Estatísticas da Wikiquote dinamarquês
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here
 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions

 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
nov 2018+2%   0%        () +3%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201851 1 403 19,4 12    ( ) 62
nov 20185112 403 19,4 25    ( ) 62
out 201850   403 19,3 12    ( ) 60
set 201850   403 19,3 2    ( ) 60
ago 201850   402 19,4 9    ( ) 60
jul 201850   400 19,4 4    ( ) 60
jun 201850   400 19,4 11    ( ) 60
mai 201850   399 19,4 3    ( ) 60
abr 201850   399 19,4 9    ( ) 60
mar 201850   399 19,4 10    ( ) 60
fev 2018501  399 19,4 7    ( ) 60
jan 201849 1 399 19,4 9    ( ) 60
dez 201749   399 19,3 8    ( ) 60
nov 201749   397 19,4 2    ( ) 60
out 201749   397 19,4 5    ( ) 60
set 201749   397 19,4 21    ( ) 60
ago 201749   397 19,4 4    ( ) 59
jul 201749 1 397 19,3 15    ( ) 59
jun 201749 2 396 19,4 23    ( ) 59
mai 20174912 391 19,5 35    ( ) 59
abr 201748 3 388 19,6 27    ( ) 59
mar 201748   385 19,7 5    ( ) 58
fev 201748   384 19,7 7    ( ) 58
jan 201748   384 19,7 8    ( ) 58
dez 201648 1 384 19,7 15    ( ) 58
nov 201648 1 384 19,6 18    ( ) 58
out 201648 2 382 19,7 19    ( ) 58
set 201648   377 19,9 7    ( ) 57
ago 201648   376 19,9 6    ( ) 57
jul 201648   375 20 14    ( ) 57
jun 201648 1 374 20 11    ( ) 57
mai 201648   373 20 5    ( ) 57
abr 201648 1 373 20 17    ( ) 57
mar 201648 1 372 20 30    ( ) 57
fev 20164811 371 20 26    ( ) 57
jan 201647 3 370 20 50    ( ) 57
dez 201547   367 20 8    ( ) 53
nov 201547   367 20 4    ( ) 53
out 201547   367 20 6    ( ) 53
set 201547 1 367 20 7    ( ) 53
ago 201547   366 20 12    ( ) 53
jul 201547 1 366 20 30    ( ) 53
jun 201547 2 362 20,1 28    ( ) 52
mai 201547 1 360 20,1 16    ( ) 50
abr 201547 2 358 20,2 41    ( ) 50
mar 201547 3 357 20,1 111    ( ) 50
fev 201547 4 350 20,2 198    ( ) 50
jan 20154713 345 19,9 158    ( ) 48
dez 201446 1 340 19,8 22    ( ) 48
nov 201446   335 20 1    ( ) 48
out 201446 1 335 20 10    ( ) 48
set 201446   333 20,1 14    ( ) 48
ago 20144612 333 20 19    ( ) 48
jul 201445 2 333 20 36    ( ) 47
jun 201445 1 333 19,9 82    ( ) 47
mai 201445 1 332 19,7 71    ( ) 47
abr 20144535 332 19,5 240    ( ) 47
mar 201442   332 18,8 9    ( ) 46
fev 201442 1 332 18,7 11    ( ) 46
jan 201442 1 330 18,8 52    ( ) 46
dez 201342   329 18,7 9    ( ) 46
nov 201342 2 329 18,7 50    ( ) 46
out 20134212 321 19 38    ( ) 46
set 201341 2 321 18,9 38    ( ) 46
ago 20134112 321 18,8 53    ( ) 46
jul 20134013 321 18,6 52    ( ) 46
jun 201339 2 320 18,5 67    ( ) 46
mai 201339 2 319 18,3 111    ( ) 46
abr 20133911 311 18,5 19    ( ) 45
mar 201338   311 18,4 10    ( ) 45
fev 201338 1 310 18,4 14    ( ) 45
jan 201338 3 310 18,4 164    ( ) 45
dez 201238 2 308 18 110    ( ) 45
nov 201238 3 307 17,7 177    ( ) 45
out 20123812 305 17,2 86    ( ) 40
