Estatísticas da Wikiquote inglês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2018+1% +27% +1%   +11%    () 0%
nov 20180% -4% +1%   -23%    () 0%
out 20180% +2% +1%   -17%    () 0%
set 20180% -4% +1%   -1%    () 0%
ago 2018+1% +11% +1%   +20%    () 0%
jul 20180% -2% +1%   +38%    () +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20184744291401233 k657,8 12 k    ( ) 26 k
nov 20184715201101233 k757,7 11 k    ( ) 26 k
out 20184695201151633 k857,8 14 k    ( ) 26 k
set 20184675221131233 k657,8 17 k    ( ) 26 k
ago 20184653281181232 k757,6 17 k    ( ) 26 k
jul 20184625191061532 k1057,4 14 k    ( ) 26 k
jun 20184606191081332 k657,5 10 k    ( ) 26 k
mai 20184587301191332 k657,5 11 k    ( ) 25 k
abr 20184557141121332 k757,5 15 k    ( ) 25 k
mar 20184543221101531 k757,4 13 k    ( ) 25 k
fev 20184521191031631 k857,4 13 k    ( ) 25 k
jan 20184502231041331 k657,4 13 k    ( ) 25 k
dez 2017447922991231 k657,3 13 k    ( ) 25 k
nov 2017445711911231 k457,2 8,6 k    ( ) 25 k
out 2017444613831130 k757,2 8,4 k    ( ) 25 k
set 20174433201071030 k657,4 8,7 k    ( ) 24 k
ago 2017441318961430 k457,4 12 k    ( ) 24 k
jul 20174395241041230 k557,2 8,5 k    ( ) 24 k
jun 2017437117101830 k557,2 7,1 k    ( ) 24 k
mai 20174354181041030 k657,3 8,4 k    ( ) 24 k
abr 201743361790929 k557,3 8,5 k    ( ) 24 k
mar 2017431914861029 k757,3 8,8 k    ( ) 24 k
fev 2017430512961129 k757,4 8,8 k    ( ) 24 k
jan 20174293161021129 k757,5 8,8 k    ( ) 24 k
dez 2016427710771129 k557,6 9,5 k    ( ) 24 k
nov 2016426713951329 k657,6 8,7 k    ( ) 24 k
out 2016425415911228 k557,7 8,5 k    ( ) 24 k
set 201642398751228 k1057,7 9,0 k    ( ) 23 k
ago 2016423118941528 k1658 12 k    ( ) 23 k
jul 2016421315911327 k1258,7 9,7 k    ( ) 23 k
jun 2016419810851027 k859,1 7,8 k    ( ) 22 k
mai 20164188211031027 k659,3 10 k    ( ) 22 k
abr 2016416717911027 k459,4 9,0 k    ( ) 22 k
mar 20164150161021426 k859,3 17 k    ( ) 22 k
fev 2016413418981326 k859,2 14 k    ( ) 22 k
jan 2016411615861426 k559,2 13 k    ( ) 22 k
dez 2015410121971626 k659,1 14 k    ( ) 21 k
nov 2015408012931626 k559 11 k    ( ) 21 k
out 20154068231061525 k658,9 12 k    ( ) 21 k
set 20154045161071925 k758,8 17 k    ( ) 20 k
ago 20154029291161325 k658,7 14 k    ( ) 20 k
jul 2015400012991525 k758,6 14 k    ( ) 19 k
jun 2015398815801425 k958,5 9,9 k    ( ) 19 k
mai 2015397314821324 k458,7 8,8 k    ( ) 19 k
abr 2015395917851324 k458,6 11 k    ( ) 18 k
mar 2015394218931224 k558,5 14 k    ( ) 18 k
fev 2015392416801424 k458,3 10 k    ( ) 18 k
jan 20153908171131524 k558,2 9,4 k    ( ) 17 k
dez 2014389112911124 k558,1 7,9 k    ( ) 17 k
nov 2014387924971224 k958,2 14 k    ( ) 17 k
out 2014385512911423 k758,2 11 k    ( ) 17 k
set 2014384324961423 k458,2 10 k    ( ) 16 k
ago 2014381910891323 k558,1 10 k    ( ) 16 k
jul 2014380922971323 k758 12 k    ( ) 16 k
jun 2014378716801623 k558,1 10 k    ( ) 16 k
mai 20143771231111523 k458 9,9 k    ( ) 15 k
abr 20143748161041422 k457,9 20 k    ( ) 15 k
mar 20143732271071322 k457,3 12 k    ( ) 15 k
fev 2014370526961322 k457 9,7 k    ( ) 15 k
jan 20143679301041222 k556,9 12 k    ( ) 15 k
dez 2013364918971522 k456,7 9,5 k    ( ) 14 k
nov 2013363116971222 k256,7 7,7 k    ( ) 14 k
out 2013361510981222 k356,5 8,0 k    ( ) 14 k
set 20133605241021322 k456,4 8,2 k    ( ) 14 k
ago 2013358122861221 k356,3 8,2 k    ( ) 14 k
jul 2013355915951221 k356,2 9,2 k    ( ) 14 k
jun 2013354419931721 k356 12 k    ( ) 14 k
mai 201335259811121 k355,7 11 k    ( ) 14 k
abr 2013351620101821 k555,4 12 k    ( ) 14 k
mar 201334961992921 k655,2 10 k    ( ) 13 k
fev 201334771691821 k455,2 8,9 k    ( ) 13 k
jan 2013346118961121 k555 10,0 k    ( ) 12 k
dez 201234431584820 k355 6,3 k    ( ) 12 k
nov 201234281993920 k354,9 7,6 k    ( ) 12 k
out 20123409291101120 k354,8 9,3 k    ( ) 12 k
set 2012338022102820 k354,6 6,9 k    ( ) 12 k
ago 20123358261041120 k354,5 8,9 k    ( ) 12 k
jul 201233322798920 k354,2 7,7 k    ( ) 12 k
jun 201233052588720 k354,1 6,6 k    ( ) 12 k
mai 2012328022100620 k354 9,9 k    ( ) 12 k
abr 2012325822961020 k353,7 8,4 k    ( ) 12 k
mar 2012323623107820 k353,5 8,8 k    ( ) 12 k
fev 2012321327102920 k553,3 9,7 k    ( ) 12 k
jan 2012318633118719 k453,2 11 k    ( ) 12 k
dez 2011315324100819 k452,9 12 k    ( ) 12 k
nov 201131292594519 k352,7 9,7 k    ( ) 12 k
out 201131043089919 k352,4 12 k    ( ) 11 k
set 201130743397919 k352 9,2 k    ( ) 11 k
ago 201130412187619 k251,8 9,7 k    ( ) 11 k
jul 201130202899619 k351,4 9,0 k    ( ) 11 k
jun 2011299224101619 k351,2 13 k    ( ) 11 k
mai 2011296827101819 k350,8 12 k    ( ) 11 k
abr 201129412492819 k1450,4 16 k    ( ) 11 k
mar 2011291726102818 k250,7 10 k    ( ) 11 k
fev 201128913396818 k450,3 8,5 k    ( ) 11 k
jan 2011285828101718 k450,1 12 k    ( ) 11 k
dez 2010283039105818 k549,8 11 k    ( ) 11 k
nov 2010279131104618 k549,6 13 k    ( ) 11 k
out 2010276030921218 k449,3 9,6 k    ( ) 11 k
set 20102730381141117 k549,1 11 k    ( ) 10 k
ago 201026922792817 k548,9 12 k    ( ) 10 k
jul 201026653196717 k548,6 11 k    ( ) 10 k
jun 201026343096617 k448,4 12 k    ( ) 10 k
mai 201026043393917 k347,9 11 k    ( ) 10 k
abr 2010257125107717 k447,6 12 k    ( ) 10 k
mar 20102546301111017 k447,2 12 k    ( ) 10,0 k
fev 2010251621931017 k546,8 10 k    ( ) 9,9 k
jan 2010249533101716 k646,6 11 k    ( ) 9,9 k
dez 20092462351131116 k346,4 11 k    ( ) 9,8 k
nov 20092427331131116 k546,1 11 k    ( ) 9,8 k
out 2009239441124916 k545,8 12 k    ( ) 9,7 k
set 20092353311171116 k545,5 12 k    ( ) 9,6 k
ago 20092322361081016 k345,1 9,4 k    ( ) 9,6 k
jul 2009228650148916 k544,8 11 k    ( ) 9,5 k
jun 20092236311051015 k544,5 11 k    ( ) 9,5 k
mai 20092205381331015 k444,2 12 k    ( ) 9,4 k
abr 2009216740126915 k543,8 13 k    ( ) 9,3 k
mar 20092127401421115 k543,4 14 k    ( ) 9,2 k
fev 20092087341131015 k542,8 11 k    ( ) 9,2 k
jan 20092053451311015 k342,5 12 k    ( ) 9,1 k
dez 20082008371151115 k541,9 12 k    ( ) 9,0 k
nov 20081971491251415 k441,6 12 k    ( ) 8,9 k
out 2008192232122914 k441,1 12 k    ( ) 8,8 k
set 2008189028123714 k540,6 12 k    ( ) 8,8 k
ago 2008186231125614 k440,2 12 k    ( ) 8,6 k
jul 2008183144134614 k639,7 14 k    ( ) 8,5 k
jun 2008178755180814 k839,2 16 k    ( ) 8,3 k
mai 20081732451611314 k538,7 16 k    ( ) 8,2 k
abr 20081687361291013 k738 16 k    ( ) 8,0 k
mar 2008165141144913 k637,3 15 k    ( ) 7,8 k
fev 20081610411341213 k736,7 17 k    ( ) 7,6 k
jan 2008156940148913 k835,9 16 k    ( ) 5,4 k
dez 20071529401241013 k935,4 14 k    ( ) 4,6 k
nov 2007148939130912 k835 15 k    ( ) 4,5 k
out 20071450301341012 k734,5 15 k    ( ) 4,4 k
set 2007142038136912 k633,8 14 k    ( ) 4,3 k
ago 20071382541471512 k733,1 14 k    ( ) 4,2 k
jul 20071328631701111 k1132,5 14 k    ( ) 4,0 k
jun 2007126545158711 k832,2 14 k    ( ) 3,9 k
mai 20071220641961611 k6831,7 20 k    ( ) 3,7 k
abr 2007115650146108,8 k937 18 k    ( ) 3,5 k
mar 2007110655155128,5 k1036,1 23 k    ( ) 3,1 k
fev 2007105154143118,2 k1334,8 15 k    ( ) 2,9 k
jan 200799757157117,8 k834,4 16 k    ( ) 2,8 k
dez 20069405013197,6 k733,4 14 k    ( ) 2,7 k
nov 20068904514197,4 k832,4 15 k    ( ) 2,6 k
out 20068454014477,2 k631,4 13 k    ( ) 2,5 k
set 20068054612077,0 k630,3 12 k    ( ) 2,4 k
ago 20067595613476,8 k629,4 14 k    ( ) 2,3 k
jul 20067035514586,6 k828,1 13 k    ( ) 2,2 k
jun 200664854127116,4 k2027,2 14 k    ( ) 2,1 k
mai 20065944412465,8 k627,6 12 k    ( ) 2,0 k
abr 20065503910285,6 k626,3 11 k    ( ) 1,9 k
mar 2006511329655,4 k725,2 10 k    ( ) 1,7 k
fev 2006479328555,2 k624,2 10 k    ( ) 1,6 k
jan 20064474210775,0 k923,1 11 k    ( ) 1,6 k
dez 2005405308444,7 k622,1 9,6 k    ( ) 1,4 k
nov 2005375257044,5 k720,9 8,0 k    ( ) 1,4 k
out 2005350286464,3 k1120,1 8,8 k    ( ) 1,3 k
set 2005322115264,0 k619,6 6,2 k    ( ) 1,2 k
ago 2005311278073,8 k918,9 8,9 k    ( ) 1,1 k
jul 2005284257363,5 k917,8 9,3 k    ( ) 1,0 k
jun 2005259256563,3 k716,5 6,9 k    ( ) 943
mai 2005234206373,1 k615,4 5,4 k    ( ) 871
abr 2005214215672,9 k714,5 6,6 k    ( ) 798
mar 2005193164252,6 k613,2 4,6 k    ( ) 688
fev 2005177153832,5 k512,4 2,9 k    ( ) 613
jan 20051621136 2,3 k511,8 2,7 k    ( ) 573
dez 2004151184932,2 k511,4 3,6 k    ( ) 535
nov 2004133194912,0 k510,5 3,1 k    ( ) 460
