 k5142,8 k108864832,2 k106      28
mai 20161,3 k5102,7 k108864732,1 k106      28
abr 20161,3 k5042,7 k108863832,1 k106      28
mar 20161,2 k5042,6 k108863832,0 k106      28
fev 20161,2 k5042,6 k108863832,0 k106      28
jan 20161,2 k5032,6 k108863432,0 k106      28
dez 20151,2 k5032,6 k108863432,0 k106      28
nov 20151,2 k4982,5 k108863431,9 k106      28
out 20151,2 k4962,5 k108863431,9 k106      28
set 20151,2 k4952,5 k108562721,9 k106      28
ago 20151,2 k4952,4 k108562721,8 k106      28
jul 20151,2 k4912,4 k108562621,8 k106      28
jun 20151,2 k4882,4 k108562621,8 k106      28
mai 20151,2 k4862,3 k108562621,8 k106      28
abr 20151,2 k4842,3 k108562621,8 k106      28
mar 20151,2 k4822,3 k108562621,7 k106      28
fev 20151,2 k4822,2 k108562621,7 k106     428
jan 20151,2 k4742,2 k108562621,7 k106     728
dez 20141,2 k4702,2 k108562621,7 k106     228
nov 20141,2 k4682,1 k108562621,7 k106     4928
out 20141,2 k4612,1 k108562621,7 k106     6828
set 20141,2 k4602,1 k108262521,6 k106     428
ago 20141,2 k4572,0 k108262521,5 k106      28
jul 20141,2 k4532,0 k108262521,4 k106     128
jun 20141,2 k4522,0 k108260121,4 k106      28
mai 20141,2 k4521,9 k108260121,4 k106     228
abr 20141,2 k4511,9 k108260121,4 k106      28
mar 20141,2 k4491,9 k108260121,4 k106     328
fev 20141,2 k4461,8 k108260121,4 k106      28
jan 20141,2 k4401,8 k108260121,4 k106     128
dez 20131,2 k4351,8 k108260121,4 k106      28
nov 20131,2 k4351,7 k108260121,3 k106      28
out 20131,2 k4321,7 k108260121,3 k106     3028
set 20131,2 k4271,7 k108260121,3 k106     1028
ago 20131,2 k4131,6 k108260121,3 k106     628
jul 20131,2 k3881,6 k108260121,3 k106     2328
jun 20131,2 k3841,6 k108260121,3 k106     328
mai 20131,2 k3831,5 k108160021,3 k106     9928
abr 20131,1 k3811,5 k108160021,3 k106     2928
mar 20131,1 k3771,5 k108159921,3 k106      28
fev 20131,1 k3691,4 k108159721,3 k106     8628
jan 20131,1 k3611,4 k108159521,3 k106     2628
dez 20121,1 k3591,4 k108159121,3 k106     528
nov 20121,1 k3521,4 k108155921,3 k106     2028
out 20121,1 k3501,4 k108155921,3 k106     2628
set 20121,1 k3431,4 k108155621,3 k106     5728
ago 20121,0 k3351,3 k108155221,3 k106     12728
jul 20121,0 k3311,3 k98153921,3 k102     2518
jun 20121,0 k3291,3 k98053921,3 k102     15218
mai 20129943221,2 k87953811,3 k102       8
abr 20129943191,2 k87953811,3 k102     29 8
mar 20129833131,2 k87953811,3 k102     30 8
fev 20129743091,1 k87953811,2 k102     16 8
jan 20129713011,1 k87853411,2 k102     121 8
dez 20119262891,1 k87752911,2 k102     98 8
nov 20119082841,1 k87752911,2 k102     152 8
out 201188826996987752811,2 k102     179 8
set 201184726096977752311,2 k102     127 7
ago 2011824250873775518 1,2 k102     341 7
jul 2011785247872775472 1,2 k102     482 7
jun 2011687233869771464 1,1 k100     263 7
mai 2011653226772729447 1,1 k100     11 7
abr 2011650217772729447 1,1 k100     36 7
mar 2011645208772729447 1,1 k100     58 7
fev 2011630207770725441 1,1 k99     117 7
jan 2011608201674725436 1,1 k99     329 7
dez 2010568193673724435 1,1 k99     137 7
nov 2010520189579724433 1,0 k99     27 7
out 2010512180577723431 99999     8 7
set 2010509176577723431 99899     60 7
ago 2010498168478723428 97699     201 7
jul 2010457152474723401 94957     47 7
jun 2010452151474723401 94957     43 7
mai 2010447139348723400 91457     309 7
abr 2010396134308723386 85555     75 7
mar 2010376126274723382 84355     31 7
fev 2010372121237723382 80655     129 7
jan 2010364111205723360 76055     537 7
dez 200929690197722352 71348     359 7
nov 200927184163722331 63348     304 7
out 20092286776711312 58345     314 7
set 2009206544477290 52944     617 7
ago 2009166432415232 45127     988 1
jul 2009130 3  123 33112     223  
jun 2009123 1  120 29512     663  
mai 200986    59 2048     1107  
abr 200926    10 32      171  
mar 20097    7 6      13  
fev 20093    6 1         
jan 20093    6 1         
dez 20083    6 1         
nov 20083    6 1         
out 20083    6 1         
set 20083    6 1         
ago 20083    6 1      7  
jul 20081    5           
jun 20081    5           
mai 20081    4           
abr 20081    4           
mar 20081    4           
fev 20081    4           
jan 20081    4           
dez 20071    4           
nov 20071    4           
out 20071    4           
set 20071    4           
ago 20071    4           
jul 20071    4           
jun 20071    4           