set 201237 1 305 16,9 95    ( ) 40
ago 20123712 305 16,6 100    ( ) 40
jul 201236111304 16,3 161    ( ) 40
jun 201235 1 301 16 77    ( ) 40
mai 201235 1 301 15,7 94    ( ) 39
abr 20123512 300 15,4 73    ( ) 39
mar 2012341  299 15,2 17    ( ) 39
fev 20123312 299 15,2 43    ( ) 39
jan 20123213 296 15,2 50    ( ) 39
dez 201131 1 296 15 117    ( ) 39
nov 201131 1 296 14,6 48    ( ) 39
out 201131 21295 14,5 209    ( ) 39
set 201131 1 294 13,9 55    ( ) 35
ago 20113111 294 13,7 32    ( ) 34
jul 201130 1 293 13,6 95    ( ) 34
jun 201130 2 293 13,3 86    ( ) 34
mai 201130   292 13 16    ( ) 31
abr 201130   292 13 33    ( ) 31
mar 20113024 292 12,9 162    ( ) 31
fev 20112812 287 12,5 83    ( ) 31
jan 201127 3 287 12,2 191    ( ) 31
dez 201027 3 285 11,7 166    ( ) 31
nov 20102712 281 11,2 87    ( ) 31
out 201026 1 277 11,1 48    ( ) 31
set 20102622 275 11 110    ( ) 30
ago 20102412 272 10,7 114    ( ) 28
jul 20102311 269 10,4 62    ( ) 27
jun 201022 1 269 10,2 47    ( ) 27
mai 201022 2 269 10 36    ( ) 27
abr 201022 2 268 9,9 44    ( ) 27
mar 20102212 267 9,8 101    ( ) 27
fev 201021 2 265 9,5 49    ( ) 25
jan 201021   260 9,4 21    ( ) 25
dez 20092123 257 9,5 127    ( ) 25
nov 200919 1 255 9,1 24    ( ) 23
out 200919   254 9 83    ( ) 23
set 200919 1 253 8,7 62    ( ) 23
ago 200919   249 8,6 33    ( ) 22
jul 2009191  248 8,5 17    ( ) 21
jun 200918 1 248 8,4 38    ( ) 21
mai 2009181  247 8,3 53    ( ) 21
abr 200917   247 8,1 23    ( ) 21
mar 200917 1 245 8,1 28    ( ) 21
fev 200917 1 244 8 18    ( ) 21
jan 200917 2 244 7,9 39    ( ) 21
dez 2008171  240 7,9 60    ( ) 21
nov 200816   238 7,7 34    ( ) 21
out 200816   235 7,6 9    ( ) 21
set 200816 1 233 7,7 18    ( ) 21
ago 200816   231 7,7 17    ( ) 21
jul 2008161  227 7,7 36    ( ) 21
jun 200815   227 7,6 10    ( ) 21
mai 200815   227 7,5 23    ( ) 21
abr 200815 1 224 7,5 43    ( ) 21
mar 20081512 21817,5 49    ( ) 20
fev 20081422 200 8 64    ( ) 20
jan 20081211 187 8,2 50    ( ) 20
dez 200711 2 177 8,4 88    ( ) 20
nov 20071111 173 8 50    ( ) 20
out 200710 2 168 8 41    ( ) 20
set 200710   159 8,2 60    ( ) 19
ago 200710 1 156 7,9 34    ( ) 19
jul 200710   150 8 17    ( ) 19
jun 20071011 149 8 139    ( ) 19
mai 2007922 146 7,2 113    ( ) 18
abr 20077   135 6,9 51    ( ) 13
mar 20077   134 6,6 25    ( ) 12
fev 20077   130 6,6 43    ( ) 12
jan 2007712 12916,3 75    ( ) 12
dez 2006611 113 6,6 45    ( ) 11
nov 20065   107 6,5 29    ( ) 11
out 20065 1 100 6,7 115    ( ) 11
set 20065 2 89 6,2 38    ( ) 10
ago 20065   86 6 20    ( ) 10
jul 20065 2 81 6,1 124    ( ) 10
jun 20065 1 69 5,4 59    ( ) 8
mai 2006512 6714,7 115    ( ) 5
abr 20064   49 4 22    ( ) 3
mar 200641  49 3,6 26    ( ) 3
fev 20063   44 3,4 11    ( ) 3
jan 20063 2 39 3,5 14    ( ) 3
dez 20053 1 34 3,6 18    ( ) 3
nov 20053 1 28 3,8 9    ( ) 3
out 20053   25 3,9 5    ( ) 3
set 20053   25 3,7 3    ( ) 3
