Estatísticas da Wikinotícias todas as línguas

Zoom           
 

 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Type of dump from which metrics were extracted is unknown.
See also metrics definitions


For active and very active editors (columns C and D) each editor is counted only once, even if they contributed to several languages.
For a more complete breakdown and some trends see second table Edit activity levels of registered users
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2016  +1%             
nov 2016  -6%             
out 2016  -8%             
set 2016  -13%             
ago 2016  +12%             
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jan 2017                
dez 2016  9011            
nov 2016  8912            
out 2016  9512            
set 2016  10311            
ago 2016  11916            
jul 2016  10617            
jun 2016  10611            
mai 2016  9711            
abr 2016  739            
mar 2016  8810            
fev 2016  929            
jan 2016604 90726 k36,6 586      3,2 k
dez 2015604382726 k26,6 438      3,2 k
nov 2015601183926 k36,6 603      3,2 k
out 20156001891026 k36,6 532      3,2 k
set 2015599 81625 k56,6 603      3,2 k
ago 2015599172625 k56,6 2,1 k      3,2 k
jul 2015598562725 k46,6 556      3,2 k
jun 20155932781025 k26,6 625      3,2 k
mai 2015591 99725 k46,6 642      3,2 k
abr 2015591394725 k36,6 748      3,1 k
mar 201558821131525 k46,6139990578 Mb6,8 M6,5 k17 k6,8 k63 k3,1 k
fev 20155862951625 k56,613961,0 k77 Mb6,8 M6,5 k17 k6,7 k63 k3,1 k
jan 20155842951224 k36,6139494577 Mb6,7 M6,5 k16 k6,7 k63 k3,1 k
dez 201458231041424 k36,613911,3 k76 Mb6,7 M6,4 k16 k6,7 k63 k3,1 k
nov 2014579185824 k46,613861,3 k76 Mb6,6 M6,4 k16 k6,7 k62 k3,1 k
out 201457831061124 k46,613832,5 k75 Mb6,6 M6,3 k16 k6,7 k62 k3,1 k
set 20145754941524 k56,513801,2 k75 Mb6,5 M6,2 k16 k6,6 k62 k3,0 k
ago 2014571497924 k66,513842,5 k75 Mb6,5 M6,2 k17 k6,6 k61 k3,0 k
jul 2014567596924 k56,513811,6 k74 Mb6,5 M6,2 k23 k6,5 k61 k3,0 k
jun 20145623941023 k56,413801,5 k74 Mb6,4 M6,1 k23 k6,5 k60 k3,0 k
mai 20145592101523 k56,4137858173 Mb6,4 M6,1 k23 k6,4 k60 k3,0 k
abr 2014557595723 k76,413751,2 k73 Mb6,3 M6,1 k23 k6,4 k60 k3,0 k
mar 201455261201023 k66,5136396172 Mb6,2 M6,1 k22 k6,3 k59 k3,0 k
fev 20145462108923 k56,5135974971 Mb6,2 M6,1 k22 k6,2 k59 k3,0 k
