Estatísticas da Wikiquote bretão

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2018    +2%        ()  
out 2018    +1%        ()  
set 2018    +1%        ()  
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201819 1 109 13,2 22    ( ) 11
nov 20181911 107 13,3 17    ( ) 11
out 201818 2 107 13,1 18    ( ) 11
set 201818   106 13,1 3    ( ) 11
ago 20181811 105 13,2 6    ( ) 11
jul 201817   105 13,1 3    ( ) 11
jun 201817   105 13,1 3    ( ) 11
mai 201817   105 13,1      ( ) 11
abr 201817   105 13,1      ( ) 11
mar 201817   105 13,1 3    ( ) 11
fev 201817   105 13 1    ( ) 11
jan 201817   105 13 1    ( ) 11
dez 201717   105 13 1    ( ) 11
nov 201717   105 13 3    ( ) 11
out 20171711 105 13 18    ( ) 11
set 201716   105 12,8      ( ) 11
ago 201716   105 12,8      ( ) 11
jul 201716 1 105 12,8 21    ( ) 11
jun 20171611 101 13,1 54    ( ) 11
mai 201715   100 12,7      ( ) 10
abr 201715   100 12,7      ( ) 10
mar 201715   100 12,7 1    ( ) 10
fev 201715   100 12,7      ( ) 10
jan 201715   100 12,7      ( ) 10
dez 201615   100 12,7      ( ) 10
nov 201615   100 12,7      ( ) 10
out 201615   100 12,7      ( ) 10
set 201615   100 12,7      ( ) 10
ago 201615   100 12,7      ( ) 10
jul 201615   100 12,7      ( ) 10
jun 201615   100 12,7      ( ) 10
mai 201615   100 12,7      ( ) 10
abr 201615   100 12,7      ( ) 10
mar 201615   100 12,7      ( ) 10
fev 201615   100 12,7      ( ) 10
jan 201615   100 12,7      ( ) 10
dez 201515   100 12,7      ( ) 10
nov 201515   100 12,7 3    ( ) 10
out 201515   100 12,7      ( ) 10
set 201515   100 12,7      ( ) 10
ago 20151511 100 12,7 13    ( ) 10
jul 201514   100 12,5      ( ) 10
jun 201514   100 12,5      ( ) 10
mai 201514   100 12,5      ( ) 10
abr 201514   100 12,5      ( ) 10
mar 201514   100 12,5      ( ) 10
fev 201514   100 12,5 4    ( ) 10
jan 201514   99 12,6 1    ( ) 10
dez 201414   99 12,6      ( ) 10
nov 201414   99 12,6      ( ) 10
out 201414   99 12,6      ( ) 10
set 201414   99 12,6      ( ) 10
ago 201414   99 12,6      ( ) 10
jul 201414   99 12,6      ( ) 10
jun 201414   99 12,6      ( ) 10
mai 201414   99 12,6      ( ) 10
abr 20141411 99 12,6 57    ( ) 10
mar 201413   99 12      ( ) 10
fev 201413   99 12      ( ) 10
jan 201413   99 12      ( ) 10
dez 201313   99 12      ( ) 10
nov 201313   99 12      ( ) 10
out 201313   99 12      ( ) 10
set 201313 1 99 12 9    ( ) 10
ago 201313 1 99 11,9 6    ( ) 10
jul 201313   99 11,9      ( ) 10
jun 201313 1 99 11,9 21    ( ) 10
mai 201313   99 11,7      ( ) 10
abr 201313   99 11,7 1    ( ) 10
mar 201313   99 11,6      ( ) 10
fev 201313   99 11,6      ( ) 10
jan 201313 1 99 11,6 26    ( ) 10
dez 201213   99 11,4 5    ( ) 10
nov 201213   99 11,3 2    ( ) 10
out 201213   99 11,391914152 kb16 k1081,6 k(15)1810
set 2012131  99 11,291910151 kb16 k1081,6 k(15)1810
ago 201212   99 11,19197151 kb16 k1081,6 k(15)1810
jul 201212   99 1191916151 kb16 k1081,6 k(15)1810
jun 201212   99 10,89194150 kb16 k1081,6 k(15)1810
mai 201212   99 10,89194150 kb16 k1081,6 k(15)1810
abr 201212   99 10,891911150 kb16 k1081,6 k(15)1810
mar 201212   99 10,69211150 kb16 k1091,6 k(15)1810
fev 201212 1 99 10,692112150 kb16 k1091,6 k(15)1810
jan 201212   99 10,59216150 kb16 k1091,6 k(15)1810
dez 201112   99 10,59215150 kb16 k1091,6 k(15)1810
nov 201112   98 10,59213150 kb16 k1091,6 k(15)1810
out 201112 1 98 10,592121150 kb16 k1091,6 k(15)1810
set 201112   98 10,392111149 kb16 k1091,5 k(15)1810
ago 201112   98 10,29212149 kb16 k1091,5 k(15)1810
jul 201112   98 10,192123149 kb16 k1091,5 k(15)1810
jun 201112   98 9,99212148 kb16 k1091,5 k(15)1810
mai 201112   98 9,9921 148 kb16 k1091,5 k(15)1810
abr 201112   98 9,99211148 kb16 k1091,5 k(15)1810
mar 20111211 98 9,992126148 kb16 k1091,5 k(15)1810
fev 201111   98 9,692515147 kb16 k1091,4 k(15)1810
jan 201111   97 9,592512145 kb16 k1091,4 k(15)1810
dez 201011   97 9,49256145 kb16 k1091,4 k(15)1810