ago 20053   22 4 7    ( ) 3
jul 20053 1 21 3,9 10    ( ) 3
jun 20053   20 3,6 7    ( ) 3
mai 2005322 18 3,6 49    ( ) 3
abr 20051   5 3,2 7    ( ) 2
mar 20051   2 4,5 4    ( ) 2
fev 20051       2    ( ) 2
jan 20051            ( ) 2
dez 20041            ( ) 2
nov 20041       2    ( ) 2
out 20041            ( ) 1
set 20041            ( ) 1
ago 200411      1    ( ) 1
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  1  3  5  10  5  10  1  3  5  10  25  100  5  10 
dez 2018411                  
nov 20184221   2     2       
out 20184     1     3       
set 2018            1       
ago 20184     1     2       
jul 201811          2       
jun 201831          2       
mai 20182           2       
abr 20182           3       
mar 201831          211     
fev 20183     2     31      
jan 2018211          11      
dez 201722    2     21      
nov 20171                   
out 20172     21            
set 201741    2     411     
ago 20172           1       
jul 20171111         111     
jun 2017422    1     32111   
mai 20174322   2     321   1 
abr 2017543    31    432221  
mar 20173     1     11      
fev 20172           2       
jan 20171           2       
out 20184     1     3       
jul 201811          2       
abr 20182           3       
jan 2018211          11      
out 20172     21            
jul 20171111         111     
abr 2017543    31    432221  
jan 20171           2       
out 20163221         2       
jul 20164     1     311     
abr 2016531    11    51      
jan 201673311  41    4211    
out 20152     1     411   1 
jul 2015431    21    1       
abr 20154322   533322532   1 
jan 201583333  8322  1154111  
out 2014211          61      
jul 201422211  4222  3221    
abr 20141055421141    911   11
jan 201463111  2     31      
out 2013632    2     72      
jul 201333321  33    1222     
abr 2013321    11    8321    
jan 201375321113     9211  1 
out 2012522211 3     82    11
jul 201252111121      41    11
abr 2012722111111    421     
jan 20126332   1     16321    
out 2011532221        9111    
jul 20113111111      7211    
abr 2011            411     
jan 201173311112     5211    
out 2010551  1 2     82      
jul 20106111 113     2       
abr 2010322  1       31      
jan 20104   1 2     4211    
out 20092   221     4       
jul 20091   1       2       
abr 200931    1     311   11
jan 2009422    2     211     
out 20081     1     222     
jul 20081   111     2       
abr 2008211    1     1       
jan 2008411    2     3       
out 20074221   3     41      
jul 200732          1       
abr 20072   111     4       
jan 20075321   1     1       
out 200631111  11    2211    
jul 200653211  321   5111    
abr 2006            1       
jan 2006222    1     31      
out 2005            11      
jul 2005211                  
abr 20051                   
jan 2005                    
out 2004                    

