Estatísticas da Wikiquote galês
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here
 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions

 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201819   440 4,9      ( ) 29
nov 201819   440 4,9      ( ) 29
out 201819   440 4,9      ( ) 29
set 201819   440 4,9      ( ) 29
ago 201819   440 4,9 1    ( ) 29
jul 201819   440 4,9 1    ( ) 29
jun 201819   440 4,9 1    ( ) 29
mai 201819   440 4,9 2    ( ) 29
abr 201819   440 4,9      ( ) 29
mar 201819   440 4,9 2    ( ) 29
fev 201819   440 4,8      ( ) 29
jan 201819   440 4,8      ( ) 29
dez 2017191  440 4,8 4    ( ) 29
nov 201718   439 4,8 1    ( ) 29
out 201718   439 4,8 4    ( ) 29
set 201718   439 4,8 1    ( ) 29
ago 201718   439 4,8 2    ( ) 29
jul 201718   439 4,8 1    ( ) 29
jun 201718   439 4,8      ( ) 29
mai 2017181  439 4,8 4    ( ) 29
abr 201717   439 4,8 3    ( ) 29
mar 201717 1 439 4,8 28    ( ) 29
fev 201717   436 4,8      ( ) 29
jan 201717   436 4,8      ( ) 29
dez 201617   436 4,8 6    ( ) 29
nov 201617   436 4,8      ( ) 29
out 201617   436 4,8      ( ) 29
set 201617   436 4,8      ( ) 29
ago 201617   436 4,8      ( ) 29
jul 201617   436 4,8      ( ) 29
jun 201617   436 4,8      ( ) 29
mai 201617   436 4,8 2    ( ) 29
abr 201617   435 4,8      ( ) 29
mar 201617   435 4,8 1    ( ) 29
fev 201617   435 4,8      ( ) 29
jan 201617   435 4,8      ( ) 29
dez 201517   435 4,8 1    ( ) 29
nov 201517   435 4,8 3    ( ) 29
out 201517   434 4,8 1    ( ) 29
set 201517   434 4,8 2    ( ) 29
ago 2015171  434 4,8 153    ( ) 29
jul 201516   434 4,4      ( ) 29
jun 201516   434 4,4 4    ( ) 29
mai 201516   433 4,4 2    ( ) 29
abr 201516   433 4,4      ( ) 29
mar 201516   433 4,4      ( ) 29
fev 201516   433 4,4 5    ( ) 29
jan 201516   433 4,4 2    ( ) 29
dez 201416   433 4,4      ( ) 29
nov 201416   433 4,4 5    ( ) 29
out 201416   433 4,4      ( ) 29
set 201416   433 4,4      ( ) 29
ago 201416   433 4,4 2    ( ) 29
jul 201416   433 4,4      ( ) 29
jun 20141611 433 4,4 14    ( ) 29
mai 201415   433 4,3 1    ( ) 29
abr 2014151  433 4,3 237    ( ) 29
mar 20141411 433 3,8 21    ( ) 29
fev 201413   433 3,7      ( ) 21
jan 201413   433 3,7 1    ( ) 21
dez 201313   433 3,7      ( ) 21
nov 201313   433 3,7 1    ( ) 21
out 20131311 433 3,7 10    ( ) 21
set 201312 1 429 3,8 25    ( ) 21
ago 201312   429 3,7      ( ) 21
jul 201312   429 3,7      ( ) 21
jun 201312 1 429 3,7 24    ( ) 21
mai 201312   429 3,6 2    ( ) 21
abr 201312   429 3,6 4    ( ) 21
mar 201312   429 3,6 1    ( ) 21
fev 201312   428 3,6      ( ) 21
jan 201312 1 428 3,6 30    ( ) 21
dez 201212   428 3,6 2    ( ) 21
nov 201212   428 3,6 1    ( ) 21
out 201212   428 3,6 20    ( ) 21
set 201212 1 426 3,5 25    ( ) 21
ago 201212   419 3,5 19    ( ) 20
jul 201212   418 3,5 6    ( ) 20
jun 201212   418 3,5 8    ( ) 20
mai 201212   418 3,5 10    ( ) 20
abr 201212   418 3,4 16    ( ) 20
mar 201212   418 3,4 3    ( ) 20
fev 20121211 418 3,4 35    ( ) 20
jan 20121112 418 3,3 25    ( ) 20
dez 201110   418 3,2 5    ( ) 20
nov 201110   418 3,2 3    ( ) 20
out 201110 1 416 3,2 45    ( ) 20
set 201110   416 3,1 37    ( ) 20
ago 201110   416 3 11    ( ) 20
jul 201110   416 3 6    ( ) 20
jun 201110 1 416 3 15    ( ) 20
mai 2011101  415 3 12    ( ) 20
abr 20119   411 3 3    ( ) 20
mar 2011911 411 3 111    ( ) 20
fev 2011811 410 2,7 12    ( ) 20
jan 20117   409 2,7 18    ( ) 20
dez 20107   409 2,6 10    ( ) 20
nov 20107   409 2,6 173    ( ) 20
out 2010714 409 2,2 41    ( ) 20
set 20106   396 2,2 13    ( ) 19
ago 20106   396 2,1 6    ( ) 19
jul 20106   396 2,1 13    ( ) 19
jun 20106   396 2,1 4    ( ) 19
