Estatísticas da Wikinotícias todas as línguas

Zoom           
 

 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Type of dump from which metrics were extracted is unknown.
See also metrics definitions


For active and very active editors (columns C and D) each editor is counted only once, even if they contributed to several languages.
For a more complete breakdown and some trends see second table Edit activity levels of registered users
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2016+1% +26% 0%+28%  +51%      0%
jul 2016+1% -1% 0%+19%  +11%      0%
jun 2016+1% +9% 0%0%  +5%      0%
mai 20160% +32% 0%   +33%      0%
abr 20160% -16% 0%   -56%      0%
mar 20160% -7% 0%   +31%      +4%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 201644483113517215 k3211,1 12 k      85 k
jul 201644172210718214 k2511,1 7,7 k      84 k
jun 201643952610812213 k2111,1 7,0 k      84 k
mai 20164369189912212 k2111,1 6,7 k      84 k
abr 20164351117510212 k 11,1 5,0 k      83 k
mar 20164340138910211 k 11,1 11 k      83 k
fev 20164327189610210 k2511,1 8,6 k      80 k
jan 2016430913928209 k1711,1 7,2 k      79 k
dez 201542969839209 k1311,1 5,4 k      79 k
nov 20154287108410208 k1511,1 5,9 k      78 k
out 2015427779812208 k1911,1 5,9 k      78 k
set 201542709847207 k1911,1 6,5 k      78 k
ago 2015426111747207 k1511,1 6,9 k      77 k
jul 2015425013688206 k1811,1 3,9 k      77 k
jun 20154237188111206 k1611,1 5,1 k      77 k
mai 20154219221019205 k1911,1 6,2 k      77 k
abr 2015419718978204 k1911,1 7,1 k      76 k
mar 201541792011617204 k2711,120139,6 k683 Mb66,6 M158 k106 k623 k471 k76 k
fev 20154159139918203 k3611,120117,1 k679 Mb66,3 M156 k106 k622 k468 k76 k
jan 20154146129713202 k3511,1200918 k675 Mb65,9 M153 k106 k622 k466 k75 k
dez 201441341310516201 k3411,120067,9 k670 Mb65,4 M148 k105 k621 k463 k66 k
nov 2014412110879200 k3511,120036,5 k666 Mb65,0 M147 k105 k621 k461 k65 k
out 201441111810812199 k3211,220017,5 k662 Mb64,5 M146 k105 k621 k459 k65 k
set 20144093149716198 k3411,219987,7 k659 Mb64,1 M145 k105 k620 k457 k65 k
ago 201440791510112197 k1811,219997,7 k656 Mb63,8 M144 k106 k620 k455 k64 k
jul 20144064199911196 k2111,219987,7 k654 Mb63,6 M142 k114 k620 k453 k64 k
jun 20144045159814195 k2411,219979,1 k651 Mb63,3 M138 k113 k619 k451 k63 k
mai 20144030181037195 k2111,219966,4 k648 Mb63,0 M134 k113 k619 k450 k62 k
abr 20144012171008194 k1911,219948,0 k644 Mb62,8 M131 k113 k619 k448 k62 k
mar 201439951712110193 k2611,219898,4 k640 Mb62,4 M127 k112 k619 k446 k61 k
fev 201439781711110193 k2211,219886,3 k637 Mb62,1 M124 k111 k618 k444 k60 k
jan 201439611410512192 k2111,219876,4 k634 Mb61,8 M121 k111 k618 k442 k60 k