out 200411493741,9 k79,7 3,0 k    ( ) 407
set 2004105153811,7 k69 2,2 k    ( ) 345
ago 200490102311,5 k48,6 1,4 k    ( ) 262
jul 20048092831,4 k58,5 1,7 k    ( ) 241
jun 20047172111,2 k58,3 1,3 k    ( ) 217
mai 200464101921,0 k38,3 1,3 k    ( ) 184
abr 200454618193037,8 906    ( ) 146
mar 200448410184147,5 815    ( ) 123
fev 200444 9173037,6 710    ( ) 110
jan 20044439165137,4 742    ( ) 95
dez 20034137 56517,2 371    ( ) 82
nov 200338511152927 943    ( ) 77
out 200333215 46326 477    ( ) 63
set 2003311222139545,8 732    ( ) 56
ago 200319718228755,4 880    ( ) 44
jul 2003121117114554,6 671    ( ) 20
jun 20031   1 1      ( )  
mai 20031   1 1      ( )  
abr 20031   1 1      ( )  
mar 20031   1 1      ( )  
fev 20031   1 1      ( )  
jan 200311  1 1 1    ( )  
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 20181111111 1      64
jul 20181111111 1      64
abr 20181111111 1      64
jan 20181111121 1      64
out 20171111121 1      64
jul 20171111131 1      64
abr 20171111121 1      64
jan 20171111111 1      64
out 20161111131 1      64
jul 20161111111 1      64
abr 20161111221 1      64
jan 20161111221 1      64
out 20151111231 1      64
jul 20151111221 1      64
abr 20151111241 1      64
jan 20151111221 1      64
out 20141111211 1      64
jul 20141111211 1      64
abr 20141111241 1      64
jan 20141111221 1      64
out 20131111231 1      64
jul 20131111241 1      64
abr 20131111231 1      64
jan 20131111231 1      64
out 20121111151 1      64
jul 20121111141 1      64
abr 20121111141 1      64
jan 20121112141 1      64
out 20111111131 1      64
jul 20111112131 1      64
abr 20111111131 1      64
jan 20111111121 1      63
out 20101111131 1      63
jul 20101112141 1      63
abr 20101111141 1      63
jan 20101111121 1      63
out 20091111111 1      63
jul 20091111111 1      63
abr 20091111111 1      63
jan 20091111121 1      63
out 20081111121 1      63
jul 20081113121 1      63
abr 20081111111 1      63
jan 20081111111 1      63
out 20071111111 1      62
jul 20071111111 1      61
abr 20071111111 1      61
jan 20071111111 1      61
out 20061111121 1      61
jul 20061111131 1      61
abr 20061111141 1      60
jan 20061111141 1      60
out 20051111121 1      60
jul 20051111112 1      59
abr 20051111112 1      59
jan 2005111 121 2      57
out 20041111121 1      46
jul 20041111111 1      18
abr 2004111111  1      3
jan 2004111111  1      3
out 2003111 11  1      3
jul 2003111111  1      3
abr 20031   1          3
jan 200311  1   1      2
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  1000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  5  10  100  1000 
dez 201842619314085361241     84201074        82271610511     
nov 201840116811072391241     65271481        80251495   1   
out 201839715811575401691 11  852614103        8025181351      
set 201837817611367401252 1   80221151        91312212521     
ago 201839317511877391262111  85211382        97301915511     
jul 201837014610671391571 11  803021153        9741312092      
jun 201836315510872341341 1   692311711       7235261461      
mai 201837416311970401361     77201382        754024158       
abr 201838616711268331362111  77261811821 11   842920131052     
mar 201836214611073421571     82232014732 11   853326151011     
fev 2018380156103663916102 11  7332191351       8036251561      
jan 2018393150104723413721    68251892        6528221682      
dez 201734513999643412521    6121121041       7028191151      
nov 20173511359155291231 11  6119105         793018841      
out 2017346125836035113      50181172        66281797       
set 20173501631076731103  11  5617962        652415112       
ago 20173431479660291432 11  53171252        742313641      
jul 20173851511046732125      5318941        7217854       
jun 2017355135101582683      661773         66181142       
mai 20173591381046735103      6816931        74251262   1   
abr 2017317134905936941     661614105        6422138311     
mar 20173511268655291051     7419141031       61191594       
fev 20173141299660301121     791813114   11   682416951      
jan 20173421441026232116  1   65221482   11   69271995       
out 201839715811575401691 11  852614103        8025181351      
jul 201837014610671391571 11  803021153        9741312092      
abr 201838616711268331362111  77261811821 11   842920131052     
jan 2018393150104723413721    68251892        6528221682      
out 2017346125836035113      50181172        66281797       
jul 20173851511046732125      5318941        7217854       
abr 2017317134905936941     661614105        6422138311     
jan 20173421441026232116  1   65221482   11   69271995       
out 2016292118916836125  11  51191083        63251286       
jul 20163001279162351371 1   70201273        6126201492      
abr 2016311138916431107  11  63271894        60231797       
jan 20163511398657311472121  74161084        7730201581      
out 201533314310673381581 1   823320133        672821131021 1   
jul 20153471429954301581111  11029201571       8833161363      
abr 20153181268550301353     823122135   222227922161071  1111
jan 201540715211362321561     1595439251242      1144637221322     
out 20143301269154271463     7920151131       632214961      
jul 20143441569760311393 1   7424201051       68281915103      
abr 201437414710469331451 221192312312821      108352517113  111 
jan 201439516510472411261111  1014130161031      1164431181441     
out 2013367132985828125      712312853       933221108       
jul 20133411339558361231 1   642115931       8028181162      
abr 20133441371015629852 11  752615844       79291511841     
jan 20133541419659251161 1   72201285        9240251482      
out 201236915211064321151     811611862       96261412811     
jul 201236813998552693  11  681712115        812419107       
abr 2012347140965729103  11  6526141151       8831231461      
jan 20123991661187235761 11  9330201262       96352311731     
out 2011372150896027942 11  852311642       9529176641     
jul 2011366159996026621 22  8730161031       9527201031      
abr 201138515492552685211   8932178421      104342112742     
jan 20114091611015522752 111 912416932       10129178411     
out 2010414142925830122  32  812613952       102342214821111  
jul 201040015196542072  11  8728171161       9429191351      
abr 20104511681075322742 332 8131181242       7823147421 1   
jan 2010443166101633272  431 9635201152       1123020116   21  
out 20094631751247338921 33111034127161121      13449241331      
jul 2009530227148834494  22  11935181052       16553371852  1   
abr 20094761881267333951 321 10035181063       151523318102  111 
jan 20095592091316227105  33  8625151184       124433116102      
out 2008488179122643394  43  115412819821      1705335231561 11  
jul 20085102121347128631 21  123402110622      193472917931 11  
abr 200849421912980341061 43  11340241710311     1345237251331     
jan 20085422471488428921 111 1124121161132      153483121932     
out 200752222613470311021 222 108312213831      145462519104      
jul 20075412471709643115  211 1224328207311     1705943281951     
abr 20075752231468036106  111 135412718962      142443221133  1111
jan 20075572411578541116  11  129362013642      17458341995      
out 2006513219144532073      110271310622      17140261686      
jul 2006506215145773683  11  114251611632      162482313841     
abr 2006420157102592482  11  10124147521      13540281363      
jan 2006349151107562671  111 9133201041       110331913641 11  
out 200526711064331861  111 65181310311      793117863      
jul 2005288114734321631 111 80261611742      117402511742     
abr 20052117656301273      5617118722      88322111831     
jan 20051715936167       239421        5013741       
out 2004115593716942      2912633        3996331      
jul 200482362815631      1910831        3765311      
abr 20045927181251       14431         186211       
jan 200431159421       843          16741        
out 200330201593       1542          1752         
jul 20033224171161       1811621        2210721       
abr 2003                                    
jan 20031                                   