nov 20101111 97 9,492530145 kb16 k1091,4 k(15)1810
out 201010   97 9,19475143 kb15 k1091,4 k(16)189
set 201010   97 99477143 kb15 k1091,3 k(16)189
ago 201010   97 8,99478143 kb15 k1091,3 k(16)189
jul 201010   97 8,894712143 kb15 k1091,3 k(16)189
jun 201010   97 8,79476143 kb15 k1091,3 k(16)189
mai 201010   97 8,79473143 kb15 k1091,3 k(16)189
abr 201010   97 8,69479143 kb15 k1091,3 k(16)189
mar 201010   97 8,594712142 kb15 k1091,3 k(16)189
fev 201010   97 8,49477142 kb15 k1091,3 k(16)189
jan 201010   97 8,39475141 kb15 k1091,3 k(16)189
dez 200910   97 8,394714142 kb15 k1091,3 k(16)189
nov 2009101  97 8,19476142 kb15 k1091,3 k(16)189
out 200991  97 8,194774142 kb15 k1091,3 k(16)189
set 20098   97 7,39661133 kb15 k109941(16)189
ago 20098   96 7,4966 133 kb15 k109941(16)189
jul 20098   96 7,49663133 kb15 k109941(16)189
jun 20098   96 7,49665132 kb15 k109934(16)189
mai 20098   96 7,3966 132 kb15 k109921(16)189
abr 20098   96 7,39663132 kb15 k109921(16)189
mar 20098   96 7,39562131 kb15 k109919(16)189
fev 20098   96 7,2956 131 kb15 k109917(16)189
jan 200981  96 7,295611131 kb15 k109917(16)189
dez 20087   96 7,19561129 kb15 k109860(16)189
nov 20087   96 7,19564129 kb15 k109859(16)189
out 20087   94 7,29654129 kb15 k108859(16)189
set 20087   94 7,2953 129 kb14 k108895(16)189
ago 20087   94 7,2953 129 kb14 k108895(16)189
jul 20087   94 7,29531129 kb14 k108895(16)189
jun 20087 1 94 7,29527129 kb14 k108895(16)189
mai 20087   93 7,29611128 kb14 k108896(16)179
abr 20087 1 92 7,29728128 kb14 k107896(16)179
mar 20087   91 7,29537126 kb14 k107896(16)179
fev 20087   88 7,49492121 kb14 k107896(16)179
jan 20087 1 86 7,694943120 kb14 k107896(16)179
dez 2007712 77 7,97086488 kb9,4 k91853(5)119
nov 200762316518,457329964 kb6,8 k78835( )117
out 200742414215,831220019 kb2,6 k1856( )9 
set 2007221 7 6,31091446,3 kb610654(1)4 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  1  3  5  10  5  1  3  5  10  25  100  5  10 
dez 20182111   2    1       
nov 20183211   22           
out 20182221   221  31      
set 201811    22   1       
ago 2018111         1       
jul 201811         1       
jun 20182                  
mai 2018                   
abr 2018           1       
mar 201811                 
fev 20181     1    11      
jan 20181                  
dez 20171     1    11      
nov 201711         22      
out 20172111   1    22      
set 2017           1       
ago 2017           1       
jul 20172111        211     
jun 201711111  1    21111   
mai 2017                   
abr 2017           1       
mar 20171                  
fev 2017           3       
jan 2017                   
out 20182221   221  31      
jul 201811         1       
abr 2018           1       
jan 20181                  
out 20172111   1    22      
jul 20172111        211     
abr 2017           1       
jan 2017                   
out 2016                   
jul 2016                   
abr 2016           1       
jan 2016                   
out 2015                 1 
jul 2015      1    2       
abr 2015          21       
jan 20151     11   11      
out 2014           3       
jul 2014           11111   
abr 201431111       4       
jan 2014      1    21      
out 2013      1    31      
jul 2013           3       
abr 20131          4       
jan 2013211  111    2       
out 2012    2 1    32      
jul 20121   2      31    11
abr 2012    1111   311     
jan 201221         811   1 
out 20114111   1    51      
jul 2011    111    621     
abr 20111          211     
jan 201111  1      3       
out 2010    1      2       
jul 20101   11             
abr 20101   1      31      
jan 20101     2    1111    
out 2009    11     1       
jul 20091          1       
abr 2009      1    311     
jan 2009    11     111     
out 2008      1    222     
jul 2008           1       
abr 2008111         2       
jan 200811111  3    4111    
out 2007744321  3    44221   