dez 20133947201079191 k2011,219846,0 k630 Mb61,5 M118 k110 k617 k440 k59 k
nov 20133927159615191 k1911,219825,2 k627 Mb61,3 M117 k110 k617 k438 k59 k
out 201339121711010190 k1911,219817,2 k625 Mb61,0 M116 k109 k617 k437 k59 k
set 201338952010910189 k1711,219817,4 k623 Mb60,8 M115 k108 k616 k435 k58 k
ago 201338752312215189 k2411,2197914 k620 Mb60,6 M114 k108 k616 k434 k58 k
jul 201338521813019188 k3811,2197911 k617 Mb60,3 M113 k107 k616 k432 k57 k
jun 201338342512017187 k3011,219837,4 k613 Mb59,9 M111 k106 k616 k429 k57 k
mai 201338091412418186 k3511,219858,7 k610 Mb59,7 M110 k105 k616 k427 k56 k
abr 201337952914123185 k3711,2198520 k606 Mb59,3 M107 k103 k616 k424 k56 k
mar 201337662113419184 k3911,2198512 k601 Mb58,9 M104 k101 k615 k421 k47 k
fev 201337452415424183 k3811,2198412 k596 Mb58,5 M101 k100 k615 k418 k47 k
jan 201337212012418181 k3811,2198410 k592 Mb58,1 M98 k98 k615 k415 k46 k
dez 201237012312019180 k4211,2198411 k587 Mb57,6 M95 k97 k614 k412 k45 k
nov 201236781511615179 k4211,2198311 k582 Mb57,2 M93 k97 k614 k409 k45 k
out 201236632011914178 k3811,219858,9 k578 Mb56,8 M92 k96 k614 k406 k44 k
set 201236432013421177 k2911,319869,2 k574 Mb56,5 M91 k93 k613 k403 k44 k
ago 201236231411925176 k3411,3198710 k571 Mb56,1 M91 k92 k613 k401 k44 k
jul 201236091613325174 k4111,319899,4 k568 Mb55,8 M90 k92 k613 k398 k44 k
jun 20123593512118173 k3011,319949,8 k564 Mb55,5 M89 k91 k613 k395 k43 k
mai 201235881512420172 k3111,419968,9 k562 Mb55,2 M89 k91 k613 k393 k43 k
abr 201235732913921171 k3411,419968,9 k559 Mb54,9 M88 k90 k612 k391 k43 k
mar 201235441914927170 k3511,4199510 k555 Mb54,5 M87 k89 k612 k389 k43 k
fev 201235251913328169 k4111,4199511 k551 Mb54,1 M85 k88 k612 k386 k43 k
jan 201235063916329168 k5011,4199516 k547 Mb53,7 M83 k87 k611 k383 k42 k
dez 201134672414031166 k4411,4199851 k542 Mb53,3 M82 k86 k611 k380 k42 k
nov 201134431812720165 k3411,2205317 k537 Mb52,8 M81 k85 k611 k377 k30 k
out 201134253015926164 k4011,2205410 k533 Mb52,5 M80 k84 k611 k374 k30 k
set 201133951513117162 k7111,2205813 k529 Mb52,1 M79 k83 k611 k371 k29 k
ago 201133803615021160 k6211,3206612 k524 Mb51,6 M78 k82 k610 k366 k29 k
jul 201133441513524158 k6511,3207213 k520 Mb51,1 M78 k81 k610 k362 k29 k
jun 201133291314327156 k6911,4207713 k514 Mb50,5 M77 k81 k610 k357 k29 k
mai 201133162416428154 k7211,5208215 k509 Mb49,9 M76 k80 k610 k353 k28 k
abr 201132922816630152 k7611,5208518 k501 Mb49,2 M76 k79 k609 k347 k28 k
mar 201132643221539150 k8311,6208620 k494 Mb48,4 M74 k78 k609 k341 k28 k
fev 201132322417329147 k7411,7208816 k486 Mb47,5 M72 k76 k608 k333 k27 k
jan 201132082317129145 k7511,7209122 k480 Mb46,8 M71 k75 k608 k327 k27 k