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2007: 1 1 Ana Sayfa

out 2007: 1 1 Ana Sayfa

mai 2008: 1 1 Ana Sayfa

jun 2008: 1 2 Ana Sayfa

ago 2008: 1 1 Ana Sayfa

mar 2009: 1 2 Ana Sayfa

abr 2009: 1 4 Türkiye'de 2009 yerel seçimleri yapıldı , 2 4 \"ABD uzlaşma taraftarı\" , 3 3 Ana Sayfa , 4 3 Dünya Kupası elemeleri, İspanya 1 - 0 Türkiye , 5 3 Premier League'de gol düellosu , 6 3 KKTC'de 10. genel seçimler yapıldı , 7 3 Hindistan'da bir havai fişek fabrikası yandı , 8 3 Domuz gribi yayılıyor , 9 3 Diyarbakır'da terör saldırısı

mai 2009: 1 5 Ana Sayfa , 2 3 Türkiye'de kabine revizyonu , 3 3 Norveç, Eurovision'da birinci oldu , 4 3 Mehmet Ali Talat İstanbul'da , 5 3 Mardin'de düğüne silahlı saldırı , 6 3 Malatya'da Atatürk büstünü kıran ineğe soruşturma açıldı , 7 3 Hızlı tren yolcu sayısını artırdı , 8 3 Türkiye'den Dailymotion'a erişim yasaklandı , 9 3 Aliyev ile Sarkisyan Prag'da görüştüler , 10 2 İtalya'da 6,3 büyüklüğünde deprem , 11 2 Dünya Kupası elemeleri, İspanya 1 - 0 Türkiye , 12 2 İspanya'da 600 asker karantinada , 13 2 Zeki Sezer DSP genel başkanlığından istifa etti , 14 2 Türkiye'de kredi kartı aidatı 3 yılda bir alınacak , 15 2 Türkiye'de cari açık yüzde 90,6 azaldı , 16 2 Türkiye'de 2009 yerel seçimleri yapıldı , 17 2 Twitter büyümeye devam ediyor

jun 2009: 1 3 Turkcell Süper Lig şampiyonu Beşiktaş , 2 2 Ana Sayfa , 3 2 Dünya Kupası elemeleri, İspanya 1 - 0 Türkiye , 4 2 İran'da Cumhurbaşkanlığı seçimi , 5 2 Ukrayna'da domuz gribi vakası , 6 2 Ufuk Uras ÖDP'den istifa etti , 7 2 Türkiye Kupası Beşiktaş'ın , 8 2 Twitter büyümeye devam ediyor , 9 2 Turkcell Süper Lig'e son katılan takım Kasımpaşa , 10 2 Tiranosorus'da kolajen saptandı , 11 2 TBL'nin yeni takımları belli oldu , 12 2 Sri Lanka'daki 26 yıllık iç savaş sona erdi , 13 2 Son UEFA kupasının sahibi belli oldu , 14 2 Dünya Kupası elemeleri, Türkiye 1 - 2 İspanya , 15 2 RTÜK üyesi Mehmet Dadak kınama cezası aldı , 16 2 Premier Lig'in şampiyonu Manchester United , 17 2 Premier League'de gol düellosu , 18 2 Pana Film'den yeni bir sinema filmi , 19 2 Pakistan'ın Peşaver şehrinde patlama , 20 2 Musavi seçimi kazandığını iddia etti , 21 2 La Liga'da gol düellosu , 22 2 Irak'ta şiddet durulmuyor , 23 2 Hacettepe Galatasaray'ı mağlup etti

jul 2009: 1 3 Dursun Çiçek önce tutuklandı sonra tahliye edildi , 2 2 İzlanda, AB yolunda , 3 2 İran'da uçak düştü , 4 2 Sincan Uygur Özerk Bölgesi'nde çatışma , 5 2 Pardus 2009 yayınlandı , 6 2 Nabucco'da devletler arası anlaşma imzalandı , 7 2 Honduras'ta askerî darbe , 8 1 Ana Sayfa