mai 20106   396 2,1 5    ( ) 19
abr 20106   395 2,1 40    ( ) 19
mar 20106 1 39412 107    ( ) 19
fev 2010611 36531,8 133    ( ) 19
jan 20105 1 28721,9 177    ( ) 18
dez 200951  215 1,7 14    ( ) 4
nov 2009423121271,6 316    ( ) 4
out 20092   7 3,6 2    ( ) 2
set 20092   7 3,3 3    ( ) 2
ago 20092   6 3,3      ( ) 2
jul 20092   6 3,3 1    ( ) 2
jun 20092   6 3,2      ( ) 2
mai 20092   6 3,2      ( ) 2
abr 20092   6 3,2      ( ) 2
mar 20092   6 3,2      ( ) 2
fev 20092   6 3,2      ( ) 2
jan 20092   6 3,2      ( ) 2
dez 20082   6 3,2 4    ( ) 2
nov 20082   4 3,8      ( ) 1
out 20082   4 3,8      ( ) 1
set 20082   4 3,8      ( ) 1
ago 20082   4 3,8      ( ) 1
jul 20082   4 3,8 1    ( ) 1
jun 20082   4 3,5      ( ) 1
mai 20082   4 3,5      ( ) 1
abr 20082   4 3,5      ( ) 1
mar 20082   4 3,5      ( ) 1
fev 20082   4 3,5      ( ) 1
jan 20082   4 3,5      ( ) 1
dez 20072   4 3,5      ( ) 1
nov 20072   4 3,5      ( ) 1
out 20072   4 3,5      ( ) 1
set 20072   4 3,5 1    ( ) 1
ago 200721  4 3,2 4    ( ) 1
jul 20071   2 4,5      ( ) 1
jun 20071   2 4,5      ( ) 1
mai 20071   2 4,5 1    ( ) 1
abr 20071   2 4      ( ) 1
mar 20071   2 4 1    ( ) 1
fev 20071   2 3,5      ( ) 1
jan 20071 1 2 3,5 6    ( ) 1
dez 20061   1 1      ( )  
nov 20061   1 1      ( )  
out 20061   1 1      ( )  
set 20061   1 1      ( )  
ago 20061   1 1      ( )  
jul 200611  1 1 1    ( )  
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  100  1  3  5  5  10  1  3  5  10  25  100  5  10 
dez 2018                    
nov 2018                    
out 2018            2       
set 2018            1       
ago 20181                   
jul 20181           2       
jun 2018                    
mai 2018                    
abr 2018            1       
mar 20181           1       
fev 2018       1            
jan 2018                    
dez 201711     1    22      
nov 20171                   
out 20171                   
set 2017            1       
ago 20171                   
jul 20171                   
jun 2017            1       
mai 201711          1     1 
abr 20172           211     
mar 2017111          31      
fev 2017            2       
jan 2017                    
out 2018            2       
jul 20181           2       
abr 2018            1       
jan 2018                    
out 20171                   
jul 20171                   
abr 20172           211     
jan 2017                    
out 2016                    
jul 2016                    
abr 2016            1       
jan 2016            1       
out 2015       1    1     1 
jul 2015       1    1       
abr 2015          2 3       
jan 20151      11   21      
out 2014            3       
jul 2014                    
abr 20143   111     5111  11
jan 20141      1    421     
out 20131111    421  73221   
jul 2013            6       
abr 201311          61      
jan 20131111 11 1    41    11
out 201211  11 1    42      
jul 2012    1       511     
abr 20123   11 11   311     
jan 20123221         921     
out 201131111        5111    
jul 20112           61      
abr 20112           311     
jan 201121  11      5       
out 20105441    21   31      
jul 20103   11              
abr 2010    22      31      
jan 201021111   2    222211  
out 2009            2       
jul 2009            5       
abr 2009       1    311     
jan 2009            111     
out 2008       1    222     
jul 20081           2       
abr 2008            1       
jan 2008       1    2       
out 2007       2    1       
jul 2007                    
abr 2007                    
jan 2007111          1111    
out 2006                    
jul 20061      1            