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1212100.0%5,242100.0%
39142.9%5,05896.5%
105023.6%4,81191.8%
322411.3%4,34282.8%
100104.7%3,44265.7%
31620.9%1,94237.0%
100010.5%1,57430.0%

 

3 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions		agoraΔtotalúltimos
30 dias		totalúltimos
30 dias		datadias
atrás		totalúltimos
30 dias		totalúltimos
30 dias
Risto hot sirUC28+129226-dez 23, 20173721---
CommonsDelinkerUC30 02715-jun 08, 20074223----
TradeUC35+22151-abr 11, 20122454----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions		posiçãototaldatadias
atrás		datadias
atrás
Rosenquist~dawikiquoteUC11,574set 21, 20103022abr 22, 20151348
AnankeBotUC2368dez 18, 20083664set 15, 20131932
FnielsenUC3302set 24, 20112654nov 25, 201835
SorenhkUC4256jun 04, 20132035fev 26, 2018307
BisgaardUC5237nov 04, 20054804set 27, 20103016
Liljekonvaller~dawikiquoteUC6204jul 03, 20103102jan 08, 20112913
SimmeDUC7192ago 11, 20122332mar 21, 2018284
ArthurBotUC8106mai 22, 20093509dez 02, 20093315
HenrikRombyUC9102jun 29, 20074202jun 13, 20083852
Jan FribergUC10101mai 19, 20074243nov 06, 20083706
DiupwijkUC1189mar 17, 20103210fev 25, 20122500
SamoaBotUC1289abr 08, 20141727abr 15, 20141720
Cred13UC1381out 21, 20122261jan 15, 20132175
DexbotUC1477abr 08, 20141727jan 18, 20161077
SteenthUC1575ago 14, 20131964jul 16, 2016897
LaaknorBotUC1673jul 18, 20083817jan 08, 20132182
SashaUC1760dez 03, 20093314mar 29, 20112833
HeismarkUC1858nov 27, 20102955jul 31, 20112709
LavendelerUC1957jun 24, 20093476fev 08, 20103247
LaurettaUC2053ago 07, 20103067ago 29, 20103045

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 2.256 edições foram feitas por usuários anônimos, de um total de 7.833 edições ( 28e %)
  