ago 2009: 1 5 Ana Sayfa , 2 4 Türkiye'de 2009 yerel seçimleri yapıldı , 3 4 Türkan Saylan hayatını kaybetti , 4 4 Türk Dil Kurumundan Atasözleri ve Deyimler Sözlüğü , 5 4 Facebook'a İran yasağı , 6 3 Ted Kennedy hayatını kaybetti , 7 3 The Simpsons Afrika'da , 8 3 Yunanistan'da orman yangınları sonucu olağanüstü hal ilan edildi , 9 3 Madrid Havalimanı'ndaki Spanair'e ait MD82 tipindeki uçağın kazasının ara raporu açıklandı , 10 3 Lockerbie'nin bombalamasının sorumlularından El Migrahi serbest bırakıldı , 11 3 İngilizce Vikipedi 3 milyon maddeyi aştı , 12 3 İtalya'da 6,3 büyüklüğünde deprem , 13 3 İran'da çatışmalarda en az 21 kişi hayatını kaybetti , 14 3 Zeki Sezer DSP genel başkanlığından istifa etti , 15 3 Uzan grubunun İsviçre'deki banka hesaplarına el konuldu , 16 3 Türkiye'de kabine revizyonu , 17 3 Türkiye'de Gençlik ve Spor Bayramı kutlanıyor , 18 3 Twitter büyümeye devam ediyor , 19 3 Turkcell Süper Lig'e son katılan takım Kasımpaşa , 20 3 Taksim'de 32 yıl sonra 1 Mayıs , 21 3 TRT'den müzik kanalı , 22 3 Sincan Uygur Özerk Bölgesi'nde çatışma , 23 3 Rifat Hisarcıklıoğlu, TOBB Başkanlığına yeniden seçildi , 24 3 Obama Türkiye'de , 25 3 Norveç, Eurovision'da birinci oldu

set 2009: 1 4 ABD'li oyuncu Patrick Swayze 57 yaşında öldü , 2 3 Türkiye'de üretilen ilk yerli uydu İTÜpSAT1 bugün uzaya fırlatılıyor , 3 3 Yeni ay aracı başarıyla denendi , 4 3 Doğan Yayın Holding'e rekor ceza , 5 3 Hakkâri, Siirt ve Van'da çatışma , 6 3 Türkiye'de sel felaketi , 7 3 Endonezya'da deprem yine can aldı , 8 2 Tasarımını Kaddafi’nin yaptığı “roket” adlı otomobil tanıtıldı , 9 2 New York'ta THY uçağına lastik bulunamadı , 10 2 Sidney'de kum fırtınası , 11 2 Türkiye ile Suriye arasındaki vize uygulaması kaldırıldı , 12 2 Karzai seçimi önde götürüyor , 13 2 Çin'de grizu patlaması , 14 2 Çin'de altın madeninde yangın , 15 2 Gürcistan'da deprem , 16 2 VH:KY , 17 2 Dünya Kupası elemeleri, Ermenistan 0 - 2 Bosna-Hersek , 18 1 Ana Sayfa

out 2009: 1 4 NASA Ay'ı vurdu , 2 4 Nobel Barış Ödülü Obama'nın , 3 4 PASOK zaferini ilan etti , 4 3 Mercedes'ten ışık ihlaline karşı önlem , 5 2 Ana Sayfa , 6 2 Chirac yargılanacak

nov 2009: 1 4 Macaristan'da işsizlik son 13 yılın rekorunu kırdı , 2 4 ABD'de askeri üste silahlı saldırı , 3 3 İsviçre'de minare yapımı yasaklandı , 4 3 Üniversite öğrencilerini taşıyan midibüse çığ düştü , 5 3 Hamid Karzai yeniden Afganistan Devlet Başkanı seçildi , 6 3 Chirac yargılanacak , 7 2 Avrupa Birliği, üç ülke için vizeyi kaldırıldı , 8 2 Mersin, Şanlıurfa ve İstanbul'da olaylar çıktı , 9 2 İran, nükleer programını genişletme kararı aldı , 10 2 Türkçe arama motoru kuruluyor , 11 2 Rusya'da bombalı saldırı , 12 2 Dubai ekonomik krize girdi , 13 1 Ana Sayfa

dez 2009: 1 4 Silvio Berlusconi saldırıya uğradı , 2 3 Finlandiya'da alışveriş merkezine silahlı saldırı , 3 3 Çinli Liu Xiaobo yargılanmaya başlandı , 4 3 Rusya Dışişleri Bakanı Lavrov, Mübarek ile görüştü , 5 3 Muş'taki gösterilerde olaylar çıktı: 2 ölü , 6 3 Demokratik Toplum Partisi kapatıldı , 7 3 Vikipedi kullanıcıları Bakü'de toplandı