dez 201031852316432143 k13811,7209048 k472 Mb46,0 M69 k74 k600 k321 k26 k
nov 201031622416426138 k9011,8208129 k454 Mb44,6 M67 k72 k567 k313 k26 k
out 201031382216221136 k13211,8207954 k444 Mb43,7 M66 k71 k550 k307 k26 k
set 201031162715618132 k11611,7207246 k427 Mb42,4 M65 k69 k516 k299 k25 k
ago 201030894318219128 k11011,7206247 k412 Mb41,2 M64 k69 k484 k293 k25 k
jul 201030463215727125 k11411,6206246 k398 Mb40,0 M63 k68 k451 k287 k24 k
jun 201030143718430121 k12711,6205046 k383 Mb38,8 M62 k67 k418 k281 k24 k
mai 201029772919030117 k12111,6203850 k368 Mb37,4 M61 k65 k385 k274 k23 k
abr 201029483317129114 k12311,5202646 k352 Mb36,1 M59 k65 k352 k267 k23 k
mar 201029152316923110 k12411,5201349 k337 Mb34,9 M58 k64 k321 k261 k23 k
fev 201028922816623106 k12311,4200039 k322 Mb33,6 M57 k63 k287 k254 k23 k
jan 201028643018133103 k12311,4199258 k309 Mb32,5 M56 k62 k262 k247 k22 k
dez 20092834241672699 k12711,3197549 k293 Mb31,2 M55 k60 k229 k240 k22 k
nov 20092810251752995 k12611,3196046 k277 Mb29,9 M54 k59 k196 k233 k22 k
out 20092785281793591 k14111,2194855 k263 Mb28,7 M53 k59 k164 k226 k21 k
set 20092757291802687 k13611,2194745 k247 Mb27,3 M52 k57 k134 k218 k21 k
ago 20092728321833082 k13211,2193653 k232 Mb26,1 M52 k56 k103 k210 k20 k
jul 20092696291702678 k11011,1191853 k216 Mb24,7 M51 k55 k70 k203 k20 k
jun 20092667462002475 k9210,9189743 k202 Mb23,5 M50 k54 k41 k197 k20 k
mai 20092621321612372 k5110,8190112 k195 Mb22,8 M49 k53 k32 k191 k19 k
abr 20092589361712370 k3610,8189812 k190 Mb22,2 M48 k51 k31 k187 k19 k
mar 20092553301652469 k4210,8189215 k186 Mb21,8 M47 k51 k31 k184 k19 k
fev 20092523201731768 k3710,8189011 k182 Mb21,3 M46 k50 k31 k181 k18 k
jan 20092503341812567 k4010,8188611 k179 Mb20,9 M46 k48 k30 k178 k18 k
dez 20082469462022766 k5010,8188213 k176 Mb20,5 M45 k47 k30 k174 k18 k
nov 20082423332002964 k5110,9188813 k172 Mb20,1 M44 k47 k29 k170 k17 k
out 20082390402133463 k6010,9189117 k168 Mb19,6 M42 k46 k29 k166 k17 k
set 20082350362173561 k7511,0188915 k163 Mb19,0 M41 k45 k28 k162 k17 k
ago 20082314462473258 k5411,2189914 k157 Mb18,4 M39 k44 k28 k157 k16 k
jul 20082268522133057 k5811,3190513 k153 Mb17,9 M37 k42 k27 k153 k16 k
jun 20082216522293355 k6011,4191515 k149 Mb17,4 M36 k41 k26 k148 k16 k
mai 20082164312102553 k4611,5191813 k144 Mb16,8 M34 k40 k26 k144 k15 k
abr 20082133281952852 k4811,6191715 k140 Mb16,3 M33 k38 k25 k139 k15 k
mar 20082105382093150 k5111,6191817 k136 Mb15,9 M32 k37 k25 k135 k15 k
fev 20082067522443949 k6211,7191218 k131 Mb15,3 M31 k35 k24 k130 k15 k
jan 20082015502424447 k6511,7190918 k126 Mb14,7 M29 k33 k24 k125 k14 k