3 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions		datadias
atrás		datadias
atrás
DinybotUC1160mar 24, 20074299dez 17, 20074031--
EleferenBotUC2119fev 15, 20103240jan 13, 20132177--
AvicBotUC356jul 10, 20112730out 19, 20112629--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
dez 20184654599012239219190       1
nov 20184654599012239219190       1
out 20184634599012239219190       1
set 20184634589012239219190       1
ago 20184624589012239219190       1
jul 20184604589012239219190       1
jun 20184604589012239219190       1
mai 20184594589012239219190       1
abr 20184594579012239219190       1
mar 20184594579012239219190       1
fev 20184594579012239219190       1
jan 20184594559012239219190       1
dez 20174594559012239219190       1
nov 20174574529012239219190       1
out 20174574529012239219190       1
set 20174574529012239219190       1
ago 20174564508912239219190       1
jul 20174564508912239219190       1
jun 20174554508912239219184       1
mai 20174504508912239219137       1
abr 20174474488912239219137       1
mar 20174434408612239019134       1
fev 20174424408612238719134       1
jan 20174424388612238719134       1
dez 20164424388612238719134       1
nov 20164424388612238719134       1
out 20164404378612238719134       1
set 20164344378612238719134       1
ago 20164334368612238719134       1
jul 20164324358612238719134       1
jun 20164314358512238719134       1
mai 20164304358512238719132       1
abr 20164304358512238719132       1
mar 20164294328512238619132       1
fev 20164284328512238619131       1
jan 20164274318512238619131       1
dez 20154204288512238619130       1
nov 20154204258512238618130       1
out 20154204258512238618130       1
set 20154204258412237918130       1
ago 20154194248412237918130       1
jul 20154194248412237818130       1
jun 20154144238412237818130       1
mai 20154104228412237818130       1
abr 20154084228412237818130       1
mar 20154074218212137818130       1
fev 20154004197512136818122       1
jan 20153934037312036618111       1
dez 2014388393691203381869       1
nov 2014383392681203321869       1
out 2014383391681203321869       1
set 2014381388681203321869       1
ago 2014381385681203321869       1
jul 2014380382681193321869       1
jun 2014380382671153311868       1
mai 2014379381671153311868       1
abr 2014379380671153311868       1
mar 2014378375671153311868       1
fev 2014378372671153311868       1
jan 2014376369671153301868       1
dez 2013375365671153301868       1
nov 2013375365661153291868       1
out 2013367361661153291868       1
set 2013367358661153291867       1
ago 2013367344661143291867       1
jul 2013367338641143281766       1
jun 2013366333641133271765       1
mai 2013365331641133261765       1
abr 2013356329631133241764       1
mar 2013356324621133221762       1
fev 2013355318621133221762       1
jan 2013355310621123221762       1
dez 2012353309621123191762       1
nov 2012352305621103191762       1
out 2012345304591103081553       1
set 2012345298591103081553       1
ago 2012345294591103081551       1
jul 201234428752182511248       1
jun 201234128552182511248       1
mai 201234027752182511248       1
abr 201233927452182511248       1
mar 201233826952182471248       1
fev 201233826552182471248       1
jan 201233525752182471247       1
dez 201133524852182471246       1
nov 201133524252182461246       1
out 201133423052182451245       1
set 201132922452182451245       1
ago 201132822252182451245       1
jul 201132721852182451245       1
jun 201132721052182451245       1
mai 201132320652182451245       1
abr 201132320252182451245       1
mar 201132319552182451245       1
fev 201131818852182451245       1
jan 201131818251182451244       1
dez 201031617951182431244       1
nov 201031217651182421243       1
out 201030817451182421243       1
set 201030516951182401241       1
ago 201030016451182391241       1
jul 201029614851181311241       1
jun 201029614751181311241       1
mai 201029613751181301241       1
abr 201029513751181301241       1
mar 201029413251181301241       1
fev 201029012551181291241       1
jan 201028512251181281241       1
dez 200928210851181261241       1
nov 200927810651181261241       1
out 200927710451181231241       1
set 200927610351181231241       1
ago 20092719851181231241       1
jul 20092699851181231241       1
jun 20092699651181231241       1
mai 20092689551181221241       1
abr 20092689351181221241       1
mar 20092668551181221241       1
fev 20092658251181221240       1
jan 20092657850181211240       1
dez 20082617850181211240       1
nov 20082597550181211240       1
out 20082566150181211240       1
set 20082545250181211240       1
ago 20082525050181211240       1
jul 20082484750181211240       1
jun 20082484650181211240       1
mai 20082484250181211240       1
abr 20082453950181211240       1
mar 20082383850181211240       1
fev 20082203450181201240       1
jan 20082073450181201240       1
dez 20071973250181201237       1
nov 20071932950181201237       1
out 20071882950171191237       1
set 20071782650171181237       1
ago 20071752650171181237       1
jul 20071692350161161235       1
jun 20071682350161161235       1
mai 20071642343141161235       1
abr 200714819321 1091025       1
mar 200714617301 1081025       1
fev 200714215301 1081025       1
jan 200714115301 1081025       1
dez 200612415301 1081021       1
nov 200611815301 1071021       1
out 200611115301 1071020       1
set 20069914281 1071018       1
ago 20069613281 761018       1
jul 20069112281 761018       1
jun 2006779251 721018       1
mai 2006728211 671018       1
abr 2006528211 361010       1
mar 2006528211 361010       1
fev 2006477211 361010       1
jan 2006427211 361010       1
dez 2005375211 36109       1
nov 2005313201 36108       1
out 200528321 316       1
set 200528221 3 6       1
ago 200525221 3 6       1
jul 200524221 3 6       1
jun 200523221 3 6       1
mai 20052122  3 6        
abr 20057 1  1 3        
mar 20054 1  1 2        
fev 20052    1          
jan 20052    1          
dez 20042    1          
nov 20042               
out 20041               
set 20041               
ago 20041               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons
 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

nov 2004: 1 1 Man har et standpunkt...

fev 2005: 1 1 Man har et standpunkt...

mar 2005: 1 1 Søren Kierkegaard

abr 2005: 1 1 Dolph

mai 2005: 1 2 Ytringsfrihed , 2 2 Jytte Hilden , 3 2 Padmé Neberrie , 4 2 Anakin Skywalker