jan 2010: 1 4 7 büyüklüğündeki deprem Haiti'yi vurdu , 2 4 Arnavutluk'ta sel felaketi , 3 3 Türkiye \"Balyoz Harekât Planı\"nı konuşuyor , 4 3 Haiti'de 6.1 şiddetinde deprem , 5 3 Irak'ta saldırı , 6 3 Polonya'da füze üssü kurulacak , 7 3 California'da sel , 8 3 Ukrayna'da cumhurbaşkanlığı seçimi , 9 3 Mehmet Ali Ağca tahliye edildi , 10 2 Yemen'de orduya saldırı , 11 2 Usame Bin Ladin'e ait olduğu iddia edilen ses kaydı yayınlandı , 12 1 Çin ABD'ye nota verdi

fev 2010: 1 4 Recep Tayyip Erdoğan sanatçılarla buluştu , 2 4 2010 Kış Olimpiyatları başladı , 3 3 Balyoz darbe planı soruşturması ile ilgili olarak tutuklanan subay sayısı 37'ye ulaştı , 4 1 Japonya'da 7.0 büyüklüğünde deprem

mar 2010: 1 3 Balyoz darbe planı soruşturması ile ilgili olarak tutuklanan subay sayısı 37'ye ulaştı , 2 2 Wikipedia ve kardeş projelere bir süre erişilemedi

abr 2010: 1 3 Somali'deki iki saldırıda 14 kişi öldü , 2 3 Papua Yeni Gine'de 6.3 büyüklüğünde deprem , 3 3 İzlanda'da patlayan yanardağın külleri Avrupa'yı felç etti , 4 2 Telenor'un Kosova'daki iki baz istasyonu kapalı olacak , 5 2 Meksika Körfezi'nde petrol sızıntısı , 6 2 Sofya Havalimanı'nda 107 papağan ele geçirildi

mai 2010: 1 8 İsrail Gazze'ye yardım taşıyan gemilere saldırdı, 9 aktivist öldürüldü , 2 6 Libya'daki uçak kazasında 100'den fazla kişi öldü , 3 5 27 Mayıs Darbesi 50. yılında protesto edildi , 4 3 Google'ın Android'i, iPhone'u geçti , 5 3 Deniz Baykal, Cumhuriyet Halk Partisi Genel Başkanlığı'ndan istifa etti , 6 2 Türkçe Vikihaber 400 habere ulaştı , 7 2 2010'un genç müzisyeni Lara Ömeroğlu , 8 2 Everest Dağı'nda yeni rekor , 9 2 Kemal Kılıçdaroğlu, Cumhuriyet Halk Partisi Genel Başkanı seçildi , 10 2 Türkiye'de eğitim uçağı düştü: 2 ölü

jun 2010: 1 5 İstanbul'da sağanak yağış sebebiyle okullar tatil edildi , 2 3 Estonya Euro bölgesine dahil oluyor , 3 2 Telenor'un Kosova'daki iki baz istasyonu kapalı olacak

jul 2010: 1 3 2010 FIFA Dünya Kupası İspanya'nın oldu , 2 2 Vuvuzela çaldığı için öldürüldü , 3 1 Spor Toto Süper Lig 2010-2011 Sezonu fikstürü belli oldu

ago 2010: 1 3 Filipinler'de rehine krizi , 2 3 İran nükleer reaktörüne yakıt yüklemeye başladı , 3 3 Tel Aviv'deki Türk büyükelçiliğine giren Filistinli İsraillilere teslim edildi , 4 3 2010 FIFA Dünya Kupası İspanya'nın oldu , 5 2 Fransa'nın çingene siyasetine tepki , 6 2 Hollandalı Türkler Wilders koalisyonundan kaygılı , 7 2 Şilili madenciler için alternatif plan , 8 2 Türkiye'deki Dünya Basketbol Şampiyonası öncesi BM'den kampanya , 9 2 İspanya'da boğa 30 seyirciyi yaraladı , 10 2 Sümela Manastırı'nda tarihî ayin , 11 2 Nasrallah: \"Hariri'yi İsrail öldürdü\" , 12 2 2010 Yüksek Askerî Şûra kararları açıklandı , 13 2 İsrail-Lübnan sınırında çatışma

set 2010: 1 2 Irak'taki muharebeler resmen sona erdi , 2 1 2010-2011 Spor Toto Süper Lig 6. Hafta: Galatasaray-İBB Spor

out 2010: 1 1 2010-2011 Spor Toto Süper Lig 9. Hafta: Fenerbahçe-Galatasaray

nov 2010: 1 2 WikiLeaks ABD'nin gizli diplomatik belgelerini yayınladı , 2 2 Julian Assange'e yakalama kararı , 3 2 Talabani: Tarık Aziz'in idam emrini imzalamayacağım