dez 20071965372083545 k4611,9191516 k121 Mb14,1 M27 k31 k23 k120 k14 k
nov 20071928382173543 k5611,9191816 k117 Mb13,7 M26 k30 k23 k116 k14 k
out 20071890542363242 k6712,0191519 k113 Mb13,1 M24 k29 k22 k112 k13 k
set 20071836492163240 k6212,2190723 k107 Mb12,4 M22 k28 k21 k107 k13 k
ago 20071787522002838 k4812,1190815 k102 Mb11,9 M20 k27 k20 k103 k12 k
jul 20071735462163136 k5012,2191016 k98 Mb11,4 M19 k26 k20 k99 k12 k
jun 20071689361922335 k5012,3191018 k93 Mb10,9 M18 k25 k19 k95 k11 k
mai 20071653652063333 k4412,3191617 k90 Mb10,5 M17 k25 k19 k91 k11 k
abr 20071588611943232 k3612,3191316 k86 Mb10,0 M15 k24 k18 k88 k10 k
mar 20071527391902931 k3512,2190415 k83 Mb9,6 M14 k24 k18 k85 k10,0 k
fev 20071488371782630 k3712,1188614 k79 Mb9,2 M14 k23 k17 k81 k9,6 k
jan 20071451542082929 k3312,1187814 k76 Mb8,8 M13 k23 k17 k78 k9,1 k
dez 20061397462082828 k3212,0187314 k73 Mb8,5 M15 k22 k16 k75 k8,7 k
nov 20061351572202927 k3811,9187219 k70 Mb8,2 M15 k21 k16 k72 k8,4 k
out 20061294552302225 k3311,8185014 k66 Mb7,7 M14 k20 k15 k69 k8,0 k
set 20061239552113024 k4511,7183714 k63 Mb7,4 M14 k20 k15 k66 k7,6 k
ago 20061184592093223 k4011,7186116 k60 Mb7,0 M13 k19 k15 k63 k7,2 k
jul 20061125542272822 k3911,7185815 k57 Mb6,6 M12 k17 k14 k59 k6,7 k
jun 20061071432412821 k4111,7186416 k54 Mb6,3 M11 k16 k14 k56 k6,3 k
mai 20061028772523019 k4111,6186215 k50 Mb5,9 M10 k14 k12 k53 k5,9 k
abr 2006951522042518 k3211,6186212 k47 Mb5,5 M9,4 k13 k12 k50 k5,6 k
mar 2006899742413717 k4011,5186414 k44 Mb5,2 M8,9 k13 k11 k47 k5,3 k
fev 2006825442002916 k3111,5186014 k41 Mb4,8 M8,2 k12 k10 k44 k4,8 k
jan 2006781632453315 k4811,3184018 k38 Mb4,4 M7,8 k12 k10 k41 k4,6 k
dez 2005718572024313 k4211,2183216 k34 Mb4,0 M7,2 k10 k9,3 k37 k4,1 k
nov 2005661421733512 k3011,0184012 k31 Mb3,6 M6,6 k8,9 k8,6 k34 k3,7 k
out 2005619621943111 k4710,9182716 k28 Mb3,3 M6,4 k8,3 k8,2 k32 k3,4 k
set 200555749193379,7 k4710,8183515 k25 Mb2,9 M3,6 k7,3 k7,8 k28 k3,0 k
ago 200550866218378,3 k4411,0179717 k20 Mb2,4 M3,1 k6,4 k7,2 k24 k2,6 k
jul 200544289238337,0 k4510,6182419 k17 Mb2,0 M2,7 k5,2 k6,6 k20 k2,1 k
jun 200535341145215,6 k329,9186210 k14 Mb1,6 M2,1 k4,0 k6,3 k17 k1,5 k
mai 200531246140214,6 k329,818599,9 k11 Mb1,4 M1,6 k3,4 k5,9 k14 k1,2 k
abr 200526660164293,6 k459,9182912 k8,7 Mb1,0 M1,2 k2,7 k5,5 k11 k985
mar 200520651111162,3 k2910,318087,6 k5,4 Mb638 k7941,5 k4,9 k7,4 k679
fev 200515550113101,3 k2011,617514,8 k3,2 Mb367 k6145934,2 k4,6 k407
jan 2005105297197861113,817633,9 k1,8 Mb210 k4152357483,0 k259
dez 2004766010784291116,218345,7 k1,0 Mb120 k30423831,9 k132
nov 2004161626375216,418021,2 k177 kb21 k11981829938
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users