jan 201454421041222 k46,513561,1 k70 Mb6,1 M6,0 k22 k6,2 k59 k2,9 k
dez 20135426104922 k46,513531,9 k70 Mb6,1 M6,0 k22 k6,2 k58 k2,9 k
nov 20135363951522 k76,4134897569 Mb6,0 M6,0 k21 k6,1 k58 k2,9 k
out 201353351081022 k56,413461,2 k69 Mb6,0 M6,0 k21 k6,1 k58 k2,9 k
set 201352851071022 k46,5134373768 Mb5,9 M5,9 k21 k6,0 k57 k2,9 k
ago 201352341191522 k56,513361,2 k67 Mb5,9 M5,9 k20 k6,0 k57 k2,9 k
jul 201351951291721 k176,513322,2 k66 Mb5,8 M5,9 k20 k6,0 k57 k2,9 k
jun 201351421201721 k96,513411,8 k65 Mb5,7 M5,9 k19 k6,0 k56 k2,8 k
mai 201351241211821 k106,513361,9 k64 Mb5,6 M5,9 k19 k5,9 k55 k2,8 k
abr 2013508101382320 k116,513313,7 k63 Mb5,5 M5,8 k18 k5,9 k54 k2,7 k
mar 201349841281820 k96,513292,0 k62 Mb5,4 M5,7 k17 k5,8 k54 k2,7 k
fev 2013494111502120 k116,413222,0 k60 Mb5,3 M5,6 k16 k5,8 k53 k2,6 k
jan 201348331211719 k76,513181,7 k59 Mb5,2 M5,6 k16 k5,7 k52 k2,6 k
dez 201248041161819 k86,513151,3 k58 Mb5,1 M5,5 k15 k5,7 k51 k2,6 k
nov 201247651141419 k86,513111,8 k57 Mb5,1 M5,5 k15 k5,7 k51 k2,6 k
out 201247121151318 k86,513071,9 k57 Mb5,0 M5,4 k15 k5,7 k50 k2,5 k
set 201246971302018 k106,513022,6 k56 Mb4,9 M5,4 k15 k5,6 k50 k2,5 k
ago 201246231162118 k106,512991,8 k55 Mb4,8 M5,4 k14 k5,6 k49 k2,5 k
jul 201245961302318 k96,512981,8 k54 Mb4,7 M5,4 k14 k5,6 k48 k2,4 k
jun 2012453 1161617 k76,512981,8 k53 Mb4,7 M5,3 k14 k5,5 k47 k2,4 k
mai 201245341191917 k96,512961,5 k52 Mb4,6 M5,3 k14 k5,5 k47 k2,3 k
abr 201244931381817 k96,512911,2 k51 Mb4,5 M5,2 k14 k5,5 k46 k2,3 k
mar 201244621452416 k76,612841,2 k50 Mb4,4 M5,1 k14 k5,4 k46 k2,3 k
fev 201244421282716 k96,612771,6 k49 Mb4,4 M5,0 k13 k5,4 k45 k2,2 k
jan 201244261562616 k116,612693,1 k48 Mb4,3 M5,0 k13 k5,3 k45 k2,2 k
dez 201143651362915 k76,512641,9 k47 Mb4,2 M5,0 k13 k5,3 k44 k2,1 k
nov 201143121231915 k86,512581,3 k46 Mb4,2 M5,0 k13 k5,2 k43 k2,1 k
out 201142991542415 k96,512552,0 k45 Mb4,1 M5,0 k12 k5,2 k43 k2,0 k
set 201142031271615 k116,512514,0 k44 Mb4,0 M4,9 k12 k5,1 k42 k1,9 k
ago 201141761472014 k76,412462,3 k43 Mb4,0 M4,9 k12 k5,1 k41 k1,9 k
jul 201141141312114 k96,412382,0 k43 Mb3,9 M4,8 k12 k5,0 k41 k1,9 k
jun 201140721392514 k116,412311,6 k42 Mb3,8 M4,8 k11 k4,9 k40 k1,8 k
mai 201140561582613 k116,412252,2 k41 Mb3,7 M4,6 k11 k4,8 k40 k1,8 k
abr 201139961592713 k116,411973,3 k38 Mb3,6 M6,4 k11 k4,7 k39 k1,8 k
mar 201139352093713 k116,411762,6 k37 Mb3,5 M5,5 k11 k4,7 k38 k1,7 k