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
131,472100.0%1,050,799100.0%
310,10832.1%1,018,99697.0%
104,74315.1%988,70094.1%
321,7735.6%938,65189.3%
1006742.1%878,81483.6%
3162470.8%804,93176.6%
10001030.3%728,10269.3%
3162400.1%616,66058.7%
10000150.0%466,74744.4%
3162340.0%273,65226.0%

 

50 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
KalkiUC1 091,28823939,52068ago 11, 20035620998---
BD2412UC2 076,61321314,27692set 01, 200548681,5202--
UDScottUC3 065,69059216,339580jul 20, 200549111,0944--
NingaubleUC5 028,0624416,38434jul 27, 2008380855---
Risto hot sirUC6+124,9561,5541,93570mar 17, 2017653671--
DanielTomUC8 018,662264,9524set 07, 20122305285---
Peter1cUC9 018,5304472,34152ago 28, 2009341195720--
MiszatomicUC10 015,813233,1885jun 14, 2013202537---
WikiLubberUC13 012,8421781,17473abr 28, 200935331---
SpannerjamUC14 011,514134,906-dez 02, 2011258594---
CensoredScribeUC16 09,652171,53013abr 18, 20151352903--
TreybienUC18 09,030604-mai 25, 2013204554---
ELAproUC20 08,332119472-nov 09, 20045164234---
Rupert loupUC21 08,211131,3401jan 12, 201321782601--
FotoDutchUC22+18,161952726mai 31, 2014167492---
Y-S.KoUC28 05,03423352-set 25, 201415577621--
GreenMeansGoUC29 04,896541,77325set 17, 20151200191--
EaglestormUC31 04,5533550-dez 16, 2006439713---
AtcoviUC32 04,49911,323-dez 29, 2013182768---
CommonsDelinkerUC35 04,1504294210fev 12, 20074339----
P3Y229UC39 03,518153-abr 25, 201224402---
SpinozianoUC41+13,09859205-dez 29, 201029234509--
SuperJewUC45 02,832203344ago 14, 200837905---
AC9016UC47+32,6421881255mar 19, 2016101622---
Markjoseph125UC50-12,51525121-mar 30, 20074293107---
NickrjUC52 02,36038-jun 17, 2007421427---
AdamDeanHallUC57+12,1382773-set 16, 20083757486--
BatGoddessUC58-12,13211-dez 02, 200836804---
CrouchbkUC60+12,026472-jan 08, 200936437---
BritannicusUC61+52,025177581jun 07, 20064589531--
JackBotUC64-11,9452124-ago 25, 20103049----
AlexandervonweimannUC68 01,804439-jan 23, 201514374---
Christian M. (2016)UC71 01,603201-nov 18, 2016772----
OoznozUC72+31,58459794ago 27, 2015122161--
DavidESpeedUC78+21,4654812-mai 25, 201513158---
JessRek6UC79+101,4602122-ago 22, 2018130406--
SamuraiMasterUC82+11,4166337-abr 09, 2007428310---
GilldragonUC84-21,364329-nov 29, 201511271,1532--
Bszabo15UC90 01,2581746-abr 03, 20141732621--
Om777omUC92+921,21476110874out 01, 2018904630--
HenryGarden1000UC96+41,05630--out 03, 20151184----
Cwf97UC97-11,0541493-fev 27, 2016103732---
Finister2UC107-194945553jun 27, 201223773---
11614soupUC108-19461823-jul 31, 2010307411---
Rubbish computerUC118+218081632115ago 22, 20151226----
TegelUC127+17073277-mar 17, 20112845----
ChongkianUC131+2694221596abr 13, 20132087974--
Esme ShepherdUC137-26631--jun 22, 20169218---
StarWarsFanBoyUC138-26593769-out 02, 200933761---
Yoshi876UC149-161992-fev 20, 20151409----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Illegitimate BarristerUC440,061jun 25, 20122379nov 24, 201836
MddUC723,542set 07, 20074132jun 27, 2018186
AllixpeekeUC1114,245jan 09, 20141816jul 26, 2018157
InvisibleSunUC1213,508set 21, 20054848abr 11, 20103185
RogDelUC1511,421mar 18, 20093574dez 26, 20131830
AnankeBotUC179,291abr 05, 20083921set 16, 20131931
DexbotUC198,722abr 08, 20141727jan 18, 20161077
ZarbonUC238,159fev 27, 20074324out 30, 201861
JeffqUC247,914abr 19, 20045368set 08, 2017478
MosheZadkaUC256,317abr 11, 20055011jun 11, 20103124
LrdChaosUC265,723fev 22, 20064694jun 01, 20093499
OracleofottawaUC275,280set 13, 20093395abr 13, 20141722
BrownBotUC304,823mar 23, 20074300mar 24, 20074299
Ranger6342UC334,447out 27, 2016794nov 30, 2017395
CirtUC344,403nov 21, 20083691abr 24, 2016980
AntiquaryUC364,066set 17, 20064487set 24, 20093384
NvvcharUC373,783nov 18, 20131868jan 29, 20151431
OmnipaedistaUC383,778jul 13, 20093457out 13, 201878
SketchmooseUC403,171out 16, 20083727abr 19, 2018255
CollingwoodUC423,053nov 02, 20112615fev 01, 20132158