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
155100.0%1,256100.0%
32647.3%1,21496.7%
101832.7%1,17093.2%
32814.5%1,01680.9%
10047.3%75560.1%

 

2 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Lagad ZoltecUC3+210316743jun 20, 201755892--
VIGNERONUC55...11--dez 09, 201821----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
BenoniUC1309set 28, 20074111jun 22, 20083843
AnankeBotUC2241out 26, 20093352set 14, 20131933
Bianchi-BihanUC4102set 29, 20074110dez 04, 20112583
GwennUC598out 10, 20074099nov 13, 20074065
SPQRobinUC668nov 25, 20074053nov 26, 20074052
SamoaBotUC755abr 09, 20141726abr 15, 20141720
BenoniBot~brwikiquoteUC840nov 26, 20074052nov 27, 20074051
MerlIwBotUC926jul 27, 20122347jun 14, 20132025
LaaknorBotUC1020jan 23, 20093628dez 19, 20122202
PrieladkozhUC1118out 06, 201885nov 26, 201834
Nova DraconisUC1217out 14, 2017442out 15, 2017441
GwendalUC1315nov 14, 20102968nov 15, 20102967
YiFeiBotUC1414ago 10, 20151238nov 29, 201831
DARIO SEVERIUC1512mar 31, 2018274ago 06, 2018146
FañchUC1611out 19, 20074090out 31, 20074078
VolkovBotUC1711jun 30, 20093470mar 15, 20103212
MjbmrbotUC1810fev 12, 20112878mar 25, 20112837
Idioma-botUC197jan 01, 20122555jan 22, 20132168
FulupUC206out 25, 20074084out 25, 20074084
ArthurBotUC216nov 12, 20093335dez 02, 20093315

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 81 edições foram feitas por usuários anônimos, de um total de 1443 edições ( 5e %)
  


