Estatísticas da Wikinotícias todas as línguas

Zoom           
 

 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Type of dump from which metrics were extracted is unknown.
See also metrics definitions


For active and very active editors (columns C and D) each editor is counted only once, even if they contributed to several languages.
For a more complete breakdown and some trends see second table Edit activity levels of registered users
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mai 20170% +3% 0%-3%  -21%      +1%
abr 20170% -5% 0%-17%  -17%      +1%
mar 20170% +7% 0%+12%  +67%      0%
fev 20170% 0% 0%-14%  -27%      0%
jan 20170% +5% +1%+9%  +17%      0%
dez 20160% -3% 0%-17%  -74%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mai 20175048119512240 k2910,6 6,6 k      91 k
abr 20175037189213239 k3010,7 8,3 k      90 k
mar 20175019 9713238 k3610,7 10 k      90 k
fev 20175002 9111236 k3210,7 6,0 k      90 k
jan 20174993189114236 k3710,7 8,3 k      89 k
dez 2016497598712234 k3410,7 7,1 k      89 k
nov 20164966199013233 k4110,7 28 k      89 k
out 2016494799613232 k3010,7 7,8 k      88 k
set 201649381310411231 k3210,7 6,8 k      88 k
ago 201649252612116230 k3110,7 11 k      87 k
jul 201648992210617229 k2510,7 7,7 k      87 k
jun 201648772910711228 k2110,7 7,5 k      87 k
mai 201648481910011228 k2110,7 6,7 k      86 k
abr 2016482911749227 k2110,7 5,1 k      86 k
mar 20164818158810226 k2910,7 11 k      86 k
fev 2016480318959225 k2510,7 8,6 k      82 k
jan 2016478513907225 k1710,7 7,2 k      82 k
dez 2015477213828224 k1410,7 5,7 k      81 k
nov 2015475914849224 k1610,7 6,2 k      81 k
out 2015474589611223 k1910,7 5,9 k      81 k
set 2015473711836222 k1910,7 6,6 k      80 k
ago 2015472610736222 k1510,7 7,1 k      80 k
jul 2015471613677221 k1810,7 4,0 k      80 k
jun 20154703198010221 k1610,7 5,3 k      79 k
mai 20154684221008220 k1810,7 6,2 k      79 k
abr 2015466219957220 k1910,7 7,2 k      79 k
mar 201546432111517219 k2710,719759,8 k724 Mb69,9 M170 k113 k626 k495 k79 k
fev 20154622159717218 k3710,719737,5 k720 Mb69,5 M167 k113 k626 k493 k78 k
jan 20154607159612217 k3510,7197118 k716 Mb69,1 M164 k113 k626 k490 k77 k
dez 201445921210415216 k3310,719698,0 k710 Mb68,6 M160 k112 k625 k488 k68 k
nov 2014458010868215 k3410,719656,5 k706 Mb68,2 M159 k112 k625 k485 k68 k
out 201445701810611214 k3210,719637,7 k703 Mb67,7 M158 k112 k624 k483 k68 k
set 20144552169615213 k3510,719618,3 k699 Mb67,3 M157 k112 k624 k481 k67 k
ago 201445361710011212 k1910,719618,2 k696 Mb67,0 M156 k115 k624 k479 k67 k
jul 20144519209810211 k2110,719607,8 k694 Mb66,8 M154 k124 k623 k477 k67 k
jun 20144499179712211 k2510,719599,4 k691 Mb66,5 M150 k124 k623 k476 k66 k
mai 20144482191026210 k2210,719586,5 k688 Mb66,2 M145 k123 k623 k474 k65 k