Articles = namespace 0 only.

Notes on count methodology:
Before user activity is counted, edits per user per month are totalled for all languages. So each user is counted only once.
Before July 2012 WMF used a rough approximation for establishing total editor counts:
Users who contributed to several wikis could be counted twice or more (only for wikis where their monthy activity reached any given threshold)

In each column all editors with at least x edits are included.
For example, an editor with 12 edits in some month would be counted in columns 1,2,5,10.

 
YoY = Year over Year change

MoM/PoM: Unofficial quasi-normalized metrics, meant for quick and rough monthly trend assesment:
* = As a rough 'normalization' currently only first 28 days per month are taken into account
MoM = Month over Month change
PoM = Percentage of Maximum, (= highest value ever in that column)
PoM = Note how a short month can have PoM 100% even when the absolute editor count is less than the all-time maximum for that column

  Users  Trends
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5 YoY100 YoY 5 MoM100 MoM 5 PoM100 PoM
ago 201623915813598501710   82.4%142.9% 26.5%14.3% 53.8%38.1%
jul 201623213310773421861  57.4%125.0% -1.9%16.7% 42.5%33.3%
jun 201623312810873381261  33.3%9.1% 10.6%0.0% 43.3%28.6%
mai 20162281419967401271  -2.0%33.3% 30.6%20.0% 39.2%28.6%
abr 201619398754831107   -22.7%25.0% -13.3%0.0% 30.0%23.8%
mar 201620311889673010811 -23.3%-41.2% -11.7%0.0% 34.6%23.8%
fev 2016202117966334105   -3.0%-44.4% 10.6%42.9% 39.2%23.8%
jan 2016194117926028861  -5.2%- 10.4%- 35.4%16.7%
dez 201516897835629931  -21.0%- -7.2%- 32.1%19.0%
nov 20152051148463351042  -3.4%11.1% -2.4%25.0% 34.6%23.8%
out 20152081189863351221  -9.3%0.0% 7.6%- 35.4%19.0%
set 2015181110846031742  -13.4%- 12.9%- 32.9%16.7%
ago 201516794746330751  -26.7%- 18.6%- 29.2%16.7%
jul 20151849568513283   -31.3%- -25.3%- 24.6%16.7%
jun 2015192111816032114   -17.3%-21.4% -19.4%37.5% 32.9%26.2%
mai 20152411341016135951  -1.9%- 5.4%- 40.8%19.0%
abr 2015207131976837852  -3.0%- -17.0%- 38.8%16.7%
mar 201526815111677471792  -4.1%70.0% 13.1%-16.7% 46.7%35.7%
fev 20152251209972461861  -10.8%80.0% 8.8%38.5% 41.2%42.9%
jan 201525312897674113931 -7.6%8.3% -9.0%8.3% 37.9%31.0%
dez 201424914310574381641  -1.9%77.8% 17.6%50.0% 41.7%28.6%
nov 201419211187603596   -9.4%- -15.8%- 35.4%19.0%
out 201424613410877351261  -1.8%20.0% 7.4%-25.0% 42.1%28.6%
set 2014197120977140167   -11.0%60.0% 0.0%45.5% 39.2%38.1%
ago 201421112810166371241  -17.2%-20.0% -1.1%0.0% 39.2%26.2%
jul 20142291389967431151  -23.8%-42.1% 2.2%-21.4% 39.6%26.2%
jun 20142301389870431491  -18.3%-17.6% -6.1%133.3% 38.8%33.3%
mai 20142531461037134761  -16.9%- 3.1%- 41.2%14.3%
abr 20142671501006635852  -29.1%- -17.9%- 40.0%19.0%
mar 201426815412181431063  -9.7%-47.4% 5.4%- 48.8%21.4%
fev 201425415411178431041  -27.9%-58.3% 11.0%0.0% 46.2%23.8%
jan 201422612410577451251  -15.3%-33.3% 4.2%25.0% 41.7%23.8%
jul 201623213310773421861  57.4%125.0% -1.9%16.7% 42.5%33.3%