2 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
EleferenBotUC171fev 13, 20103242jan 05, 20132185--
AvicBotUC235jul 10, 20112730set 06, 20112672--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 201812033311 966 75       
nov 201811833311 966 75       
out 201811833311 966 75       
set 201811733211 963 75       
ago 201811633211 963 75       
jul 201811633211 963 75       
jun 201811633211 963 75       
mai 201811633211 963 75       
abr 201811633211 963 75       
mar 201811633211 963 75       
fev 201811633211 963 75       
jan 201811633011 963 75       
dez 201711633011 963 75       
nov 201711632811 963 75       
out 201711632811 963 75       
set 201711632711 963 75       
ago 201711632611 963 75       
jul 201711632611 963 75       
jun 201711232611 961 75       
mai 201711032510 952 75       
abr 201711032510 952 75       
mar 201711032510 952 75       
fev 201711032510 952 75       
jan 201711032310 952 75       
dez 201611032310 952 75       
nov 201611032310 952 75       
out 201611032310 952 75       
set 201611032310 952 75       
ago 201611032210 952 75       
jul 201611032110 952 75       
jun 201611032110 952 75       
mai 201611032110 952 75       
abr 201611032010 952 75       
mar 201611031910 952 75       
fev 201611031910 952 75       
jan 201611031910 952 75       
dez 201511031910 952 75       
nov 201511031610 952 75       
out 201511031510 952 75       
set 201511031510 945 75       
ago 201511031510 945 75       
jul 201511031510 944 75       
jun 201511031410 944 75       
mai 201511031410 944 75       
abr 201511031410 944 75       
mar 201511031310 944 75       
fev 201511031310 944 75       
jan 201510930910 944 75       
dez 201410930710 944 75       
nov 201410930710 944 75       
out 201410930510 944 75       
set 201410930310 944 75       
ago 201410930010 944 75       
jul 201410929710 944 75       
jun 201410929710 944 75       
mai 201410929710 944 75       
abr 201410929610 944 75       
mar 201410929310 944 75       
fev 201410928910 944 75       
jan 201410928610 944 75       
dez 201310928310 944 75       
nov 201310928310 944 75       
out 201310927810 944 75       
set 201310927510 944 75       
ago 201310926110 944 75       
jul 201310925710 944 75       
jun 201310925310 944 75       
mai 201310925110 944 75       
abr 201310925010 944 75       
mar 201310924710 944 75       
fev 201310924110 944 75       
jan 201310923510 944 75       
dez 201210923410 944 75       
nov 201210922810 944 75       
out 201210922710 944 75       
set 201210922310 944 75       
ago 201210922010 944 75      1
jul 201210921610 944 75      2
jun 201210921410 944 75       
mai 201210920610 944 75      1
abr 201210920310 944 75       
mar 201210919710 944 75      1
fev 201210919510 944 75      12
jan 201210918910 944 75      6
dez 201110918410 944 74      4
nov 201110818110 944 74      3
out 201110816910 943 74      21
set 201110816510 943 74      1
ago 201110816210 943 74       
jul 201110816010 943 74       
jun 201110815110 943 74      2
mai 201110814710 943 74       
abr 201110814310 943 74      1
mar 201110813710 943 74      12
fev 201110813710 943 74      6
jan 201110713210 942 73      4
dez 201010712910 942 73      1
nov 201010712710 942 73      15
out 201010612410 842 73       
set 201010612210 842 73       
ago 201010611810 842 73       
jul 201010610510 842 73      1
jun 201010610510 842 73       
mai 20101069710 842 73       
abr 20101069710 842 73      1
mar 20101069210 842 73       
fev 2010106909 842 73       
jan 2010106879 842 73      1
dez 2009106769 842 73       
nov 2009106739 839 73      1
out 2009106719 839 73       
set 2009106708 839 73       
ago 2009105668 839 73       
jul 2009105668 839 73      1
jun 2009105658 839 73       
mai 2009105648 838 73       
abr 2009105638 838 73       
mar 2009105558 838 73      1
fev 2009105538 838 73       
jan 2009105498 838 73       
dez 2008105498 838 73      1
nov 2008105488 838 73       
out 2008103348 838 73       
set 2008103258 838 73       
ago 2008103248 838 73       
jul 2008103248 838 73       
jun 2008103248 838 73      6
mai 2008102208 837 73       
abr 2008101178 837 73      7
mar 2008100168 837 73      2
fev 200897148 837 73      1
jan 200895148 837 73      41
dez 200786128 836 73      63
nov 20077278  32 73      249
out 200741 3  18         
set 20076    12         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2007: 1 3 Degemer , 2 1 Gerioù-stur hervez ar vro