dez 2010: 1 3 2010 Kennedy Merkezi Ödülleri sahiplerini buldu , 2 3 Cancun'daki çevre konferansından beklentiler az , 3 3 ABD'de işsizlik arttı , 4 3 Güney Kore'den Kuzey Kore'ye uyarı , 5 3 Avrupa'da aşırı soğuk hayatı felç ediyor , 6 3 Obama'dan Afganistan'a sürpriz ziyaret , 7 2 16. Birleşmiş Milletler İklim Değişikliği Zirvesi sona erdi , 8 2 Türkiye ile İsrail arasında ilk görüşme , 9 2 Wikileaks olayının yasal boyutları nereye kadar gidebilir? , 10 2 İran ilk yerli uranyum tozunu üretti , 11 2 İsrail'de orman yangını kontrol altına alındı , 12 2 Bebeklerin çevrelerini nasıl gözlemlediği bulundu , 13 2 WikiLeaks'in yayınlayacağı belgelerin arasında Kıbrıs'la ilgili olanların da bulunduğu bildirildi , 14 2 Kuril Adaları'nda 5.3 büyüklüğünde deprem , 15 2 2018 Dünya Kupası Rusya'da, 2022 Dünya Kupası Katar'da düzenlenecek , 16 2 Rusya'da uçak kazası: 2 ölü

jan 2011: 1 3 Turkel Komisyonu İsrail ordusunu suçlu bulmadı , 2 3 Yemen’de hükümet karşıtı gösteriler yapıldı , 3 3 İngiltere: \"Coca Cola’nın Vitaminli Su’yu besleyici değil\" , 4 3 Türk Telekom Arena açılışında Gül ve Erdoğan protesto edildi , 5 2 Erzurum Universiade Kış Oyunları'nın açılış töreni yapıldı , 6 2 Ukrayna ile Türkiye arasında vizeler kaldırıldı , 7 2 Kurtlar Vadisi Filistin filminin Almanya'da gösterilmesine izin verilmedi , 8 2 ABD: \"Mavi Marmara Soruşturmasında öncelik BM'nin\" , 9 2 Tek parmaklı dinozor türü keşfedildi , 10 2 IMF: 2011 büyüme oranı tahmini yüzde 4,75

fev 2011: 1 2 Termik santral neden çöktü? , 2 2 2011 BRIT ödülleri sahiplerini buldu , 3 2 Mısır halkı Başbakanlık Sarayı'na yürüyor , 4 2 TGB'nin Emrah Uslu protestosu , 5 2 TRT, Anadolu Ajansı ile bağlarını kopardı , 6 1 Oscar töreninde annelerin gecesi

mar 2011: 1 4 Trabzonspor genel sekreteri Hasan Yener: Bundan sonra kaybedemeyiz , 2 4 Oya Eczacıbaşı ve Görgün Taner Légion d'honneur nişanına layık görüldü , 3 2 2011 ECHO ödülleri sahiplerini buldu , 4 2 Kıbrıs Cumhuriyeti NATO ile işbirliğini onayladı , 5 1 Kıbrıs Cumhuriyeti'nin kredi notu düştü

abr 2011: 1 3 Erdoğan, 'çılgın proje'yi açıkladı , 2 3 Katy Perry ve Robbie Williams, Japon afetzedelere yardım ediyor , 3 3 Kuzey Kıbrıs Türk Cumhuriyeti'nde yeni kabine açıklandı

mai 2011: 1 1 Gaz bombası emekli öğretmenin hayatına mal oldu

jun 2011: 1 4 Nabucco inşaat süreci anlaşması imzalandı , 2 4 Apple i-bulut teknolojisine geçiyor , 3 3 Markasız sigaralar mı geliyor? , 4 3 New York'ta eşcinsel evliliğe izin çıktı , 5 3 Türkiye'de Anonymous gözaltıları , 6 3 Suriye sınırından 3 bin kişi Türkiye'ye giriş yaptı , 7 3 Anonymous grubu Türk devlet sitelerine saldırmaya başladı , 8 2 Kaddafi için tutuklama kararı çıktı , 9 2 Selahattin Demirtaş: \"Yarın meclise gitmiyoruz\" , 10 2 Türkiye'de tutuklu milletvekilleri tahliye edilmedi, siyasi kriz meydana geldi , 11 1 VH:HOTCAT