fev 201138861702712 k96,411511,6 k35 Mb3,3 M4,8 k11 k4,6 k36 k1,7 k
jan 201138281682712 k86,311452,1 k34 Mb3,3 M4,7 k10 k4,5 k36 k1,7 k
dez 201037461633012 k106,311381,9 k33 Mb3,2 M4,6 k9,5 k4,4 k35 k1,6 k
nov 201036881612411 k86,311281,8 k32 Mb3,1 M4,6 k8,7 k4,2 k35 k1,6 k
out 201036021581911 k56,3112495832 Mb3,1 M4,5 k8,4 k4,1 k34 k1,6 k
set 201035861521611 k56,3112183031 Mb3,0 M4,5 k8,3 k4,1 k34 k1,6 k
ago 201035271791811 k76,3111599131 Mb3,0 M4,5 k8,1 k4,0 k34 k1,5 k
jul 201034591522511 k56,4111481630 Mb3,0 M4,4 k8,0 k4,0 k33 k1,5 k
jun 201033621782910 k46,4110991729 Mb2,9 M4,4 k7,6 k3,9 k33 k1,5 k
mai 201033431842710 k76,5110195629 Mb2,8 M4,3 k6,8 k3,8 k32 k1,5 k
abr 201033121652810 k46,5109775528 Mb2,8 M4,3 k6,6 k3,7 k32 k1,5 k
mar 20103298162219,9 k26,5109162027 Mb2,8 M4,2 k6,3 k3,7 k32 k1,5 k
fev 20103214159229,8 k46,5108770027 Mb2,7 M4,2 k6,2 k3,6 k31 k1,5 k
jan 20103176174309,7 k76,510841,4 k27 Mb2,7 M4,1 k6,1 k3,5 k31 k1,5 k
dez 20093114161249,4 k56,5108382026 Mb2,6 M4,1 k5,9 k3,5 k30 k1,4 k
nov 20093075167279,3 k46,5108295925 Mb2,6 M4,1 k5,7 k3,4 k30 k1,4 k
out 20093026175329,1 k66,510801,2 k25 Mb2,6 M4,0 k5,7 k3,4 k30 k1,4 k
set 20092965178238,9 k66,610771,7 k24 Mb2,5 M4,0 k5,4 k3,3 k29 k1,4 k
ago 200929110173278,8 k86,510772,3 k24 Mb2,5 M4,0 k5,3 k3,2 k29 k1,3 k
jul 20092814165248,5 k56,410791,2 k23 Mb2,4 M3,9 k5,3 k3,2 k28 k1,3 k
jun 20092777194238,3 k26,410751,3 k22 Mb2,4 M3,9 k5,3 k3,1 k28 k1,2 k
mai 20092706160238,2 k46,310741,8 k22 Mb2,4 M3,9 k5,1 k3,1 k28 k1,2 k
abr 20092649170208,0 k76,310731,3 k22 Mb2,3 M3,8 k4,7 k3,0 k27 k1,2 k
mar 200925512162247,8 k86,310881,7 k21 Mb2,3 M3,8 k4,5 k2,9 k27 k1,1 k
fev 20092435170157,6 k56,3109479721 Mb2,3 M3,7 k4,3 k2,9 k27 k1,1 k
jan 20092385174227,4 k36,310951,0 k20 Mb2,2 M3,7 k4,2 k2,8 k26 k1,0 k
dez 200823323190257,3 k136,210953,0 k20 Mb2,2 M3,6 k4,2 k2,8 k26 k1,0 k
nov 20082106192276,9 k36,1111466519 Mb2,1 M3,5 k4,1 k2,6 k25 k915
out 20082044209336,8 k96,111101,9 k19 Mb2,1 M3,4 k4,1 k2,6 k25 k901
set 20082005212346,6 k106,111011,3 k18 Mb2,0 M3,3 k4,0 k2,5 k25 k868
ago 20081957239326,2 k116,211041,8 k18 Mb1,9 M3,1 k3,8 k2,2 k24 k845
jul 20081888207295,9 k126,311151,5 k17 Mb1,8 M3,0 k3,6 k2,0 k23 k815
jun 20081809228325,5 k116,511342,2 k16 Mb1,7 M2,8 k3,5 k1,9 k22 k773
mai 20081714208255,2 k46,4112985715 Mb1,6 M2,5 k3,3 k1,8 k20 k754
abr 2008167 191265,0 k36,4113158215 Mb1,5 M2,4 k3,2 k1,7 k19 k743