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
159100.0%1,596100.0%
32237.3%1,54796.9%
101830.5%1,51895.1%
32610.2%1,32583.0%
10046.8%1,21075.8%
31623.4%82051.4%

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions		posiçãototaldatadias
atrás		datadias
atrás
AnankeBotUC1501out 27, 20093351set 14, 20131933
Rhodri77UC2319nov 14, 20093333mai 10, 20103156
DexbotUC3235abr 11, 20141724ago 18, 20141595
YiFeiBotUC4155ago 08, 20151240out 02, 2017454
VolkovBotUC558nov 17, 20093330abr 15, 20103181
OergellUC657out 13, 20103000dez 06, 2016754
LaaknorBotUC728set 16, 20103027fev 02, 20122523
PwyllUC827out 17, 20102996jun 08, 20141666
TigershrikeUC925jan 24, 20074358fev 14, 20103241
John F. LewisUC1020out 09, 20131908abr 08, 20141727
CarsracBotUC1117jan 21, 20122535mai 10, 20132060
Llywelyn2000UC1213mai 22, 20112779jul 15, 2018168
Idioma-botUC1313jan 01, 20122555abr 03, 20122462
Adda'r YwUC1410nov 18, 20093329ago 02, 20112707
AlessiaUC1510fev 18, 20112872fev 17, 20122508
タチコマ robotUC1610mar 28, 20141738mar 28, 20141738
BallnitikonUC1710jun 05, 20141669jun 05, 20141669
AlwynapHuwUC1810fev 28, 20151401dez 02, 2017393
LexusunsUC199nov 27, 20112590abr 03, 20122462
CommonsDelinkerUC207mar 22, 20074301abr 04, 2017635

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 391 edições foram feitas por usuários anônimos, de um total de 2140 edições ( 18e %)
  