jun 2005: 1 1 Aase D. Madsen

jul 2005: 1 1 Angelina Jolie

ago 2005: 1 1 Albert Einstein

set 2005: 1 1 Anders Fogh Rasmussen

nov 2005: 1 1 Isaac Newton

dez 2005: 1 2 Herbert Hoover

jan 2006: 1 1 Arkimedes

fev 2006: 1 1 Angelina Jolie

mar 2006: 1 1 Yann Martel

mai 2006: 1 2 Woody Allen , 2 1 William T. Sherman

jun 2006: 1 1 Opsætning til forfatterartikler

jul 2006: 1 2 Thomas Jefferson , 2 2 Uffe Ellemann-Jensen , 3 1 Samuel Beckett

ago 2006: 1 1 Pia Kjærsgaard

set 2006: 1 2 Samuel Beckett , 2 1 The Matrix Reloaded

out 2006: 1 2 Jackie Mason , 2 1 Bart Simpson

nov 2006: 1 1 Danske ordsprog

dez 2006: 1 1 Friedrich Nietzsche

jan 2007: 1 2 Peter Pan , 2 1 Danske ordsprog

fev 2007: 1 1 Danske ordsprog

mar 2007: 1 1 Danske ordsprog

abr 2007: 1 2 August Strindberg , 2 1 Johan August Strindberg

mai 2007: 1 2 Ga-Jol , 2 2 Aksel Sandemose , 3 2 Mærsk Mc-Kinney Møller , 4 2 Marilyn Monroe

jun 2007: 1 3 Gerald Ford , 2 2 Mark Twain , 3 2 Benito Mussolini , 4 2 Mao Zedong , 5 2 The Matrix Revolutions , 6 1 Mogens Glistrup

jul 2007: 1 2 Mao Zedong , 2 1 Danske ordsprog

ago 2007: 1 1 Comte de Lautréamont

set 2007: 1 2 Karen Jespersen , 2 1 Jens Blauenfeldt

out 2007: 1 1 Rune Lund

nov 2007: 1 1 Jakob Axel Nielsen

dez 2007: 1 1 Holger Kirkholm Nielsen

jan 2008: 1 1 Eddie Izzard

fev 2008: 1 1 Danske ordsprog

mar 2008: 1 1 Groucho Marx

abr 2008: 1 1 Lars Emil Johansen

mai 2008: 1 1 Oscar Wilde

jun 2008: 1 1 Alex Ahrendtsen

jul 2008: 1 1 John Lennon

ago 2008: 1 2 Matador , 2 1 Wien

set 2008: 1 1 Danske ordsprog

out 2008: 1 1 Borat

nov 2008: 1 2 Anders Fogh Rasmussen , 2 1 Kristian Thulesen Dahl

dez 2008: 1 1 Bart Simpson

jan 2009: 1 2 Peter Albert Huggler , 2 2 Josef Stalin , 3 1 Lone Dybkjær

fev 2009: 1 1 Danske ordsprog

mar 2009: 1 1 Niels Ditlev Riegels

abr 2009: 1 1 Danske ordsprog

mai 2009: 1 1 Danske ordsprog

jun 2009: 1 1 Karen Blixen

jul 2009: 1 1 Karen Blixen

ago 2009: 1 1 Henry E. Steinway

set 2009: 1 1 Grigorij Aleksandrovich Petjorin

out 2009: 1 1 Brian Mikkelsen

nov 2009: 1 1 Karen Blixen

dez 2009: 1 2 W.C. Fields , 2 2 Josef Stalin , 3 1 Danske ordsprog

jan 2010: 1 2 Karen Blixen , 2 1 Leonardo da Vinci

fev 2010: 1 2 Richard Feynman , 2 2 Karen Blixen , 3 1 Danske ordsprog

mar 2010: 1 2 Danske ordsprog , 2 2 Karen Blixen

abr 2010: 1 1 Danske ordsprog

mai 2010: 1 1 Danske ordsprog

jun 2010: 1 1 Danske ordsprog

jul 2010: 1 2 Danske ordsprog , 2 2 Karen Blixen

ago 2010: 1 3 Danske ordsprog , 2 2 Thomas Dinesen , 3 1 Søren Aabye Kierkegaard

set 2010: 1 2 Danske ordsprog , 2 1 Fawlty towers

out 2010: 1 2 Jul , 2 2 Danske ordsprog , 3 1 Jul (højtid)

nov 2010: 1 1 Robert G. Ingersoll

dez 2010: 1 2 Christian Braunmann Tullin , 2 2 Thomas Paine , 3 2 Danske ordsprog , 4 2 Comte de Lautréamont , 5 2 Abraham Lincoln , 6 1 Thomas Edison