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 868.892 edições foram feitas por usuários anônimos, de um total de 1924.711 edições ( 45e %)
  


4 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
ChtitBotUC13,846fev 24, 20074327fev 06, 20112884--
DinybotUC2658mar 24, 20074299dez 17, 20074031--
AvicBotUC3346ago 11, 20112698set 07, 20112671--
EleferenBotUC4170fev 12, 20103243mar 14, 20103213--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
dez 201859 k9,9 k8,5 k11031,2 k1067,1 k       1
nov 201859 k9,8 k8,5 k11031,2 k1067,0 k       1
out 201859 k9,8 k8,5 k11031,2 k1066,9 k       1
set 201859 k9,8 k8,4 k11031,2 k1066,8 k       1
ago 201858 k9,7 k8,4 k11001,2 k1066,7 k       1
jul 201858 k9,7 k8,4 k11001,2 k1066,4 k       1
jun 201858 k9,7 k8,3 k11001,2 k1066,2 k       1
mai 201857 k9,6 k8,3 k11001,2 k1066,1 k       1
abr 201857 k9,6 k8,2 k11001,2 k1066,0 k       1
mar 201857 k9,6 k8,1 k11001,2 k1065,3 k       1
fev 201856 k9,6 k8,1 k11001,2 k1065,1 k       1
jan 201856 k9,5 k8,0 k11001,2 k1065,0 k       1
dez 201755 k9,5 k8,0 k11001,2 k1064,8 k       1
nov 201755 k9,5 k8,0 k11001,2 k1064,6 k       1
out 201755 k9,5 k7,9 k11001,2 k1064,5 k       1
set 201755 k9,4 k7,9 k11001,2 k1064,5 k       1
ago 201754 k9,4 k7,9 k11001,2 k1064,5 k       1
jul 201754 k9,4 k7,8 k11001,2 k1064,4 k       1
jun 201754 k9,3 k7,8 k11001,2 k1064,4 k       1
mai 201754 k9,3 k7,8 k11001,1 k1064,3 k       1
abr 201753 k9,3 k7,7 k11001,1 k1064,3 k       1
mar 201753 k9,3 k7,7 k11001,1 k1064,3 k       1
fev 201753 k9,2 k7,6 k11001,1 k1064,2 k       1
jan 201753 k9,2 k7,6 k11001,1 k1064,2 k       1
dez 201652 k9,2 k7,6 k11001,1 k1064,2 k       1
nov 201652 k9,2 k7,5 k11001,1 k1064,1 k       1
out 201652 k9,1 k7,5 k11001,1 k1064,1 k       1
set 201652 k9,1 k7,5 k11001,1 k1064,0 k       1
ago 201651 k9,1 k7,4 k11001,1 k1063,9 k       1
jul 201650 k9,1 k7,4 k11001,1 k1063,9 k       1
jun 201649 k9,1 k7,3 k11001,1 k1063,8 k       1
mai 201649 k9,0 k7,3 k11001,1 k1063,8 k       1
abr 201649 k9,0 k7,3 k11001,1 k1063,7 k       1
mar 201649 k9,0 k7,2 k11001,1 k1063,7 k       1
fev 201648 k9,0 k7,2 k11001,1 k1063,6 k       1
jan 201648 k8,9 k7,2 k11001,1 k1063,6 k       1
dez 201547 k8,9 k7,1 k11001,1 k1063,5 k       1
nov 201547 k8,9 k7,1 k11001,1 k1063,4 k       1
out 201546 k8,8 k7,1 k11001,1 k1063,3 k       1
set 201546 k8,8 k7,0 k11001,0 k1063,2 k       1
ago 201545 k8,8 k7,0 k11001,0 k1062,7 k       1
jul 201544 k8,7 k6,9 k11001,0 k1052,6 k       1
jun 201544 k8,7 k6,9 k11001,0 k1052,5 k       1
mai 201543 k8,7 k6,9 k11001,0 k1052,5 k       1
abr 201543 k8,6 k6,8 k11001,0 k1052,4 k       1
mar 201542 k8,6 k6,8 k11001,0 k1052,3 k       1
fev 201542 k8,6 k6,7 k11001,0 k1052,3 k       1
jan 201541 k8,5 k6,7 k11001,0 k1052,2 k       1
dez 201441 k8,4 k6,7 k11001,0 k1052,2 k       1
nov 201440 k8,3 k6,6 k11001,0 k1052,1 k       1
out 201440 k8,3 k6,6 k11001,0 k1052,1 k       1
set 201440 k8,3 k6,6 k11001,0 k1052,1 k       1
ago 201439 k8,2 k6,5 k11001,0 k1052,1 k       1
jul 201439 k8,2 k6,5 k11009961052,0 k       1
jun 201438 k8,2 k6,4 k11009901052,0 k       1
mai 201438 k8,1 k6,4 k11009761052,0 k       1
abr 201438 k8,1 k6,4 k11009731052,0 k       1
mar 201437 k8,1 k6,3 k11009681042,0 k       1
fev 201437 k8,0 k6,3 k11009641041,9 k       1
jan 201437 k8,0 k6,3 k11009621041,9 k       1
dez 201336 k7,9 k6,2 k11009501041,8 k       1
nov 201336 k7,9 k6,2 k11009491041,8 k       1
out 201336 k7,9 k6,1 k11009451041,8 k       1
set 201336 k7,8 k6,1 k11009421041,8 k       1
ago 201335 k7,8 k6,1 k11009341041,8 k       1
jul 201335 k7,7 k6,0 k11009321041,8 k       1
jun 201335 k7,7 k6,0 k1989301041,7 k       1
mai 201335 k7,7 k5,9 k1989261041,7 k       1
abr 201335 k7,6 k5,9 k1969261041,7 k       1
mar 201334 k7,6 k5,9 k1969111041,7 k       1
fev 201333 k7,5 k5,8 k1959111041,7 k       1
jan 201333 k7,5 k5,8 k1959091041,7 k       1
dez 201233 k7,5 k5,7 k1958921041,7 k       1
nov 201233 k7,4 k5,7 k1958921041,7 k       1
out 201233 k7,4 k5,7 k1958921041,7 k       1
set 201232 k7,4 k5,6 k1958911041,6 k       1
ago 201232 k7,3 k5,6 k1958871041,6 k       1
jul 201232 k7,3 k5,5 k1958871041,6 k       1
jun 201232 k7,3 k5,5 k1958851041,6 k       1
mai 201232 k7,2 k5,5 k1958641041,6 k       1
abr 201232 k7,2 k5,4 k1958621041,6 k       1
mar 201232 k7,1 k5,4 k1958601041,6 k       1
fev 201232 k7,1 k5,3 k1958561031,5 k       1
jan 201231 k7,0 k5,3 k1948531031,5 k       1
dez 201131 k7,0 k5,2 k1948501031,5 k       1
nov 201131 k6,9 k5,2 k1948391031,5 k       1
out 201131 k6,9 k5,1 k1948341031,5 k       1
set 201130 k6,8 k5,1 k1948331031,5 k       1
ago 201130 k6,7 k5,0 k1948331031,4 k       1
jul 201130 k6,7 k5,0 k1948321031,4 k       1
jun 201130 k6,6 k5,0 k1948271031,4 k       1
mai 201130 k6,6 k4,9 k1948191031,4 k       1
abr 201130 k6,6 k4,9 k1948161031,4 k       1
mar 201129 k6,5 k4,8 k1948151031,4 k       1
fev 201129 k6,5 k4,8 k1948121031,4 k       1
jan 201129 k6,4 k4,8 k1948121031,4 k       1
dez 201029 k6,4 k4,7 k1948091031,4 k       1
nov 201028 k6,4 k4,7 k1948091031,4 k       1
out 201028 k6,3 k4,6 k1947951031,3 k       1
set 201028 k6,2 k4,2 k1927861031,3 k       1
ago 201028 k6,1 k4,1 k1927821031,3 k       1
jul 201027 k6,0 k4,1 k1927761031,3 k       1
jun 201027 k6,0 k4,0 k1927751031,3 k       1
mai 201027 k5,9 k4,0 k1917721031,3 k       1
abr 201027 k5,9 k4,0 k1917701031,3 k       1
mar 201027 k5,8 k3,9 k1917701031,3 k       1
fev 201027 k5,8 k3,9 k1917641031,3 k       1
jan 201026 k5,7 k3,8 k1917491031,3 k       1
dez 200926 k5,6 k3,8 k1917471031,2 k       1
nov 200926 k5,6 k3,8 k1917351031,2 k       1
out 200926 k5,5 k3,7 k1917291031,2 k       1
set 200926 k5,5 k3,7 k1907211031,2 k       1
ago 200925 k5,4 k3,6 k1907151031,2 k       1
jul 200925 k5,3 k3,6 k1907071031,2 k       1
jun 200925 k5,2 k3,5 k1867061031,2 k       1
mai 200925 k5,1 k3,5 k1867061031,2 k       1
abr 200925 k5,0 k3,4 k1847041031,2 k       1
mar 200924 k4,9 k3,4 k1846921031,2 k       1
fev 200924 k4,8 k3,3 k1836451031,1 k       1
jan 200924 k4,7 k3,3 k1836411031,1 k       1
dez 200824 k4,7 k3,2 k1806241031,1 k       1
nov 200823 k4,6 k3,1 k1666141031,1 k       1
out 200823 k4,5 k3,0 k1556051021,0 k       1
set 200823 k4,4 k2,9 k1545961021,0 k       1
ago 200823 k4,3 k2,8 k1535891021,0 k       1
jul 200822 k4,3 k2,7 k1525831021,0 k       1
jun 200822 k4,2 k2,7 k1525741021,0 k       1
mai 200822 k4,0 k2,6 k152569102994       1
abr 200821 k3,8 k2,6 k152564102987       1
mar 200821 k3,8 k2,5 k152556102972       1
fev 200821 k3,7 k2,5 k151548102965       1
jan 200818 k3,6 k2,4 k150540102957       1
dez 200717 k3,5 k2,4 k150530102940       1
nov 200717 k3,4 k2,3 k149524102921       1
out 200716 k3,4 k2,2 k149516102903       1
set 200716 k3,3 k2,2 k149509102895       1
ago 200716 k3,2 k2,1 k148506102883       1
jul 200715 k3,1 k2,0 k148496102844       1
jun 200715 k2,9 k1,9 k143471102813       1
mai 200715 k2,8 k1,8 k143460102779       1
abr 200712 k2,7 k1,7 k142444102754       1
mar 200712 k2,6 k1,6 k137430102733       1
fev 200711 k2,4 k1,6 k136412102672       1
jan 200711 k2,4 k1,4 k132383102627       1
dez 200610 k2,2 k1,4 k132370102606       1
nov 200610,0 k2,1 k1,3 k132359102567       1
out 20069,6 k2,0 k1,2 k132345102549       1
set 20069,4 k1,9 k1,1 k132334102537       1
ago 20069,1 k1,8 k964132303102524       1
jul 20068,8 k1,7 k893132282102491       1
jun 20068,4 k1,6 k821132277102485       1
mai 20067,7 k1,5 k749132263102408       1
abr 20067,5 k1,3 k698131255102400       1
mar 20067,1 k1,2 k661130225102387       1
fev 20066,8 k1,1 k617129194102374       1
jan 20066,6 k1,1 k583127180102366       1
dez 20056,2 k989507127149102350       1
nov 20055,9 k915484127143102339       1
out 20055,6 k8592241271289324       1
set 20055,2 k8151371271139318       1
ago 20054,9 k7561291271089313       1
jul 20054,6 k693109127957297       1
jun 20054,2 k610102127857226       1
mai 20053,9 k56597124797175       1
abr 20053,7 k51690124707168       1
mar 20053,3 k46073124436127       1
fev 20053,1 k4227012440698       1
jan 20052,9 k3836912439698       1
dez 20042,7 k3576612433696       1
nov 20042,5 k3155712117457       1
out 20042,3 k2665512116449       1
set 20042,0 k2405312115428       1
ago 20041,8 k20351 217126        
jul 20041,6 k17451 216121        
jun 20041,4 k14748 215116        
mai 20041,2 k12946 215115        
abr 20041,1 k10743 221         
mar 20049639942 221         
fev 20048398742 221         
jan 20047457640 221         
dez 20036467038 221         
nov 20036056236   1         
out 20035255736   1         
set 20034505135   1         
ago 20033304034   1         
jul 20031641812             
jun 2003  
mai 2003  
abr 2003  
mar 2003  
fev 2003  
jan 2003  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2003: 1 1 Russell Crowe