abr 201619398754831107   -22.7%25.0% -13.3%0.0% 30.0%23.8%
jan 2016194117926028861  -5.2%- 10.4%- 35.4%16.7%
out 20152081189863351221  -9.3%0.0% 7.6%- 35.4%19.0%
jul 20151849568513283   -31.3%- -25.3%- 24.6%16.7%
abr 2015207131976837852  -3.0%- -17.0%- 38.8%16.7%
jan 201525312897674113931 -7.6%8.3% -9.0%8.3% 37.9%31.0%
out 201424613410877351261  -1.8%20.0% 7.4%-25.0% 42.1%28.6%
jul 20142291389967431151  -23.8%-42.1% 2.2%-21.4% 39.6%26.2%
abr 20142671501006635852  -29.1%- -17.9%- 40.0%19.0%
jan 201422612410577451251  -15.3%-33.3% 4.2%25.0% 41.7%23.8%
out 20132581431107341103   -7.6%-28.6% -3.8%- 42.1%21.4%
jul 20132891581308958198   -2.3%-24.0% 2.5%0.0% 50.8%40.5%
abr 20133301791411026323101  1.4%9.5% 6.2%35.3% 56.7%54.8%
jan 201327716512488501882  -23.9%-37.9% 0.0%-12.5% 45.4%33.3%
out 201224015311990501471  -25.2%-46.2% -13.2%-33.3% 46.7%33.3%
jul 201225716313310058258   -1.5%4.2% 10.4%37.5% 52.9%52.4%
abr 201227716813910763216   -16.3%-30.0% -5.5%-28.0% 57.1%42.9%
jan 20123712111631187829121  -4.7%0.0% 21.6%3.7% 67.9%66.7%
out 2011357199159105682611   -1.9%23.8% 20.3%41.2% 64.2%57.1%
jul 20112901671351006324112  -14.0%-11.1% -5.7%-11.5% 55.0%54.8%
abr 20113632051661247330132  -2.9%3.4% -23.2%-16.7% 66.2%71.4%
jan 2011366211171126772982  -5.5%-12.1% 0.0%-22.6% 66.2%57.1%
out 20103472171621217121121  -9.5%-40.0% 6.8%-5.6% 65.8%40.5%
jul 20103722041571177827111  -7.6%3.8% -16.1%-14.8% 62.9%54.8%
abr 20104342321711297429112  0.0%26.1% 3.2%13.0% 66.7%61.9%
jan 201041522718113285331421 0.0%32.0% 11.5%30.4% 72.5%71.4%
out 200940822917913374351531 -16.0%2.9% -1.7%15.4% 70.8%71.4%
jul 200940722717011772261111 -20.2%-13.3% -12.9%0.0% 67.5%57.1%
abr 2009434223171117592382  -12.3%-17.9% 5.9%-4.5% 67.1%50.0%
jan 2009475247181120692510   -25.2%-43.2% -9.8%-19.2% 72.5%50.0%
out 20084542672131589234111  -9.7%6.2% -4.3%-11.4% 84.2%73.8%
jul 2008462274213141723010   -1.4%-3.2% -11.6%-24.2% 82.5%59.5%
abr 2008416259195131762882  0.5%-12.5% -5.0%-20.0% 79.6%57.1%
jan 20084823032421771164412   16.3%51.7% 14.0%11.8% 95.0%90.5%
out 20074592902361619232152  2.6%45.5% 5.9%6.9% 89.2%73.8%
jul 200745526121615410131111  -4.8%10.7% 23.1%36.4% 86.7%71.4%
abr 2007458259194134773214   -4.9%28.0% 3.3%3.6% 78.3%69.0%
jan 200747027620813278299   -15.1%-12.1% 7.2%22.7% 80.4%64.3%
out 20065183072301549222101  18.6%-29.0% 7.9%-28.6% 90.8%47.6%
jul 20065013022271457328131  -4.6%-15.2% -4.0%0.0% 90.8%59.5%
abr 200643126320414476259   24.4%-13.8% -12.6%-31.2% 80.8%52.4%
jan 20065543152451651053315   245.1%266.7% 21.9%-26.2% 95.0%73.8%
out 2005401252194140813116   -- -2.1%-24.3% 77.1%66.7%
jul 20055303212381639833151  -- 68.1%55.0% 94.6%73.8%
abr 20053322141641107429101  -- 49.1%78.6% 67.1%59.5%
jan 200518710071463191   -- -39.4%- 23.8%19.0%

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 18 de setembro 2016 17:15 a partir de cópias do banco de dados SQL de Quarta-feira, 31 de agosto 2016

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.