jan 2011: 1 2 Thomas Paine , 2 2 Brian Mikkelsen , 3 2 Immanuel Kant , 4 2 Sokrates , 5 1 Jens Martin Knudsen

fev 2011: 1 3 Danske ordsprog , 2 2 Søren Krarup , 3 2 Søren Espersen , 4 1 Thomas Edison

mar 2011: 1 2 Thomas Edison , 2 2 Thomas Paine , 3 2 Danske ordsprog , 4 2 Karen Blixen , 5 2 Martin Luther King , 6 2 Josef Stalin , 7 2 August Strindberg , 8 2 Kinesiske ordsprog , 9 2 Monty Python og de skøre riddere , 10 1 Denys Finch Hatton

mai 2011: 1 1 Danske ordsprog

jun 2011: 1 2 Connie Hedegaard , 2 1 Franklin Roosevelt

jul 2011: 1 2 Søren Kierkegaard , 2 1 Giovanni Boccaccio

ago 2011: 1 2 Danske ordsprog , 2 1 Barney Stinson

set 2011: 1 2 Danske ordsprog , 2 2 H.C. Andersen , 3 1 Robert Green Ingersoll

out 2011: 1 2 August Strindberg , 2 2 Kinesiske ordsprog , 3 2 Jules Verne , 4 2 Charles Dickens , 5 1 Gajol

nov 2011: 1 2 Danske ordsprog , 2 1 Roser

dez 2011: 1 1 Mary Westenholz

jan 2012: 1 3 Danske ordsprog , 2 2 Albert Einstein , 3 1 Bill Shankly

fev 2012: 1 2 Thomas Edison , 2 2 Thomas Paine , 3 1 Richard Møller Nielsen

mar 2012: 1 1 Thomas Paine

abr 2012: 1 2 Danske ordsprog , 2 1 H.C. Hansen

mai 2012: 1 1 Jane Austen

jun 2012: 1 1 Lev Tolstoj

jul 2012: 1 2 Babettes Gæstebud (film) , 2 1 Ditte Menneskebarn (film)

ago 2012: 1 1 Ludwig Hoffmann

set 2012: 1 3 Danske ordsprog , 2 1 Chris Iwelumo

out 2012: 1 2 Karen Blixen , 2 2 August Strindberg , 3 2 Sokrates , 4 2 Albert Einstein , 5 2 Søren Kierkegaard , 6 1 De fire årstider

nov 2012: 1 2 Denys Finch Hatton , 2 2 Giovanni Boccaccio , 3 2 Leonardo da Vinci , 4 2 Peter Laugesen , 5 2 Mao Zedong , 6 2 Georg Brandes , 7 1 Christian Elling

dez 2012: 1 2 Danske ordsprog , 2 1 Rungstedlund

jan 2013: 1 3 Danske ordsprog , 2 2 Leonardo da Vinci , 3 2 August Strindberg , 4 1 Anna Ancher

fev 2013: 1 3 Andy Warhol , 2 1 Danske ordsprog

mar 2013: 1 1 Frank Herbert

abr 2013: 1 2 Danske ordsprog , 2 1 Michael Jackson

mai 2013: 1 1 Bünyamin Simsek

jun 2013: 1 2 Danske ordsprog , 2 1 Falklandskrigen

jul 2013: 1 1 Radikale Venstre

ago 2013: 1 2 Danske ordsprog , 2 2 Bibelen , 3 1 Georg Metz

set 2013: 1 2 Danske ordsprog , 2 2 Forrest Gump , 3 1 Jane Austen

out 2013: 1 3 Danske ordsprog , 2 1 Radikale Venstre

nov 2013: 1 2 Annette Vilhelmsen , 2 2 Enhedslisten , 3 1 Anarki

dez 2013: 1 1 De fire årstider

jan 2014: 1 2 Danske ordsprog , 2 1 Karsten Hønge

fev 2014: 1 1 Anne Brockenhuus-Schack

mar 2014: 1 2 Poul Nyrup Rasmussen

abr 2014: 1 6 Danske ordsprog , 2 2 Roser , 3 2 Karen Blixen , 4 2 Hillary Clinton , 5 1 Simon Emil Amnitzbøll