jul 2011: 1 5 2011 LYS sonuçları 21 Temmuz'da açıklanıyor , 2 4 Norveç'te iki saldırıda 92 kişi öldü , 3 4 Güney Sudan bağımsızlığına kavuştu , 4 4 Facebook, Skype desteği ile görüntülü konuşma sistemini getirdi , 5 4 Selahattin Demirtaş: \"Yarın meclise gitmiyoruz\" , 6 3 Mardin'deki pusuda 3 Türk askeri yaşamını yitirdi , 7 3 Kaliforniya'daki ekolojik lisede ana tema çevre ve doğa , 8 3 Atlantis Uzay Mekiği son dönüş yolculuğuna başladı , 9 3 Suriye birlikleri Lübnan sınırında bir kasabaya saldırdı, Irak yakınında bir başka kasabayı da kuşattı , 10 3 Ankara, Yalova ve Bursa'da 14 El-Kaide Militanı Yakalandı , 11 3 Kılıçdaroğlu: \"Güvence verilirse yemin ederiz\" , 12 3 Türkiye'de tutuklu milletvekilleri tahliye edilmedi, siyasi kriz meydana geldi , 13 2 Türkiye'de genelkurmay başkanı ve kuvvet komutanları istifa etti , 14 2 Google+’da 'gerçek ad' mecburiyeti , 15 2 Maldiv Adaları'nda ilk Türk oteli tamamlandı , 16 2 Norveç'teki saldırıların zanlısı suçunu itiraf etti , 17 2 Özel Harekatçılar yine iş başında , 18 2 Taksim'de Graffiti Festivali , 19 2 Google+'tan kovulan Anonymous grubu Anon+'ı kuruyor , 20 2 Atlantis Uzay Mekiği son kez dünyaya indi , 21 2 Anonymous şüphelilerine baskın , 22 1 Türkiye'de genelkurmay başkan vekili belli oldu

ago 2011: 1 5 İstanbul 2020 Olimpiyatları'na aday oldu , 2 5 Van Başkale'de terör saldırısı: 3 asker hayatını kaybetti , 3 4 Kaddafi'yi bulana 1,7 milyon dolar ödül verilecek , 4 4 Amerika Birleşik Devletleri'nde 5.9 şiddetinde deprem meydana geldi , 5 4 Suriye'ye karşı ABD-Türkiye iş birliği , 6 4 NASA Jüpiter'e uzay aracı gönderdi , 7 4 Trabzonspor, Benfica karşısında elendi , 8 4 Yeni komutanlar belli oldu , 9 3 Kaddafi'nin ailesinin Cezayir'de olduğu açıklandı , 10 3 Irene Kasırgası ABD'yi vurdu , 11 3 Fenerbahçe küme düşmeyecek , 12 3 Habertürk nereye koşuyor? , 13 3 Irak Parlamentosu'nda Türk Hava Kuvvetleri'nin yaptığı saldırılar kınandı , 14 3 Türk Silahlı Kuvvetleri: \"90-100 kadar PKK üyesi öldürüldü\" , 15 2 Tel Aviv'de bir Filistinli yedi kişiyi bıçakladı , 16 1 Beyoncé bu kez Twitter'da liste başı

set 2011: 1 2 Google+ deneme süreci bitti, artık üyelik kabul ediliyor , 2 2 EuroBasket 2011: Sırbistan 68 - 67 Türkiye , 3 2 Lee Tropik Fırtınası ABD'nin kuzeyine doğru ilerliyor , 4 2 İsrail çatışma olacağına ihtimal vermiyor , 5 2 WikiLeaks belgeleri: Mehmed Uzun ABD'nin Kuzey Irak'a askeri ve Türkiye'ye siyasi müdahalede bulunmasını istedi , 6 2 Yunanistan devlet televizyonunu kapatıyor , 7 1 İsrail'in yeni inşaat kararı uluslararası tepkilere yol açtı

out 2011: 1 5 Van'da 7.2 büyüklüğünde deprem , 2 4 Muammer Kaddafi öldürüldü , 3 4 Çukurca'da saldırı: 24 asker hayatını kaybetti , 4 3 Putin: ''Kaddafi'nin Ölümü İğrenç! '' , 5 3 Azerbaycan BM Güvenlik Konseyi üyeliğine seçildi , 6 3 Samsung Apple için çip üretecek , 7 2 Filistin UNESCO üyeliğine kabul edildi , 8 2 Profesör Mete Sözen: \"Korkarım İstanbul için zamanımız kalmadı” , 9 2 Arjantin'de eski subaya ömür boyu hapis , 10 2 Uruguay'da askerlerin işlediği insan hakları ihlallerine yönelik af kaldırıldı

nov 2011: 1 4 Van'da 5.6 büyüklüğünde deprem , 2 3 Avea ve Eyüp Belediyesi “Akıllı Belediye” projesini başlattı , 3 3 İtalya'nın yeni başbakanı Mario Monti , 4 2 Türkiye: Suriye'ye askeri seçenek masada , 5 2 Nokia Frankfurt borsasından çekiliyor , 6 2 Türkiye'de sigara kaçakçılığında büyük artış , 7 2 New York'ta eylemciler eylem yaptıkları parktan çıkarıldı , 8 1 Türkiye'de bedelli askerlik yasalaştı