abr 2014446320987209 k1910,819568,2 k685 Mb65,9 M142 k123 k623 k472 k64 k
mar 201444431812010208 k2710,719528,6 k680 Mb65,6 M139 k122 k622 k470 k63 k
fev 201444251811110208 k2310,719506,6 k677 Mb65,2 M136 k121 k622 k468 k63 k
jan 201444071510512207 k2210,819507,1 k673 Mb64,9 M132 k121 k621 k466 k62 k
dez 20134392201069206 k2210,719476,5 k670 Mb64,6 M129 k120 k621 k463 k62 k
nov 20134372159615205 k2110,819455,6 k666 Mb64,3 M128 k120 k621 k462 k61 k
out 201343572010810205 k2010,819447,4 k664 Mb64,1 M127 k119 k620 k460 k61 k
set 201343372210910204 k1810,819447,6 k661 Mb63,9 M127 k119 k620 k458 k60 k
ago 201343152312115204 k2510,7194214 k658 Mb63,6 M126 k118 k620 k457 k60 k
jul 201342921912919203 k3910,7194211 k655 Mb63,4 M125 k117 k620 k455 k60 k
jun 201342732312017201 k3110,719457,9 k651 Mb63,0 M123 k116 k620 k452 k59 k
mai 201342501712318201 k3610,719479,1 k648 Mb62,7 M121 k115 k619 k450 k59 k
abr 201342333114123199 k3910,8194721 k644 Mb62,3 M118 k113 k619 k447 k58 k
mar 201342022413219198 k4010,7194712 k639 Mb61,9 M116 k111 k619 k443 k50 k
fev 201341782715322197 k4010,7194613 k633 Mb61,4 M112 k109 k618 k440 k49 k
jan 201341512312317196 k3910,7194610 k629 Mb61,0 M110 k108 k618 k437 k48 k
dez 201241282311918194 k4310,7194612 k624 Mb60,6 M107 k107 k618 k434 k48 k
nov 201241051511514193 k4310,8194411 k619 Mb60,1 M104 k106 k617 k431 k47 k
out 201240902111713192 k4110,819469,2 k614 Mb59,7 M103 k105 k617 k428 k46 k
set 201240691913220191 k3410,8194710 k610 Mb59,4 M103 k103 k617 k425 k46 k
ago 201240501511724189 k3610,8194811 k606 Mb59,0 M102 k102 k617 k422 k46 k
jul 201240352013224188 k4310,819509,9 k603 Mb58,7 M101 k101 k616 k420 k46 k
jun 20124015511817187 k3110,8195410,0 k599 Mb58,3 M101 k101 k616 k417 k46 k
mai 201240101712119186 k3310,919569,2 k596 Mb58,0 M100 k100 k616 k415 k45 k
abr 201239933213820185 k3710,919569,2 k593 Mb57,7 M99 k99 k616 k412 k45 k
mar 201239612014625184 k3910,9195511 k589 Mb57,3 M98 k99 k615 k410 k45 k
fev 201239412013027182 k4610,9195512 k585 Mb56,9 M96 k98 k615 k407 k45 k
jan 201239214116027181 k5810,9195417 k580 Mb56,4 M95 k97 k615 k404 k45 k
dez 201138802513830179 k4910,9195752 k574 Mb55,9 M93 k96 k615 k400 k44 k
nov 201138551812519178 k3910,7200821 k568 Mb55,4 M92 k94 k614 k396 k32 k
out 201138373715825176 k4510,7200912 k564 Mb55,0 M91 k93 k614 k394 k31 k
set 201138001613016175 k7310,7201314 k559 Mb54,6 M89 k92 k614 k390 k31 k
ago 201137843614920173 k6510,8202013 k554 Mb54,1 M89 k91 k614 k385 k30 k
jul 201137481713423171 k6710,8202613 k549 Mb53,6 M88 k90 k613 k380 k30 k
jun 201137311214226169 k7110,9203013 k543 Mb53,0 M87 k89 k613 k376 k30 k
mai 201137192816327166 k7611,0203316 k537 Mb52,3 M86 k89 k613 k371 k30 k
abr 201136913216529164 k8211,0203618 k530 Mb51,6 M87 k88 k612 k365 k29 k