mar 20081672205304,9 k56,4113494514 Mb1,5 M2,3 k3,1 k1,7 k19 k732
fev 20081659240384,8 k76,511231,1 k14 Mb1,4 M2,2 k2,7 k1,5 k18 k660
jan 20081563237424,5 k66,511161,1 k13 Mb1,4 M2,1 k2,5 k1,4 k17 k645
dez 20071533204354,3 k46,6111090113 Mb1,3 M2,0 k2,5 k1,3 k17 k629
nov 20071504212334,2 k66,6111580112 Mb1,3 M1,8 k2,3 k1,3 k16 k613
out 20071464230324,0 k66,7111083912 Mb1,2 M1,7 k2,2 k1,2 k15 k601
set 20071422211303,8 k56,8111356811 Mb1,2 M1,6 k2,1 k1,2 k15 k590
ago 20071402197283,7 k36,9111573411 Mb1,1 M1,5 k2,1 k1,2 k14 k573
jul 20071382209313,6 k36,9111870511 Mb1,1 M1,4 k2,1 k1,1 k14 k540
jun 20071364191213,5 k56,9111155110 Mb1,0 M1,3 k2,0 k1,1 k13 k537
mai 20071325196333,3 k37,010976479,8 Mb992 k1,2 k2,0 k1,1 k13 k532
abr 20071273186303,2 k67,111017109,5 Mb965 k1,1 k1,9 k1,1 k12 k517
mar 20071246186273,1 k67,210836849,1 Mb924 k9741,9 k1,1 k12 k501
fev 20071182172242,9 k67,310686488,7 Mb876 k9241,8 k1,0 k11 k480
jan 20071166202282,7 k47,610427118,3 Mb825 k8761,6 k96111 k467
dez 20061105194272,6 k47,710441,1 k7,9 Mb787 k7801,6 k94310 k443
nov 20061054216282,5 k57,710561,0 k7,5 Mb748 k7441,5 k8969,5 k410
out 20061016224202,3 k57,910581,1 k7,0 Mb699 k7181,5 k8468,7 k385
set 2006954202282,1 k48,110759356,5 Mb650 k7001,4 k7938,0 k357
ago 2006917207291,9 k48,310861,0 k6,2 Mb608 k6561,3 k7437,3 k334
jul 2006843215271,8 k38,310869505,7 Mb562 k6161,2 k6966,8 k316
jun 2006811231251,7 k58,310911,4 k5,3 Mb529 k5721,1 k6406,3 k292
mai 20068011246301,5 k78,410811,6 k4,9 Mb471 k4109855045,7 k241
abr 2006697197241,3 k68,511241,2 k4,3 Mb413 k3548594125,1 k193
mar 20066221235351,1 k58,611751,5 k4,0 Mb370 k3128153444,6 k139
fev 200641 1932894928,612184943,4 Mb310 k2737292793,9 k88
jan 20064132373389028,612286663,2 Mb291 k2547092613,7 k79
dez 20053871954080738,711957622,9 Mb257 k2327372293,3 k74
nov 20053111683269329,112025022,5 Mb223 k2095572062,9 k71
out 20053021892964259,011811,6 k2,3 Mb202 k1925441942,7 k69
set 20052821913649978,411411,6 k1,7 Mb144 k1384561381,9 k49
ago 20052662133729448,910121,2 k910 kb75 k853664998235
jul 200520162243217548,110241,3 k501 kb41 k282751450425
jun 20054 1422161 2,81326 159 kb12 k7159 1177
mai 20054 1362061 2,813261159 kb12 k7159 1177
abr 200541158296012,8133462158 kb12 k7159 1167
mar 200533110163413,1131710788 kb6,5 k5157 652
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users