mai 2014: 1 1 Emmelie de Forest

jun 2014: 1 2 Margrethe 2. , 2 1 Oviri

jul 2014: 1 1 Rungstedlund

ago 2014: 1 2 Dr. Strangelove , 2 1 DF

set 2014: 1 1 Danske ordsprog

out 2014: 1 1 Regner Grasten

nov 2014: 1 1 Pia Kjærsgaard

dez 2014: 1 2 Jens Cornelius , 2 1 Jens Risom

jan 2015: 1 2 Rom , 2 2 Mahatma Gandhi , 3 2 Jens Cornelius , 4 2 Denys Finch Hatton , 5 2 Mærsk Mc-Kinney Møller , 6 1 Inger Støjberg

fev 2015: 1 2 Ruth Bader Ginsburg , 2 2 Danskere , 3 2 Thomas Edison , 4 2 Jan Guillou , 5 1 Danmark

mar 2015: 1 2 Georg Metz , 2 1 Norge

abr 2015: 1 1 Avis

mai 2015: 1 2 Michael O'Leary

jun 2015: 1 2 Charles Bukowski , 2 2 Helle Thorning-Schmidt , 3 2 Anders Fogh Rasmussen , 4 1 Homoseksualitet

jul 2015: 1 2 Kanye West , 2 2 Yahya Hassan , 3 1 Kayne West

set 2015: 1 1 Sex

out 2015: 1 1 Paradise Hotel (Danmark, sæson 6)

nov 2015: 1 1 De fire årstider

dez 2015: 1 1 Immanuel Kant

jan 2016: 1 3 Star Wars , 2 2 Albert Einstein , 3 1 Mogens Lykketoft

fev 2016: 1 2 Dana Gioia , 2 1 Søren Brun

mar 2016: 1 2 Søren Brun , 2 2 Albert Einstein , 3 1 Jordan

abr 2016: 1 2 Josef Stalin , 2 1 Carl Gustav Jung

mai 2016: 1 1 Charles Bukowski

jun 2016: 1 1 Koranen

jul 2016: 1 2 Mærsk Mc-Kinney Møller , 2 1 Jan Gehl

ago 2016: 1 1 Linus Torvalds

set 2016: 1 1 Jakob Ellemann-Jensen

out 2016: 1 1 Poul-Henning Kamp

nov 2016: 1 1 Ole Birk Olesen

dez 2016: 1 1 Jarl Cordua

jan 2017: 1 1 Jacob Haugaard

fev 2017: 1 1 De fire årstider

mar 2017: 1 2 Lars Løkke Rasmussen , 2 1 Helga Pedersen

abr 2017: 1 2 De fire årstider , 2 1 Peter Lund Madsen

mai 2017: 1 2 Harald Giersing , 2 1 Livet

jun 2017: 1 1 Bjarne Slot Christiansen

jul 2017: 1 1 Steve Jobs

ago 2017: 1 1 Livet

set 2017: 1 2 Enhedslisten , 2 1 Casper og Mandrilaftalen

out 2017: 1 2 Jacob Haugaard , 2 1 Hadsund

nov 2017: 1 1 Giovanni Boccaccio

dez 2017: 1 1 Citaterade

jan 2018: 1 1 Citaterade

fev 2018: 1 1 Citaterade

mar 2018: 1 2 Josef Stalin , 2 1 Citaterade

abr 2018: 1 1 Citaterade

mai 2018: 1 1 Citaterade

jun 2018: 1 1 Nikita Klæstrup

jul 2018: 1 1 Citaterade

ago 2018: 1 2 Gesunde Diäten Wie Schnell 10 Kg Abnehmen Acai Beeren Kaufen

out 2018: 1 1 Citaterade

nov 2018: 1 1 Den der kommer først til mølle, får først malet.

dez 2018: 1 1 Citaterade

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:28 (final run)

Dump file dawikiquote-20190101-stub-meta-history.xml.gz (edits only), size 783 kb as gz -> 5.2 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:16 after 7 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.