mar 201136593621238162 k9011,1203721 k522 Mb50,7 M84 k86 k612 k358 k29 k
fev 201136232617128159 k7811,1203917 k513 Mb49,8 M82 k85 k611 k350 k28 k
jan 201135972816928157 k8511,2204223 k507 Mb49,1 M81 k84 k611 k344 k28 k
dez 201035692816331154 k14911,2204150 k497 Mb48,2 M79 k82 k603 k338 k27 k
nov 201035412916125149 k10011,2203430 k479 Mb46,7 M77 k80 k570 k329 k27 k
out 201035122816020146 k13511,3203255 k468 Mb45,8 M75 k79 k553 k323 k27 k
set 201034842915317142 k11811,2202446 k451 Mb44,4 M74 k77 k519 k315 k26 k
ago 201034554417718138 k11311,2201447 k436 Mb43,2 M73 k77 k486 k309 k26 k
jul 201034113815426135 k11711,1201347 k421 Mb42,0 M72 k76 k453 k303 k25 k
jun 201033733918129131 k13411,1200346 k405 Mb40,7 M71 k75 k420 k296 k25 k
mai 201033343518729127 k12911,0199151 k389 Mb39,4 M70 k73 k388 k289 k24 k
abr 201032993616728123 k13411,0197947 k373 Mb38,0 M69 k72 k355 k281 k24 k
mar 201032632816621119 k13911,0196550 k356 Mb36,6 M67 k71 k323 k274 k24 k
fev 201032353316322115 k13710,9195340 k340 Mb35,3 M66 k70 k290 k266 k23 k
jan 201032023817832111 k13110,9194459 k326 Mb34,1 M65 k69 k264 k259 k23 k
dez 200931642716325107 k13310,8192749 k309 Mb32,7 M64 k67 k231 k251 k23 k
nov 200931373217328103 k13410,8191247 k293 Mb31,3 M63 k66 k198 k244 k23 k
out 20093105301783499 k14510,7189755 k277 Mb30,1 M62 k65 k166 k237 k22 k
set 20093075291782594 k14010,7189545 k261 Mb28,7 M61 k63 k135 k228 k21 k
ago 20093046411822990 k13710,7188353 k246 Mb27,4 M60 k62 k105 k220 k21 k
jul 20093005291672586 k11410,6186653 k229 Mb26,0 M59 k61 k72 k213 k21 k
jun 20092976471992482 k9310,4184443 k215 Mb24,8 M59 k60 k43 k207 k20 k
mai 20092929471622379 k5310,2184613 k207 Mb24,0 M58 k59 k33 k201 k20 k
abr 20092882361712377 k3810,3184213 k202 Mb23,4 M57 k57 k33 k196 k20 k
mar 20092846411652476 k4610,3183616 k198 Mb23,0 M56 k56 k32 k193 k19 k
fev 20092805251731775 k4010,3183312 k194 Mb22,5 M55 k54 k32 k190 k19 k
jan 20092780411802674 k4310,3182912 k191 Mb22,1 M54 k53 k32 k186 k19 k
dez 20082739522012772 k5210,3182413 k187 Mb21,6 M53 k52 k31 k182 k18 k
nov 20082687431992871 k5410,3182813 k183 Mb21,2 M52 k51 k31 k178 k18 k
out 20082644462123369 k6710,4182918 k179 Mb20,7 M51 k50 k30 k174 k18 k
set 20082598412163567 k7610,4182815 k173 Mb20,1 M49 k49 k30 k170 k17 k
ago 20082557542473265 k5610,6183615 k168 Mb19,5 M48 k48 k29 k165 k17 k
jul 20082503572133063 k6110,6184013 k163 Mb18,9 M46 k46 k28 k160 k17 k
jun 20082446642293361 k6510,7184716 k159 Mb18,4 M45 k45 k28 k156 k16 k
mai 20082382402102559 k4810,8184914 k154 Mb17,8 M43 k44 k27 k151 k16 k
abr 20082342291952858 k5210,9184715 k149 Mb17,4 M42 k42 k27 k146 k16 k
mar 20082313422093156 k5510,9184918 k145 Mb16,9 M40 k41 k26 k142 k15 k
fev 20082271552443954 k6810,9184219 k140 Mb16,2 M39 k39 k26 k136 k15 k