jul 2003: 1 22 Main Page , 2 13 List of people by name , 3 7 Winston Churchill , 4 6 Anonymous , 5 5 Albert Einstein , 6 4 Last words , 7 4 List of literary works , 8 4 Animal Farm , 9 4 Ambrose Bierce , 10 3 Science , 11 3 William Shakespeare , 12 3 Animals , 13 3 Arianna Huffington , 14 3 List of misquotations , 15 3 Les Misérables , 16 3 George Carlin , 17 3 John N. Mitchell , 18 3 Stanisław Lem , 19 3 Omar Bradley , 20 3 Will Rogers , 21 3 The Devil's Dictionary , 22 3 Bill Gates , 23 3 Dwight D. Eisenhower , 24 3 Aristotle , 25 3 Douglas Adams

ago 2003: 1 16 Main Page , 2 10 List of people by name , 3 7 Last words , 4 6 William Shakespeare , 5 5 George W. Bush , 6 5 Mark Twain , 7 5 Anonymous , 8 5 Albert Einstein , 9 4 List of misquotations , 10 4 Les Misérables , 11 4 List of proverbs , 12 4 Julius Caesar , 13 4 Zen proverbs , 14 3 Abraham Lincoln , 15 3 Art , 16 3 Dr. Seuss , 17 3 George Orwell , 18 3 Victor Hugo , 19 3 Alfred, Lord Tennyson , 20 3 Terry Pratchett , 21 3 Linus Torvalds , 22 3 W. H. Auden , 23 3 Pablo Picasso , 24 3 Benjamin Franklin , 25 3 Nineteen-Eighty Four

set 2003: 1 13 List of people by name , 2 10 Main Page , 3 5 Larry Wall , 4 4 Life , 5 4 Linus Torvalds , 6 4 Computers , 7 4 Last words , 8 4 List of misquotations , 9 4 Anonymous , 10 3 Religion , 11 3 Death , 12 3 Art , 13 3 Steven Wright , 14 3 Soichiro Honda , 15 3 Miguel de Unamuno , 16 3 Miguel de Cervantes , 17 3 Henry Wadsworth Longfellow , 18 3 John F. Kennedy , 19 3 Horace , 20 3 Dorothy Parker , 21 3 Douglas Hofstadter , 22 3 Pablo Picasso , 23 3 Mark Twain , 24 3 List of proverbs , 25 3 List of literary works

out 2003: 1 10 List of people by name , 2 6 Main Page , 3 4 List of films , 4 3 Religion , 5 3 Thomas Alva Edison , 6 2 Silence , 7 2 Love , 8 2 Inferno (Dante) , 9 2 The Matrix Reloaded , 10 2 André Breton , 11 2 Groucho Marx , 12 2 Monty Python's Life of Brian , 13 2 Bob Dylan , 14 2 The Return of the King , 15 1 Ernesto Sábato