out 2007: 1 3 Calvin hag Hobbes , 2 3 Troioù-kaer Tintin , 3 3 Martin-Luther King, Jr. , 4 3 Degemer , 5 2 Honoré de Balzac , 6 2 Garfield , 7 2 Woody Allen , 8 2 Winston Churchill , 9 2 Salvador Allende

nov 2007: 1 3 Douglas MacArthur , 2 3 Carl von Clausewitz , 3 3 Brezel , 4 3 Bertrand Russell , 5 3 Frankiz , 6 3 Sonerezh , 7 3 Robert Heinlein , 8 3 Relijion , 9 3 Reizh , 10 3 Napoleon Bonaparte , 11 2 Karantez , 12 2 Honoré de Balzac , 13 2 Havelock Ellis , 14 1 François Mitterrand

dez 2007: 1 2 Kurt Vonnegut , 2 2 Aogust , 3 2 Charles de Gaulle , 4 2 Woody Allen , 5 2 Roparz Hemon , 6 2 Mahatma Gandhi , 7 1 Fañch Peru

jan 2008: 1 1 Juvenalis

fev 2008: 1 1 George Santayana

mar 2008: 1 1 Prosper Proux

abr 2008: 1 1 Ar Plac'h hag an naer ganet war un hevelep tro gant ur wreg

jun 2008: 1 1 Jean Guéhenno

dez 2008: 1 1 Aldous Huxley

mar 2009: 1 1 Albert Einstein

jul 2009: 1 1 George Santayana

nov 2009: 1 1 Degemer

jan 2010: 1 1 Degemer

abr 2010: 1 1 Malcolm X

jul 2010: 1 1 Albert Einstein

nov 2010: 1 1 Mussolini

dez 2010: 1 1 François Mitterrand

jan 2011: 1 1 Dante Alighieri

fev 2011: 1 1 Charles de Gaulle

mar 2011: 1 2 Vergilius , 2 1 Mafia

abr 2011: 1 1 Mahatma Gandhi

jun 2011: 1 1 Primo Levi

set 2011: 1 1 Carl von Clausewitz

out 2011: 1 2 Martin Niemöller , 2 1 George Santayana

nov 2011: 1 1 Juvenalis

dez 2011: 1 1 Kazh

jan 2012: 1 1 Kurt Vonnegut

fev 2012: 1 2 Douglas MacArthur , 2 1 Martialis

mar 2012: 1 1 Mahatma Gandhi

mai 2012: 1 1 Primo Levi

jul 2012: 1 1 Vergilius

ago 2012: 1 1 Primo Levi

nov 2012: 1 1 Julius Caesar

dez 2012: 1 2 Marlene Dietrich , 2 1 Demokratelezh

jan 2013: 1 2 Vergilius , 2 1 Benito Mussolini

abr 2013: 1 1 Max Stirner

jun 2013: 1 1 Mafia

ago 2013: 1 1 Arc'hant

set 2013: 1 1 Gwenvred Latimier

abr 2014: 1 1 Mafia

jan 2015: 1 1 Dante Alighieri

fev 2015: 1 1 Lavaroù latin

ago 2015: 1 1 Blaise Pascal

mar 2017: 1 1 Lavaroù latin

jun 2017: 1 1 Martin Luther King

jul 2017: 1 1 Amerika

out 2017: 1 1 Lavaroù latin

nov 2017: 1 1 Juvenalis

dez 2017: 1 1 Horatius

jan 2018: 1 1 Lavaroù latin

fev 2018: 1 1 Prosper Proux

mar 2018: 1 1 Bertrand Russell

jun 2018: 1 1 Prosper Proux

jul 2018: 1 1 Italo Calvino

ago 2018: 1 1 Blaise Pascal

set 2018: 1 1 Fent er sinema

out 2018: 1 2 Fent er sinema , 2 1 Michel Audiard

nov 2018: 1 2 Krennlavarioù ha troioù-lavar brezhonek , 2 1 Relijion

dez 2018: 1 1 Platon

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file brwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 200 kb as gz -> 1.3 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:14 after 4 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.