dez 2011: 1 3 Türk Hava Kuvvetleri PKK yerine sivilleri bombaladı: 35 ölü , 2 3 Uzman Jandarma Okulu kapatılıyor , 3 3 Ermeni soykırım reddini cezalandıran yasa Fransa meclisinden geçti, Türkiye yaptırım paketini açıkladı , 4 2 Suudi Arabistan ABD'den yeni savaş uçakları alıyor , 5 2 Türkiye: Merkez Bankası kredi kartı faizlerini arttırdı , 6 2 Aydın Menderes vefat etti

jan 2012: 1 6 İngilizce Vikipedi 24 saatliğine karardı! , 2 3 4 ilde elektrik kesintisi tehlikesi , 3 3 Genelkurmay eski Başkanı İlker Başbuğ tutuklandı , 4 2 Birleşmiş Milletler Genel Sekreteri Ban Ki Moon: \"Kıbrıs konusunda gelişme yok\" , 5 2 Ermeni soykırım reddini cezalandıran yasa Fransa Senatosundan geçti , 6 2 \"Ordinaryüs\" son yolculuğuna uğurlandı , 7 2 Rauf Denktaş defnedildi , 8 2 KKTC Rauf Denktaş'ın yasını tutuyor , 9 2 KKTC'nin kurucusu Rauf Denktaş hayatını kaybetti

fev 2012: 1 2 Almanya Cumhurbaşkanı Christian Wulff istifa etti , 2 2 Antarktika’da 15 milyon yıllık gölde yaşam ihtimali , 3 1 Fransa'da soykırım inkar yasası iptal edildi

mar 2012: 1 3 Fransa'da Yahudi okuluna saldırı: 4 ölü , 2 2 Afganistan'da Amerikan askeri katliam yaptı: 16 ölü , 3 1 Sınırda Hareketlilik

abr 2012: 1 3 İstanbul'da bir esnafla röportaj , 2 2 Pakistan Cumhurbaşkanı Serdari Hindistan'da , 3 2 Tuaregler bağımsızlıklarını ilan etti

jun 2012: 1 2 Abdullah Öcalan nerede , 2 2 Soccer Aid 2012 sonrası , 3 1 Muhammed Mursi resmen görevine başladı

jul 2012: 1 1 NASA: \"Hatalıyız!\"

ago 2012: 1 3 Haan-gar Ayakkabı battı , 2 2 Hollanda seçime gidiyor , 3 2 Romney resmen aday , 4 2 Suriye'de iç savaş derinleşiyor , 5 2 Türkiye'de 80 binden fazla mülteci var , 6 2 Dolmabahçe Sarayındaki büyük tehlike , 7 1 Romney, resmen aday

set 2012: 1 2 Katalanlar özgürlük istiyor , 2 2 Çin'de deprem oldu , 3 2 Yemen'de halk sokağa döküldü

out 2012: 1 2 Orta Asya'da nükleer tehdidi , 2 2 Afyon'da patlamada ölen 25 asker \"doğal afet şehidi\" sayıldı , 3 1 ABD ve Kanada'da \"Sandy\" Kasırgası felaketi

nov 2012: 1 1 19 yıllık karısı erkek çıktı !

dez 2012: 1 2 Hama'da ekmek kuyruğuna saldırı yapıldı , 2 1 Ekmek kuyruğunda katliam !

jan 2013: 1 2 ABD Başkanı Obama yemin ederek göreve başladı , 2 2 Akaryakıta zam geldi , 3 1 Türk Ceza İnfaz Kanununda değişiklik Cumhurbaşkanı tarafından onaylandı

fev 2013: 1 2 Ünlü Osmanlı ve Türk tarihçisi Fransız Gilles Veinstein öldü , 2 2 Türkiye'de öldürülen Sarai Sierra'nın cenazesi ülkesine gönderildi , 3 2 ABD'nin Ankara Büyükelçiliği'ne Bombalı Saldırı , 4 2 Hürmüz Boğazı'nda restleşme , 5 1 Almanya Eğitim Bakanı Annette Schavan istifa etti

abr 2013: 1 3 Kuzey Korenin artan gerginliği: Scott Snyder ve Dr Robert Kelly Vikihaber röportajı , 2 1 Facebook

mai 2013: 1 1 Gökhan Töre Beşiktaş yolunda.