nov 2003: 1 10 List of people by name , 2 5 Main Page , 3 3 Stranger in a Strange Land , 4 3 The Silmarillion , 5 3 The Matrix (film) , 6 3 List of films , 7 3 Nineteen Eighty-Four , 8 3 List of literary works , 9 2 Epitaphs , 10 2 Frank Herbert , 11 2 Dune , 12 2 Harvey (film) , 13 2 O. Henry , 14 2 Spider Robinson , 15 2 They Might Be Giants (film) , 16 1 Love

dez 2003: 1 5 Main Page , 2 3 List of films , 3 2 Thomas Jefferson , 4 2 Fight Club (film) , 5 2 Ludwig Wittgenstein , 6 2 John F. Kennedy , 7 1 William Shakespeare

jan 2004: 1 7 List of people by name , 2 6 Main Page , 3 5 List of literary works , 4 3 List of films , 5 2 Religion , 6 2 Friendship , 7 2 Thomas Jefferson , 8 2 Madonna , 9 2 William Thomson , 10 2 Responsibility , 11 2 Mahatma Gandhi , 12 2 Ronald Reagan , 13 2 Linus Torvalds , 14 2 Arthur C. Clarke , 15 2 Computers

fev 2004: 1 9 List of people by name , 2 3 The Matrix (film) , 3 3 Computers , 4 3 Main Page , 5 2 Stupidity , 6 2 Love , 7 2 Abraham Lincoln , 8 2 Muhammad Saeed al-Sahhaf , 9 2 Alexander Mackenzie , 10 2 George Santayana , 11 2 Bill Watterson , 12 1 Jeff Koons

mar 2004: 1 13 List of people by name , 2 4 Main Page , 3 3 Casablanca (film) , 4 2 God , 5 2 Willa Cather , 6 2 Caroline Dhavernas , 7 2 Wonderfalls , 8 2 Generation X: Tales For An Accelerated Culture , 9 2 Rainer Maria Rilke , 10 2 Ayn Rand , 11 2 Georg Wilhelm Friedrich Hegel , 12 2 Aldous Huxley , 13 2 The Lord of the Rings (movies) , 14 2 List of films , 15 2 Mahatma Gandhi , 16 2 Thomas Paine , 17 2 George W. Bush , 18 1 Religion

abr 2004: 1 15 List of people by name , 2 9 Main Page , 3 5 Last words , 4 4 The Simpsons , 5 4 List of films , 6 4 Friedrich Nietzsche , 7 3 Religion , 8 3 Wonderfalls , 9 3 Babylon 5 , 10 3 List of television shows , 11 3 Adolf Hitler , 12 2 Education , 13 2 Franz Schubert , 14 2 Indian proverbs , 15 2 Bette Davis , 16 2 Theodore Dreiser , 17 2 Richard Brautigan , 18 2 Anne Frank , 19 2 Swedish proverbs , 20 2 William James , 21 2 Futurama , 22 1 Martha Washington

mai 2004: 1 12 List of people by name , 2 5 The Simpsons , 3 4 List of films , 4 4 Adolf Hitler , 5 4 Anonymous , 6 3 Politics , 7 3 Monty Python and the Holy Grail , 8 3 Walt Kelly , 9 3 Family Guy , 10 3 Paul Simon , 11 3 Ali , 12 3 Chanakya , 13 3 Indian proverbs , 14 3 Ayn Rand , 15 3 List of television shows , 16 3 Terry Pratchett , 17 3 Linus Torvalds , 18 3 Salvador Dalí , 19 3 Main Page , 20 2 War , 21 2 Love , 22 2 Piet Hein , 23 2 Blackadder , 24 2 John Forbes Nash, Jr. , 25 2 Firefly (TV series)

jun 2004: 1 14 List of people by name , 2 5 List of literary works , 3 5 Main Page , 4 4 War , 5 4 Michael Moore , 6 4 Ronald Reagan , 7 3 Cult , 8 3 List of television shows , 9 3 Mark Twain , 10 3 Dwight D. Eisenhower , 11 2 Religion , 12 2 Love , 13 2 Epitaphs , 14 2 David Deutsch , 15 2 Charles Spurgeon , 16 2 Les Tontons flingueurs , 17 2 James Joyce , 18 2 Ray Charles , 19 2 Tuck Everlasting (2002 film) , 20 2 Firefly (TV series) , 21 2 The Simpsons , 22 2 Fight Club (film) , 23 2 Carl Sagan , 24 2 List of films , 25 2 Neil Armstrong

jul 2004: 1 9 List of people by name , 2 9 Main Page , 3 6 Religion , 4 5 Robert A. Heinlein , 5 4 Carl Sagan , 6 4 Bertrand Russell , 7 3 Music , 8 3 Michael Moore , 9 3 Steve Jobs , 10 3 Kurt Vonnegut , 11 3 Monty Python's Flying Circus , 12 3 William S. Burroughs , 13 3 Richard Feynman , 14 3 Carl Jung , 15 3 John F. Kennedy , 16 3 Linus Torvalds , 17 3 Emo Philips , 18 3 Bill Gates , 19 2 War , 20 2 Death , 21 2 Pope Sixtus V , 22 2 Thomas Jefferson , 23 2 Chauncey Depew , 24 2 Kurt Donald Cobain , 25 2 Leoš Janáček

ago 2004: 1 13 List of people by name , 2 6 List of literary works , 3 5 Main Page , 4 4 Plato , 5 4 Futurama , 6 4 The Simpsons , 7 4 Franklin D. Roosevelt , 8 4 Anonymous , 9 4 Oscar Wilde , 10 3 South Park , 11 3 Buffy the Vampire Slayer , 12 3 Metallica , 13 3 Groucho Marx , 14 3 Friedrich Nietzsche , 15 3 Adolf Hitler , 16 3 Voltaire , 17 2 Acting , 18 2 The Bible , 19 2 Aneurin Bevan , 20 2 Marshall McLuhan , 21 2 Julia Child , 22 2 Washington Irving , 23 2 Shimon Peres , 24 2 Tony Benn , 25 2 Tenzin Gyatso, 14th Dalai Lama

set 2004: 1 20 List of people by name , 2 11 Main Page , 3 9 George W. Bush , 4 6 List of television shows , 5 5 The Simpsons , 6 5 List of films , 7 5 Anonymous , 8 4 Religion , 9 4 Star Wars , 10 4 Mark Twain , 11 4 Douglas Adams , 12 3 War , 13 3 Thomas Jefferson , 14 3 Louis Mountbatten, 1st Earl Mountbatten of Burma , 15 3 George Marshall , 16 3 Magnolia (film) , 17 3 SpongeBob SquarePants , 18 3 Prem Rawat , 19 3 Ferris Bueller's Day Off , 20 3 H. G. Wells , 21 3 Will Rogers , 22 3 List of literary works , 23 2 Music , 24 2 Politics , 25 2 Money

out 2004: 1 12 Main Page , 2 11 List of people by name , 3 8 List of films , 4 8 List of literary works , 5 6 Blackadder , 6 5 Prem Rawat , 7 5 Computers , 8 5 Douglas Adams , 9 4 Love , 10 4 Beauty , 11 4 List of television shows , 12 4 Futurama , 13 4 The Simpsons , 14 4 Oscar Wilde , 15 3 William Shakespeare , 16 3 Techniques of Knowledge , 17 3 Atlas Shrugged , 18 3 Duke Nukem , 19 3 Marie Curie , 20 3 Alexander (film) , 21 3 Kinsey (film) , 22 3 Firefly (TV series) , 23 3 Dick Cheney , 24 3 Sherlock Holmes , 25 3 Abortion

nov 2004: 1 11 List of people by name , 2 10 List of films , 3 8 George W. Bush , 4 8 Main Page , 5 6 The Simpsons , 6 6 Albert Einstein , 7 5 Politics , 8 4 Indiana Jones , 9 4 Van Helsing , 10 4 List of proverbs , 11 3 War , 12 3 Love , 13 3 Epitaphs , 14 3 The Twilight Zone (1959 TV series) , 15 3 The Incredibles , 16 3 Michael Badnarik , 17 3 Apocalypse Now , 18 3 American History X , 19 3 Gracie Allen , 20 3 Prem Rawat , 21 3 George Burns , 22 3 Erwin Rommel , 23 3 Babylon 5 , 24 3 Arthur Conan Doyle , 25 3 Doctor Who