jan 20082216612424452 k7811,0183820 k135 Mb15,6 M37 k36 k25 k131 k15 k
dez 20072155452083550 k5111,1184617 k129 Mb15,0 M34 k34 k24 k126 k14 k
nov 20072110502163348 k6111,1184817 k125 Mb14,5 M32 k33 k24 k121 k14 k
out 20072060652363246 k7111,2184519 k120 Mb13,9 M30 k32 k23 k117 k14 k
set 20071995502163244 k6211,3183623 k114 Mb13,2 M28 k31 k23 k112 k13 k
ago 20071945542002842 k4811,3183515 k109 Mb12,7 M26 k30 k22 k108 k13 k
jul 20071891552163141 k5211,3183317 k105 Mb12,2 M25 k29 k21 k104 k12 k
jun 20071836421922339 k5211,4183219 k100 Mb11,7 M24 k28 k20 k100 k12 k
mai 20071794662063337 k4511,4183417 k97 Mb11,2 M23 k27 k20 k96 k11 k
abr 20071728641943236 k3811,3182917 k93 Mb10,8 M22 k27 k19 k92 k11 k
mar 20071664451902935 k3511,2181915 k89 Mb10,4 M21 k26 k19 k89 k10 k
fev 20071619421782634 k3811,1180115 k86 Mb10,0 M20 k25 k18 k86 k10,0 k
jan 20071577552082933 k3411,1179215 k83 Mb9,6 M20 k25 k18 k83 k9,5 k
dez 20061522552082832 k3711,0178515 k79 Mb9,2 M21 k24 k18 k80 k9,1 k
nov 20061467612202931 k5110,9178620 k76 Mb8,9 M21 k23 k17 k77 k8,8 k
out 20061406712302229 k4410,8177715 k72 Mb8,4 M20 k22 k17 k73 k8,4 k
set 20061335602113028 k4910,8177615 k69 Mb8,0 M20 k21 k16 k69 k7,9 k
ago 20061275632093126 k4210,9179917 k65 Mb7,6 M19 k21 k16 k66 k7,5 k
jul 20061212552272825 k4110,8179516 k62 Mb7,2 M18 k19 k15 k63 k7,0 k
jun 20061157502412824 k4210,7179916 k59 Mb6,8 M17 k18 k15 k59 k6,6 k
mai 20061107792513022 k4310,6179215 k55 Mb6,4 M16 k16 k13 k56 k6,3 k
abr 20061028512042521 k3410,6179112 k52 Mb6,0 M15 k15 k13 k53 k5,9 k
mar 2006977762413720 k6010,5178918 k49 Mb5,7 M14 k14 k12 k50 k5,6 k
fev 2006901482002918 k4410,6179915 k45 Mb5,2 M10 k13 k11 k46 k5,1 k
jan 2006853692453317 k6110,5178620 k41 Mb4,8 M9,3 k13 k10 k43 k4,8 k
dez 2005784672024315 k5710,5178618 k36 Mb4,2 M8,5 k11 k9,6 k39 k4,3 k
nov 2005717451723513 k3210,6180412 k32 Mb3,8 M7,4 k9,8 k8,8 k35 k3,8 k
out 2005672621933112 k4710,4179217 k30 Mb3,5 M7,1 k9,2 k8,3 k33 k3,5 k
set 2005610521933711 k4810,3179515 k26 Mb3,0 M4,3 k8,1 k7,9 k29 k3,1 k
ago 200555871218379,1 k4610,4175517 k22 Mb2,5 M3,8 k7,1 k7,3 k25 k2,7 k
jul 200548798238337,7 k4610,0176819 k18 Mb2,2 M3,2 k6,0 k6,7 k21 k2,2 k
jun 200538947145216,3 k349,3178711 k15 Mb1,8 M2,6 k4,6 k6,4 k18 k1,6 k
mai 200534252140215,3 k349,0177610 k12 Mb1,5 M2,1 k4,0 k6,0 k15 k1,3 k
abr 200529062163294,2 k519,0173513 k9,5 Mb1,1 M1,7 k3,2 k5,6 k12 k1,0 k
mar 200522852111162,7 k329,316977,9 k6,0 Mb696 k1,2 k1,7 k5,0 k8,0 k724
fev 200517659113101,7 k2910,116145,7 k3,6 Mb409 k8937694,2 k5,0 k430
jan 2005117367198561313,016924,2 k1,9 Mb218 k5522697583,1 k266
dez 2004816310784291116,218345,7 k1,0 Mb120 k30423831,9 k132
nov 2004181826375216,418021,2 k177 kb21 k11981829938
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users