2 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions		datadias
atrás		datadias
atrás
EleferenBotUC1110fev 13, 20103242jan 13, 20132177--
AvicBotUC243ago 29, 20112680set 07, 20112671--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 2018469342160 1684198       
nov 2018469342160 1684198       
out 2018469342160 1684198       
set 2018469341160 1684198       
ago 2018469340160 1684198       
jul 2018469340160 1684198       
jun 2018469340160 1684197       
mai 2018469340160 1684197       
abr 2018469340160 1684197       
mar 2018469340160 1684197       
fev 2018469340160 1684197       
jan 2018469340160 1684197       
dez 2017469340160 1684197       
nov 2017468337160 1684197       
out 2017468337160 1684197       
set 2017468337160 1684197       
ago 2017468336160 1684197       
jul 2017468336160 1684197       
jun 2017468336160 1684197       
mai 2017468336160 1684197       
abr 2017468336160 1684197       
mar 2017468336160 1684197       
fev 2017465336160 1684193       
jan 2017465334160 1684193       
dez 2016465334160 1684193       
nov 2016465334160 1684193       
out 2016465334160 1684193       
set 2016465334160 1684193       
ago 2016465333160 1684193       
jul 2016465332160 1684193       
jun 2016465332160 1684193       
mai 2016465332160 1684193       
abr 2016464331160 1684193       
mar 2016464330160 1684193       
fev 2016464329160 1684193       
jan 2016464329160 1684193       
dez 2015464329160 1684193       
nov 2015464325160 1684193       
out 2015463324160 1684193       
set 2015463324160 1614193       
ago 2015463324160 1614193       
jul 2015463324160 1604193       
jun 2015463323160 1604193       
mai 2015462323160 1604193       
abr 2015462323160 1604193       
mar 2015462322160 1604193       
fev 2015462322160 1604193       
jan 2015462318160 1604193       
dez 2014462315160 1604193       
nov 2014462315160 1604193       
out 2014462312160 1604193       
set 2014462310160 1604193       
ago 2014462307160 1604193       
jul 2014462304160 1604193       
jun 2014462304160 1604193       
mai 2014462304160 1604193       
abr 2014462304160 1604193       
mar 2014462301160 1604193       
fev 2014454299160 1604191       
jan 2014454297160 1604190       
dez 2013454294160 1604190       
nov 2013454294160 1604190       
out 2013454291160 1604190       
set 2013450288159 1584190       
ago 2013450274159 1584190       
jul 2013450270159 1584190       
jun 2013450265159 1584190       
mai 2013450263159 1584190       
abr 2013450261159 1584190       
mar 2013450257159 1584190       
fev 2013449252159 1584190       
jan 2013449245159 1584190       
dez 2012449243159 1584190       
nov 2012449239159 1584190       
out 2012449239159 1584190       
set 2012447235159 1584190       
ago 2012439232159 1584190       
jul 2012438228159 1584190       
jun 2012438225159 1584190       
mai 2012438217159 1584190       
abr 2012438214159 1584190       
mar 2012438209159 1584190       
fev 2012438207159 1584190       
jan 2012438198159 1584190       
dez 2011438193158 1584189       
nov 2011438190158 1584189       
out 2011436178158 1574189       
set 2011436174158 1574189       
ago 2011436172158 1574189       
jul 2011436171158 1574189       
jun 2011436162158 1574189       
mai 2011435158158 1574188       
abr 2011431153158 1564188       
mar 2011431148158 1564188       
fev 2011430147158 1564188       
jan 2011429142158 1564188       
dez 2010429139158 1564188       
nov 2010429137158 1564188       
out 2010429135158  564188       
set 2010415132156  564188       
ago 2010415127156  564188       
jul 2010415112156  564188       
jun 2010415112156  564188       
mai 2010415104155  564188       
abr 2010414104154  564188       
mar 2010413100153  564188       
fev 201038496124  544188       
jan 20103059387  532162       
dez 20092197824  421101       
nov 20092167524  411100       
out 20099723  9 6       
set 20099703  9 6       
ago 20098663  8 6       
jul 20098663  8 6       
jun 20098633  8 6       
mai 20098623  7 6       
abr 20098613  7 6       
mar 20098533  7 6       
fev 20098513  7 5       
jan 20098473  7 5       
dez 20088473  7 5       
nov 20085463  7 5       
out 20085333  7 5       
set 20085233  7 5       
ago 20085233  7 5       
jul 20085223  7 5       
jun 20085213  7 5       
mai 20085173  7 5       
abr 20085143  7 5       
mar 20085133  7 4       
fev 20085113  7 4       
jan 20085113  7 4       
dez 20075103  7 4       
nov 2007583  7 4       
out 2007583  7 4       
set 2007573  7 4       
ago 2007562  7 3       
jul 2007352  7 1       
jun 2007352  7 1       
mai 2007352  7 1       
abr 2007352  6 1       
mar 2007352  6 1       
fev 2007342  6 1       
jan 2007342  6 1       
dez 2006131  1         
nov 2006121  1         
out 2006121  1         
set 2006121  1         
ago 2006121  1         
jul 2006121  1         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons
 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2006: 1 1 Hafan

jan 2007: 1 1 Gwynfor Evans

mar 2007: 1 1 Hafan

mai 2007: 1 1 Hafan

ago 2007: 1 1 Simonides

set 2007: 1 1 Simonides

jul 2008: 1 1 Simonides

dez 2008: 1 1 Dafydd ap Gwilym

set 2009: 1 1 Matholwch

nov 2009: 1 3 Hafan , 2 2 Geiriau olaf , 3 2 Woody Allen , 4 2 Cyfoeth , 5 2 Diarhebion Cymraeg , 6 1 Dudley Field Malone