dez 2004: 1 17 List of people by name , 2 9 List of films , 3 8 Futurama , 4 7 List of television shows , 5 7 Main Page , 6 5 The Simpsons , 7 5 George W. Bush , 8 5 Last words , 9 5 Adolf Hitler , 10 5 Latin proverbs , 11 4 War , 12 4 Lewis Black , 13 4 Final Fantasy , 14 4 Aqua Teen Hunger Force , 15 4 Family Guy , 16 4 John Kerry , 17 4 Donald Rumsfeld , 18 4 Dune , 19 4 Monty Python's Life of Brian , 20 4 Advertising slogans , 21 4 Mahatma Gandhi , 22 4 Chinese proverbs , 23 4 List of literary works , 24 3 Religion , 25 3 Peace

jan 2005: 1 9 List of people by name , 2 6 List of films , 3 5 Main Page , 4 4 Thomas Jefferson , 5 4 List of films/requested , 6 4 George W. Bush , 7 4 Douglas Adams , 8 3 The Simpsons , 9 3 Noam Chomsky , 10 3 Advertising slogans , 11 3 English proverbs , 12 3 Archimedes , 13 3 Latin proverbs , 14 2 Music , 15 2 Politics , 16 2 Love , 17 2 Abraham Lincoln , 18 2 Enrico Fermi , 19 2 Creationism , 20 2 Gloria Estefan , 21 2 Paracelsus , 22 2 John Dewey , 23 2 Dead Poets Society , 24 2 Batman , 25 2 The 13th Warrior

fev 2005: 1 12 List of people by name , 2 7 Main Page , 3 6 Monty Python and the Holy Grail , 4 5 The Tick , 5 5 List of television shows , 6 5 Dwight D. Eisenhower , 7 4 Final Fantasy , 8 4 Ludwig van Beethoven , 9 4 List of films , 10 4 H. G. Wells , 11 4 James A. Michener , 12 4 Anonymous , 13 3 Truth , 14 3 John D. Carmack , 15 3 Sam Walton , 16 3 Arthur Miller , 17 3 Lawrence Kudlow , 18 3 Aldo Leopold , 19 3 Mighty Morphin Power Rangers , 20 3 Stargate SG-1 , 21 3 Grosse Pointe Blank (1997) , 22 3 Buffy the Vampire Slayer , 23 3 The Simpsons , 24 3 Groucho Marx , 25 3 Margaret Cho

mar 2005: 1 14 List of people by name , 2 6 List of television shows , 3 6 Albert Einstein , 4 5 Star Wars , 5 5 List of films , 6 5 Latin proverbs , 7 4 Angel (1999 TV series) , 8 4 Russell Crowe , 9 4 Black Hawk Down , 10 4 Atheism , 11 4 Douglas Adams , 12 3 God , 13 3 Mary Wollstonecraft , 14 3 Sappho , 15 3 Keith Richards , 16 3 Saint Patrick , 17 3 Tim Moore (writer) , 18 3 David Baddiel , 19 3 Kiefer Sutherland , 20 3 Anthony Robbins , 21 3 Radical Dreamers , 22 3 The Magic School Bus , 23 3 The Incredibles , 24 3 Jurassic Park (film) , 25 3 Alexander Graham Bell

abr 2005: 1 21 List of people by name , 2 12 Mitch Hedberg , 3 9 Pope John Paul II , 4 8 The Simpsons , 5 7 List of television shows , 6 7 List of films , 7 6 Anonymous , 8 6 Main Page , 9 5 Sin City (film) , 10 5 Veronica Mars , 11 5 English proverbs , 12 5 List of literary works , 13 5 Douglas Adams , 14 5 Winston Churchill , 15 4 Dogma (film) , 16 4 Family Guy , 17 4 The Wizard of Oz (1939 film) , 18 4 Star Wars , 19 4 Advertising slogans , 20 4 René Descartes , 21 4 Karl Marx , 22 4 Woody Allen , 23 4 Bertrand Russell , 24 4 Albert Einstein , 25 3 Money

mai 2005: 1 13 Star Wars , 2 11 List of people by name , 3 6 Palpatine , 4 6 Mitch Hedberg , 5 6 List of television shows , 6 6 List of films , 7 6 Computers , 8 5 Darth Vader , 9 5 Margaret Thatcher , 10 5 The Simpsons , 11 5 Last words , 12 5 Bill Watterson , 13 4 Epitaphs , 14 4 Jesus , 15 4 Angel (1999 TV series) , 16 4 Star Trek , 17 4 Bill Gates , 18 3 Religion , 19 3 Mothers , 20 3 Politics , 21 3 School of Rock , 22 3 NewsRadio , 23 3 Guinevere Jones , 24 3 Georgia O'Keeffe , 25 3 David Letterman

jun 2005: 1 14 List of films , 2 12 List of people by name , 3 11 List of television shows , 4 8 Star Wars , 5 8 Winston Churchill , 6 7 Batman Begins , 7 7 Mitch Hedberg , 8 7 Socrates , 9 7 Anonymous , 10 6 Darth Vader , 11 6 Plato , 12 6 Ambrose Bierce , 13 5 Religion , 14 5 John Ziman , 15 5 Pyotr Ilyich Tchaikovsky , 16 5 W. Mark Felt , 17 5 Doctor Who , 18 5 Last words , 19 5 Mark Twain , 20 5 Bertrand Russell , 21 4 Politics , 22 4 The Order of the Stick , 23 4 Toy Story , 24 4 The Fifth Element , 25 4 John Derbyshire

jul 2005: 1 9 List of people by name , 2 8 George W. Bush , 3 7 Harry Potter (series) , 4 7 The Simpsons , 5 7 Star Wars , 6 7 List of films , 7 6 Mitch Hedberg , 8 6 Monty Python's Flying Circus , 9 6 Carl Sagan , 10 6 Mark Twain , 11 5 Love , 12 5 London , 13 5 Firefly (TV series) , 14 5 Mystery Science Theater 3000 , 15 5 Abortion , 16 5 Star Trek , 17 5 English proverbs , 18 5 Douglas Adams , 19 4 Religion , 20 4 Jesus , 21 4 Wedding Crashers , 22 4 The Good, the Bad and the Ugly , 23 4 Jacques-Yves Cousteau , 24 4 Kate Clinton , 25 4 Million Dollar Baby

ago 2005: 1 17 List of people by name , 2 8 Family Guy , 3 8 List of films , 4 6 Creationism , 5 6 Abortion , 6 6 George Bernard Shaw , 7 5 God , 8 5 American Psycho (film) , 9 5 The Hitchhiker's Guide to the Galaxy , 10 5 Buffy the Vampire Slayer , 11 5 List of television shows , 12 5 The Simpsons , 13 5 Star Trek , 14 5 Anonymous , 15 5 Winston Churchill , 16 4 Religion , 17 4 Politics , 18 4 Love , 19 4 Epitaphs , 20 4 Democracy , 21 4 Courage , 22 4 Jacques Chirac , 23 4 Anti-Polonism , 24 4 Fakhri al-Qaisi , 25 4 Swingers (1996 film)

set 2005: 1 11 List of films , 2 10 List of people by name , 3 6 Family Guy , 4 6 George W. Bush , 5 4 The Royal Tenenbaums , 6 4 Pure Pwnage , 7 4 James Hudson Taylor , 8 4 Showgirls , 9 4 Angel (1999 TV series) , 10 4 Advertising slogans , 11 3 Religion , 12 3 Intelligence , 13 3 The Bible , 14 3 Andrew S. Tanenbaum , 15 3 Edward Heath , 16 3 The Railway Series , 17 3 Henry VIII of England , 18 3 Max Weber , 19 3 Earth , 20 3 Chief Seattle , 21 3 Adam and Eve , 22 3 Golden Rule , 23 3 Diogenes Small , 24 3 The Godfather: Part III , 25 3 Troy (film)