Articles = namespace 0 only.

Notes on count methodology:
Before user activity is counted, edits per user per month are totalled for all languages. So each user is counted only once.
Before July 2012 WMF used a rough approximation for establishing total editor counts:
Users who contributed to several wikis could be counted twice or more (only for wikis where their monthy activity reached any given threshold)

In each column all editors with at least x edits are included.
For example, an editor with 12 edits in some month would be counted in columns 1,2,5,10.

 
YoY = Year over Year change

MoM/PoM: Unofficial quasi-normalized metrics, meant for quick and rough monthly trend assesment:
* = As a rough 'normalization' currently only first 28 days per month are taken into account
MoM = Month over Month change
PoM = Percentage of Maximum, (= highest value ever in that column)
PoM = Note how a short month can have PoM 100% even when the absolute editor count is less than the all-time maximum for that column

  Users  Trends
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5 YoY100 YoY 5 MoM100 MoM 5 PoM100 PoM
mai 20172471409565311241  -5.0%9.1% 3.4%-8.3% 37.7%26.2%
abr 20172071269258351371  24.3%44.4% -8.4%0.0% 36.4%28.6%
mar 20172481299764401372  10.2%30.0% 4.4%9.1% 39.7%28.6%
fev 2017207111916030114   -4.2%22.2% 9.6%-15.4% 38.1%26.2%
jan 2017240123916842147   1.1%100.0% 1.2%62.5% 34.7%31.0%
dez 2016209117875738126   6.1%50.0% -4.7%- 34.3%19.0%
nov 2016219121905730135   7.1%44.4% -2.3%-7.7% 36.0%28.6%
out 2016225131966839138   0.0%18.2% -12.9%30.0% 36.8%31.0%
set 20162171341046037115   25.3%83.3% -12.2%-33.3% 42.3%23.8%
ago 20162271471219046169   65.8%166.7% 13.9%15.4% 48.1%35.7%
jul 201623013110672401751  58.2%142.9% -1.9%18.2% 42.3%31.0%
jun 201623112610771361151  33.8%10.0% 8.4%0.0% 43.1%26.2%
mai 201623014310066381161  0.0%37.5% 33.8%22.2% 39.7%26.2%
abr 20161939774462996   -22.1%- -13.4%- 29.7%21.4%
mar 201620111788662810711 -23.5%-41.2% -11.8%25.0% 34.3%23.8%
fev 201620211695613394   -2.1%- 10.7%- 38.9%19.0%
jan 2016193115905825751  -6.2%- 10.5%- 35.1%14.3%
dez 201516796825627821  -21.2%- -8.4%- 31.8%16.7%
nov 2015204114846233932  -2.3%- 0.0%- 34.7%21.4%
out 20152071179662331121  -9.4%0.0% 6.4%- 34.7%16.7%
set 2015180109835929642  -13.5%- 13.0%- 32.6%14.3%
ago 201516493736228641  -27.0%- 19.0%- 28.9%14.3%
jul 20151799367493172   -31.6%- -25.6%- 24.3%14.3%
jun 2015189109805930103   -17.5%-16.7% -19.6%42.9% 32.6%23.8%
mai 20152391331006033841  -2.0%- 6.6%- 40.6%16.7%
abr 2015204129956736742  -3.1%- -18.0%- 38.1%14.3%
mar 201526415011576451782  -4.2%70.0% 14.4%-17.6% 46.4%33.3%
fev 20152221199771441751  -12.6%70.0% 7.8%41.7% 40.6%40.5%
jan 20152521269666391282  -8.6%0.0% -9.1%9.1% 37.7%28.6%
abr 20172071269258351371  24.3%44.4% -8.4%0.0% 36.4%28.6%
jan 2017240123916842147   1.1%100.0% 1.2%62.5% 34.7%31.0%
out 2016225131966839138   0.0%18.2% -12.9%30.0% 36.8%31.0%
jul 201623013110672401751  58.2%142.9% -1.9%18.2% 42.3%31.0%