Articles = namespace 0 only.

Notes on count methodology:
Before user activity is counted, edits per user per month are totalled for all languages. So each user is counted only once.
Before July 2012 WMF used a rough approximation for establishing total editor counts:
Users who contributed to several wikis could be counted twice or more (only for wikis where their monthy activity reached any given threshold)

In each column all editors with at least x edits are included.
For example, an editor with 12 edits in some month would be counted in columns 1,2,5,10.

 
YoY = Year over Year change

MoM/PoM: Unofficial quasi-normalized metrics, meant for quick and rough monthly trend assesment:
* = As a rough 'normalization' currently only first 28 days per month are taken into account
MoM = Month over Month change
PoM = Percentage of Maximum, (= highest value ever in that column)
PoM = Note how a short month can have PoM 100% even when the absolute editor count is less than the all-time maximum for that column

  Users  Trends
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5 YoY100 YoY 5 MoM100 MoM 5 PoM100 PoM
jan 2017        -- -- --
dez 2016224120905837116   9.8%57.1% 0.0%- 36.2%23.7%
nov 2016221121895629125   7.2%33.3% -2.3%-8.3% 36.2%28.9%
out 2016226132956739127   6.7%20.0% -13.0%20.0% 37.0%31.6%
set 20162161341036036115   27.2%83.3% -12.3%-33.3% 42.6%26.3%
ago 20162271441198945169   65.3%166.7% 12.9%15.4% 48.5%39.5%
jul 201622913110672401751  71.0%142.9% -1.0%18.2% 43.0%34.2%
jun 201623012610670361151  35.9%10.0% 9.7%10.0% 43.4%28.9%
mai 2016229140976637116   -2.0%57.1% 31.0%11.1% 39.6%26.3%
abr 20161929573452996   -22.3%- -13.4%- 30.2%23.7%
mar 2016202113886428106   -22.1%-33.3% -9.9%25.0% 34.9%26.3%
fev 201620011392613094   -3.2%- 9.6%- 38.7%21.1%
jan 2016193114905825751  -5.3%- 9.2%- 35.3%15.8%
dez 201516893825326721  -21.2%- -7.3%- 32.3%15.8%
nov 2015201112836133931  -2.4%- 6.5%- 34.9%23.7%
out 2015206115896232102   -16.0%-9.1% 0.0%- 32.8%18.4%
set 2015180109815927641  -13.8%- 13.2%- 32.8%15.8%
ago 20151669272602864   -25.8%- 23.6%- 28.9%15.8%
jul 20151819262483072   -35.4%- -26.7%- 23.4%15.8%
jun 2015190107785929103   -17.0%0.0% -21.9%42.9% 31.9%26.3%
mai 201523913399603074   -2.0%- 6.7%- 40.9%18.4%
abr 2015205128946635741  -1.1%- -17.4%- 38.3%15.8%
mar 201526514811373441582  -5.8%50.0% 14.7%-18.8% 46.4%34.2%
fev 2015221117956842165   -12.0%77.8% 6.7%33.3% 40.4%42.1%
jan 20152501249566391281  -8.7%0.0% -10.1%9.1% 37.9%31.6%
jan 2017        -- -- --
out 2016226132956739127   6.7%20.0% -13.0%20.0% 37.0%31.6%
jul 201622913110672401751  71.0%142.9% -1.0%18.2% 43.0%34.2%
abr 20161929573452996   -22.3%- -13.4%- 30.2%23.7%
jan 2016193114905825751  -5.3%- 9.2%- 35.3%15.8%
out 2015206115896232102   -16.0%-9.1% 0.0%- 32.8%18.4%