jun 2013: 1 2 İran'ın yeni cumhurbaşkanı Hasan Ruhani

jul 2013: 1 2 2013 FIFA 20 Yaş Altı Dünya Kupası Fransa'nın oldu , 2 1 Cambridge Düşesi bir erkek çocuk dünyaya getirdi

ago 2013: 1 1 Türkiye Cumhurbaşkanı Gül ve Başbakan Erdoğan Suriye ile ilgili açıklamalar yaptı

set 2013: 1 2 Suriye'nin başkenti Şam'da bulunan BM heyeti incelemelerini tamamladı , 2 1 Suriye kimyasal silah stoklarının kısmi listesini açıkladı

out 2013: 1 2 Tofaş 2015'te B Sedan sınıfı yerli otomobil üretecek , 2 2 Yaz saati uygulaması bu gece sona eriyor , 3 1 Yaz Saati uygulaması bu gece sona eriyor

jan 2014: 1 1 Bu Bir Hitap Biçimi Değildir

mar 2014: 1 1 Erdoğan ile Demirören arasında geçtiği iddia edilen bir ses kaydı yayınlandı

mai 2014: 1 2 Soma'daki kömür madeninde patlama meydana geldi

jul 2014: 1 1 Uzan grubunun İsviçre'deki banka hesaplarına el konuldu

set 2014: 1 1 2014-2015 Eğitim-Öğretim Yılı başladı

out 2014: 1 1 Nizar El Hatip: Kürtlerle birleşeceğiz

nov 2014: 1 1 Liseli Tuğra, halı sahada öldü

dez 2014: 1 1 Fransa'da ağır kar yağışı 15 bin arabayı mahsur bıraktı

jan 2015: 1 1 WikiLeaks belgeleri: Mehmet Uzun ABD'nin Kuzey Irak'a askeri ve Türkiye'ye siyasi müdahalede bulunmasını istedi

fev 2015: 1 1 Diyanet 4110 kadrolu personel alacak

abr 2015: 1 1 Mursi'ye 20 yıl hapis

mai 2015: 1 1 Nepal'de ölü sayısı artıyor.

jun 2015: 1 2 Süleyman Demirel 90 yaşında hayatını kaybetti

jul 2015: 1 1 Süleyman Demirel 90 yaşında hayatını kaybetti

out 2015: 1 2 Hama'da ekmek kuyruğuna saldırı yapıldı , 2 1 Fethullah Gülen aranan teröristler listesine eklendi

nov 2015: 1 1 Köye düşen göktaşlarını toplayıp satan köylülerden vergi alınacak olması tartışmalara yol açtı

dez 2015: 1 1 İspanya'da genel seçim

fev 2016: 1 2 IŞİD, 15 yaşındaki çocuğun kafasını kesti , 2 2 Cumhurbaşkanı Erdoğan: ''Millet bu kararı versin'' , 3 2 Papa Franciscus'u görmek isteyenler izdihama yol açtı , 4 1 Wikimedia Topluluğu Kullanıcı Grubu Türkiye (WMTR) resmen kuruldu!

mar 2016: 1 2 İstanbul'da ki intihar saldırısında 5 kişi öldü , 2 1 Gökhan Gönül'de dopinge rastlanıldı

abr 2016: 1 2 Fransız mahkemesi: Eşcinsel kuaföre hakaret homofobik değil , 2 2 3 yaşındaki çocuğa tecavüz edildiği iddiası , 3 1 Fransa mahkemesi: Eşcinsel kuaföre hakaret homofobik değil

mai 2016: 1 3 UEFA Fenerbahçeli futbolcuların cezasını açıkladı , 2 3 Gaziantepspor'dan Erdem Şen'e suçlama , 3 3 Beyaz Saray'da silah sesleri duyuldu , 4 2 700 mülteciden haber alınamıyor , 5 2 İstanbul'da rehine krizi , 6 2 54. Ziraat Türkiye Kupası Galatasaray'ın oldu , 7 2 NBA'de ilk finalist Cleveland Cavaliers , 8 2 LGBTİ pankartına dava açıldı , 9 2 Binalı Yıldırım yeni genel başkan olarak seçildi , 10 2 Binalı Yıldırım:\"Yolumuz Erdoğan'ın yoludur'' , 11 2 Binali Yıldırım AKP'nin yeni genel başkanı oldu , 12 1 Fenerbahçe, Galatasaray'ı yenerek finale kaldı

jun 2016: 1 2 Fransa Millî Futbol Takımı 2016 Avrupa Futbol Şampiyonası aday kadrosu belli oldu , 2 2 Caner Erkin Inter'e transfer oldu , 3 2 Suriye ordusu Rakka şehrinin sınırlarına girdi , 4 1 İsrail ile Türkiye anlaşmaya vardı

ago 2016: 1 2 Obama'dan Fethullah Gülen açıklaması , 2 1 Gaziantep'te ölü sayısı 51'e yükseldi

set 2016: 1 1 Obama'dan Fethullah Gülen açıklaması

out 2016: 1 1 29 Ekim KHK ihraç ve iade edilen çalışanlar

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 21 de novembro 2016 01:15

Dump file trwikinews-20161101-stub-meta-history.xml.gz (edits only), size 8.9 Mb as gz -> 107 Mb
Dump processed till Oct 31, 2016, on server stat1002, ready at Fri-11/11/2016-23:10 after 53 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.