abr 20161939774462996   -22.1%- -13.4%- 29.7%21.4%
jan 2016193115905825751  -6.2%- 10.5%- 35.1%14.3%
out 20152071179662331121  -9.4%0.0% 6.4%- 34.7%16.7%
jul 20151799367493172   -31.6%- -25.6%- 24.3%14.3%
abr 2015204129956736742  -3.1%- -18.0%- 38.1%14.3%
jan 20152521269666391282  -8.6%0.0% -9.1%9.1% 37.7%28.6%
out 201424413410674351151  -1.9%10.0% 5.4%-26.7% 41.0%26.2%
jul 20142281379866411041  -24.0%-47.4% 2.2%-16.7% 39.3%23.8%
abr 2014264148986534742  -30.5%- -19.0%- 39.3%16.7%
jan 201422612410576451251  -14.6%-29.4% 5.3%25.0% 41.8%23.8%
out 20132581431087341103   -7.7%-23.1% -3.8%- 42.3%21.4%
jul 20132881571298957198   -2.3%-20.8% 2.5%0.0% 51.0%40.5%
abr 20133271781411026323101  2.2%15.0% 7.9%35.3% 56.9%54.8%
jan 201327616412387481782  -23.1%-37.0% 0.0%-13.3% 45.2%31.0%
out 201223815111788491361  -25.9%-48.0% -13.4%-35.0% 46.0%31.0%
jul 20122561611329956247   -1.5%4.3% 11.6%40.0% 52.3%50.0%
abr 201227616713810561206   -16.4%-31.0% -4.2%-26.1% 56.9%40.5%
jan 20123692081601157527111  -5.3%-3.6% 21.2%-3.7% 66.9%61.9%
out 2011356198158104662510   -1.2%25.0% 20.5%43.8% 64.0%54.8%
jul 2011289166134996123101  -13.0%-11.5% -5.8%-12.0% 54.8%52.4%
abr 20113592041651237129121  -1.2%3.6% -22.5%-17.1% 66.1%69.0%
jan 2011363209169124762871  -5.1%-12.5% -0.6%-23.3% 65.7%54.8%
out 2010342214160118702011   -10.1%-41.2% 6.8%-5.9% 65.3%38.1%
jul 2010368200154115762610   -7.8%4.0% -16.4%-15.4% 61.9%52.4%
abr 20104312291671267128101  -2.3%21.7% 3.3%23.8% 65.7%61.9%
jan 20104122241781298232131  -1.1%23.1% 12.5%31.8% 71.5%69.0%
out 20094062281781317234142  -16.0%3.0% -1.2%16.0% 70.7%69.0%
jul 2009405225167115702510   -21.6%-16.7% -13.5%-4.2% 66.9%54.8%
abr 2009433222171116582382  -12.3%-17.9% 5.9%-4.5% 67.4%50.0%
jan 2009473247180120692610   -25.6%-40.9% -8.9%-19.2% 73.2%50.0%
out 20084532662121579033111  -10.2%3.1% -4.3%-11.4% 84.1%73.8%
jul 2008460274213141723010   -1.4%-3.2% -11.6%-24.2% 82.8%59.5%
abr 2008415259195131762882  0.5%-12.5% -5.0%-20.0% 79.9%57.1%
jan 20084823032421771164412   16.3%51.7% 14.0%11.8% 95.4%90.5%
out 20074592902361619232152  2.6%45.5% 5.9%6.9% 89.5%73.8%
jul 200745526121615410131111  -4.8%10.7% 23.1%36.4% 87.0%71.4%
abr 2007457259194134773214   -4.9%28.0% 3.3%3.6% 78.7%69.0%
jan 200747027620813278299   -15.1%-12.1% 7.2%22.7% 80.8%64.3%
out 20065183072301549222101  19.2%-29.0% 7.9%-28.6% 91.2%47.6%
jul 20065013022271457328131  -4.6%-15.2% -4.0%0.0% 91.2%59.5%
abr 200643126320414476259   25.2%-13.8% -12.6%-31.2% 81.2%52.4%
jan 20065543152451651053315   245.1%266.7% 21.9%-26.2% 95.4%73.8%
out 2005401251193139803116   -- -2.6%-24.3% 77.0%66.7%
jul 20055303212381639833151  -- 68.1%55.0% 95.0%73.8%
abr 20053312131631097429101  -- 48.1%78.6% 66.9%59.5%
jan 200518710071463191   -- -39.4%- 23.8%19.0%

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 19 de junho 2017 10:24 a partir de cópias do banco de dados SQL de Quarta-feira, 31 de maio 2017

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.