jul 20151819262483072   -35.4%- -26.7%- 23.4%15.8%
abr 2015205128946635741  -1.1%- -17.4%- 38.3%15.8%
jan 20152501249566391281  -8.7%0.0% -10.1%9.1% 37.9%31.6%
out 201424413310673351151  -1.9%10.0% 6.5%-26.7% 41.7%28.9%
jul 2014226133966540941  -25.6%- 1.1%- 39.1%23.7%
abr 2014264144956533742  -31.2%- -21.6%- 38.7%18.4%
jan 201422512310477441241  -14.0%-29.4% 2.1%25.0% 41.7%26.3%
out 20132581371087139103   -6.1%-23.1% -1.9%- 43.0%23.7%
jul 20132861571298854178   -0.8%-26.1% 1.7%-11.8% 51.5%39.5%
abr 2013326174138101632310   0.0%27.8% 8.1%43.8% 56.6%60.5%
jan 201327416212187481781  -22.4%-34.6% 1.9%-13.3% 45.5%34.2%
out 20122361461158648136   -25.3%-45.8% -12.8%-35.0% 46.4%34.2%
jul 20122561571309955237   -0.8%9.5% 10.8%33.3% 52.3%52.6%
abr 201227516613810160186   -13.2%-33.3% -4.2%-34.8% 57.9%39.5%
jan 20123682041561157226111  -7.1%-3.7% 20.0%4.2% 66.4%65.8%
out 201135019615410365249   -2.5%26.3% 18.4%46.7% 63.0%57.9%
jul 201128716113197612110   -13.8%-16.0% -5.1%-12.5% 54.9%55.3%
abr 20113571981591206827101  -3.6%-3.6% -24.4%-25.7% 64.7%68.4%
jan 2011361207168123752771  -3.4%-10.0% -1.3%-17.9% 66.4%60.5%
out 2010337211158116701911   -9.7%-40.6% 6.9%0.0% 66.0%42.1%
jul 201036719815211276258   -7.9%4.2% -15.5%-16.7% 62.6%52.6%
abr 2010425222165126712891  -2.9%40.0% 4.7%23.8% 66.0%68.4%
jan 20104092181741288030131  0.0%36.4% 12.8%18.2% 71.1%68.4%
out 20094032271751277232141  -16.3%-3.0% -2.9%17.4% 70.2%71.1%
jul 2009400221165113642410   -20.3%-17.2% -12.2%-4.3% 67.2%57.9%
abr 2009433218170113562082  -11.0%-23.1% 7.4%-18.2% 68.1%47.4%
jan 200946724017411764229   -26.6%-47.6% -8.3%-20.0% 70.6%52.6%
out 20084462612091508833111  -9.1%3.1% -3.9%-11.8% 84.3%78.9%
jul 2008454267207136692910   -1.0%-6.5% -13.9%-25.0% 81.7%63.2%
abr 2008412254191129752681  2.7%-13.3% -5.1%-24.1% 80.0%57.9%
jan 20084782952371771134212   17.3%50.0% 14.3%5.9% 95.3%94.7%
out 20074562812301579132152  2.7%60.0% 5.1%16.0% 88.5%76.3%
jul 200745225620914910031111  -2.8%14.8% 20.2%50.0% 86.0%78.9%
abr 2007450248186126773014   -5.6%25.0% 1.1%7.7% 76.6%73.7%
jan 200746326420212875289   -14.8%-15.2% 6.9%22.7% 79.6%71.1%
out 2006506295224152882091  18.5%-31.0% 9.9%-33.3% 89.8%47.4%
jul 20064952922151407027121  -4.0%-15.6% -5.1%4.3% 87.2%63.2%
abr 200642825519714074248   24.7%-17.2% -13.0%-29.0% 80.0%57.9%
jan 20065453072371591033313   233.8%371.4% 22.8%-21.1% 94.0%78.9%
out 2005398244189136802916   -- -2.7%-25.0% 77.4%71.1%
jul 20055243092241609232151  -- 62.9%66.7% 91.5%78.9%
abr 200532820915810773299   -- 44.9%78.6% 66.0%65.8%

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 19 de fevereiro 2017 17:07 a partir de cópias do banco de dados SQL de Terça-feira, 31 de janeiro 2017

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.