dez 2009: 1 2 Robert Capa , 2 1 Peter Beard

jan 2010: 1 2 Hafan , 2 1 14 Chwefror

fev 2010: 1 1 11 Mawrth

mar 2010: 1 1 8 Ebrill

mai 2010: 1 1 Llwyth (drama)

jun 2010: 1 1 Sigmund Freud

jul 2010: 1 1 Gordon Brown

set 2010: 1 1 Albert Camus

out 2010: 1 2 Pen Talar , 2 2 Guido Westerwelle

nov 2010: 1 1 Lewis Valentine

dez 2010: 1 2 Abraham Lincoln , 2 1 1872

jan 2011: 1 1 Victor Hugo

fev 2011: 1 2 Gwleidyddiaeth , 2 1 Gwilym Deudraeth

mar 2011: 1 1 Dewi Sant

abr 2011: 1 1 Iaith

mai 2011: 1 2 Geraint Jarman , 2 1 Dylan Iorwerth

jun 2011: 1 1 Owen Morgan Edwards

jul 2011: 1 1 Celf

ago 2011: 1 1 Rhodri Morgan

out 2011: 1 2 Rainer Maria Rilke , 2 1 Owain Owain

nov 2011: 1 1 T. S. Eliot

dez 2011: 1 1 Cyfeillgarwch

jan 2012: 1 2 1957 , 2 1 Rainer Maria Rilke

fev 2012: 1 2 Rhestr ffilmiau , 2 1 John F. Kennedy

mar 2012: 1 1 Victor Hugo

abr 2012: 1 2 Umberto Eco , 2 1 Angela Merkel

mai 2012: 1 1 Horace Walpole

ago 2012: 1 1 Thomas Herbert Parry-Williams

set 2012: 1 1 Ronald Stuart Thomas

out 2012: 1 1 Dizzee Rascal

dez 2012: 1 1 Addysg

jan 2013: 1 1 Victor Hugo

mar 2013: 1 1 Hugo Chávez

abr 2013: 1 1 Umberto Eco

mai 2013: 1 1 Hugo Chávez

jun 2013: 1 1 Hugo Chávez

set 2013: 1 1 Hugo Chávez

out 2013: 1 1 Eric Blom

nov 2013: 1 1 Gandhi

jan 2014: 1 1 Angela Merkel

mar 2014: 1 1 Wiciquote:Y Ddesg Gyfeirio

abr 2014: 1 1 Rhyfel

mai 2014: 1 1 Diarhebion Cymraeg

jun 2014: 1 2 Bryan Martin Davies

ago 2014: 1 1 Simone de Beauvoir

nov 2014: 1 1 Virginia Woolf

jan 2015: 1 1 Diarhebion Cymraeg

fev 2015: 1 1 Hedd Wyn (bardd)

mai 2015: 1 1 Simone de Beauvoir

jun 2015: 1 1 Raymond Williams

set 2015: 1 1 Barry Perowne

nov 2015: 1 1 Siôn Cent

dez 2015: 1 1 Gwyneth Lewis

mar 2016: 1 1 Sigmund Freud

mai 2016: 1 1 Gweddi'r Orsedd

dez 2016: 1 1 Owain Owain

mar 2017: 1 1 Meddwl

abr 2017: 1 1 John Ruskin

mai 2017: 1 1 Siwan (drama)

jul 2017: 1 1 Diarhebion Cymraeg

ago 2017: 1 1 John Evans

out 2017: 1 1 Diarhebion Cymraeg

nov 2017: 1 1 René Descartes

dez 2017: 1 1 Gweddi'r Arglwydd

mar 2018: 1 1 Isaac Bashevis Singer

jul 2018: 1 1 Ieuan Wyn Jones

ago 2018: 1 1 Dewi Sant

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file cywikiquote-20190101-stub-meta-history.xml.gz (edits only), size 298 kb as gz -> 2.1 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:14 after 5 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.