out 2005: 1 12 List of people by name , 2 7 Star Wars , 3 7 List of films , 4 7 Albert Einstein , 5 6 Family Guy , 6 5 Buffy the Vampire Slayer , 7 5 List of television shows , 8 5 English proverbs , 9 5 George W. Bush , 10 4 Politics , 11 4 Love , 12 4 God , 13 4 Octavio Paz , 14 4 Lost (TV series) , 15 4 Steve Jobs , 16 4 Che Guevara , 17 4 Benjamin Franklin , 18 4 Mark Twain , 19 3 Science , 20 3 Suicide , 21 3 Life , 22 3 Michael Crichton , 23 3 Blade II , 24 3 Dave Matthews , 25 3 IPod

nov 2005: 1 8 List of films , 2 8 List of misquotations , 3 7 The Simpsons , 4 7 Last words , 5 7 List of people by name , 6 6 George W. Bush , 7 5 Firefly (TV series) , 8 5 List of television shows , 9 5 English proverbs , 10 4 Colin Wilson , 11 4 Extras (TV series) , 12 4 The Office (U.S. TV series) , 13 4 Veronica Mars , 14 4 Final Fantasy , 15 4 Buffy the Vampire Slayer , 16 4 Abortion , 17 4 Advertising slogans , 18 4 Mahatma Gandhi , 19 4 Kate Bush , 20 4 Adolf Hitler , 21 4 Douglas Adams , 22 4 Anonymous , 23 4 Latin proverbs , 24 3 Music , 25 3 Jesus

dez 2005: 1 8 Anarchism , 2 8 Star Wars , 3 8 List of films , 4 8 Mark Twain , 5 8 List of people by name , 6 7 The Simpsons , 7 7 Abortion , 8 6 List of television shows , 9 6 George W. Bush , 10 5 True Romance , 11 5 The 40-Year-Old Virgin , 12 5 Billie Joe Armstrong , 13 5 Mitch Hedberg , 14 5 Buffy the Vampire Slayer , 15 5 Advertising slogans , 16 4 Jesus , 17 4 Enya , 18 4 Dane Cook , 19 4 Ursula K. Le Guin , 20 4 Warcraft , 21 4 Robert Oppenheimer , 22 4 Family Guy , 23 4 The Lord of the Rings , 24 4 Last words , 25 4 George Carlin

jan 2006: 1 16 List of people by name , 2 8 List of television shows , 3 7 The Simpsons , 4 6 The Hitchhiker's Guide to the Galaxy , 5 6 Star Wars , 6 6 Mark Twain , 7 5 Nelson Mandela , 8 5 Mystery Science Theater 3000 , 9 5 Star Trek , 10 5 Advertising slogans , 11 5 Adolf Hitler , 12 5 Napoleon I of France , 13 4 Calvin Coolidge , 14 4 The Incredibles , 15 4 Stargate SG-1 , 16 4 Jimmy Wales , 17 4 Red vs. Blue , 18 4 South Park , 19 4 Steve Jobs , 20 4 Family Guy , 21 4 Muhammad , 22 4 List of films , 23 4 Joseph Addison , 24 4 Richard Dawkins , 25 4 Friedrich Nietzsche

fev 2006: 1 7 List of people by name , 2 6 Jack Thompson (attorney) , 3 6 Buffy the Vampire Slayer , 4 6 Abortion , 5 6 List of films , 6 5 Red vs. Blue , 7 5 List of television shows , 8 4 Guilt , 9 4 Anarchism , 10 4 Mitch Hedberg , 11 4 Mystery Science Theater 3000 , 12 4 Indian proverbs , 13 4 George W. Bush , 14 4 Last words , 15 4 Anonymous , 16 4 Winston Churchill , 17 3 Spring (season) , 18 3 Truth , 19 3 Weakness , 20 3 Abraham Lincoln , 21 3 Courage , 22 3 Winter , 23 3 The Rock (entertainer) , 24 3 Robert Graves , 25 3 The Aviator

mar 2006: 1 10 List of people by name , 2 8 George W. Bush , 3 6 Love , 4 6 The Grim Adventures of Billy & Mandy , 5 6 Star Wars , 6 6 List of films , 7 6 Last words , 8 5 The King of Fighters , 9 5 V for Vendetta (film) , 10 5 Jack Thompson (attorney) , 11 5 Mystery Science Theater 3000 , 12 5 Buffy the Vampire Slayer , 13 5 List of television shows , 14 5 Abortion , 15 5 Bill Gates , 16 4 Ward Cunningham , 17 4 Sitting Bull , 18 4 Michael Jackson , 19 4 Sonic the Hedgehog , 20 4 Gilmore Girls , 21 4 Firefly (TV series) , 22 4 Family Guy , 23 4 Mahatma Gandhi , 24 3 William Shakespeare , 25 3 Friendship

abr 2006: 1 17 List of people by name , 2 10 V for Vendetta (film) , 3 8 Anonymous , 4 7 Jimmy Wales , 5 7 Star Wars , 6 6 South Park , 7 6 Doctor Who , 8 6 Last words , 9 6 Albert Einstein , 10 5 Whose Line Is It Anyway? , 11 5 Thomas Jefferson , 12 5 Tony Almeida , 13 5 Veronica Mars , 14 5 Stargate SG-1 , 15 5 Buffy the Vampire Slayer , 16 5 List of films , 17 5 George W. Bush , 18 5 Douglas Adams , 19 4 Mick Jagger , 20 4 Crash (2004 film) , 21 4 Sonic the Hedgehog , 22 4 Atheism , 23 4 Pulp Fiction , 24 4 List of television shows , 25 4 Abortion

mai 2006: 1 11 List of people by name , 2 8 Grey's Anatomy , 3 8 George W. Bush , 4 7 The Simpsons , 5 7 Doctor Who , 6 7 List of films , 7 6 Red vs. Blue , 8 6 List of television shows , 9 6 Futurama , 10 6 Johann Wolfgang von Goethe , 11 6 Bill Gates , 12 6 Douglas Adams , 13 6 Anonymous , 14 6 Winston Churchill , 15 5 V for Vendetta (film) , 16 5 House (TV series) , 17 5 Mystery Science Theater 3000 , 18 5 The Princess Bride (film) , 19 5 Last words , 20 5 List of literary works , 21 5 Oscar Wilde , 22 5 Martin Luther King, Jr. , 23 4 Brigitte Bardot , 24 4 God , 25 4 Jesus

jun 2006: 1 11 List of people by name , 2 8 Futurama , 3 8 List of films , 4 8 George W. Bush , 5 7 House (TV series) , 6 7 The Simpsons , 7 7 Doctor Who , 8 6 Stargate Atlantis , 9 6 Mystery Science Theater 3000 , 10 6 Muhammad , 11 6 Anonymous , 12 5 Star Trek VI: The Undiscovered Country , 13 5 MythBusters , 14 5 A Clockwork Orange , 15 5 The Mighty Boosh (TV series) , 16 5 Robert A. Heinlein , 17 5 Buffy the Vampire Slayer , 18 5 The Matrix (film) , 19 4 Simplicity , 20 4 Star Wars: Episode III – Revenge of the Sith , 21 4 Katherine Harris , 22 4 The Last Temptation of Christ (film) , 23 4 Suikoden II , 24 4 Star Trek: The Original Series , 25 4 Top Gear

jul 2006: 1 18 List of films , 2 8 List of people by name , 3 7 Fictional last words , 4 7 Jimmy Wales , 5 6 Tenth Doctor , 6 6 List of television shows , 7 6 George W. Bush , 8 5 Superman Returns , 9 5 C. S. Lewis , 10 5 Bertrand Russell , 11 4 Religion , 12 4 William Shakespeare , 13 4 Love , 14 4 College football , 15 4 The Adventures of Chico and Guapo , 16 4 Thierry Henry , 17 4 Stargate Atlantis , 18 4 MythBusters , 19 4 Jesse Ventura , 20 4 Frida Kahlo , 21 4 Naruto , 22 4 Mitch Hedberg , 23 4 Pirates of the Caribbean: The Curse of the Black Pearl , 24 4 The Simpsons , 25 4 Titanic (1997 film)

ago 2006: 1 10 List of television shows , 2 10 List of films , 3 10 List of people by name , 4 9 Stargate SG-1 , 5 8 Talladega Nights: The Ballad of Ricky Bobby , 6 8 The Simpsons , 7 7 Mel Gibson , 8 7 Top Gear , 9 6 Fictional last words , 10 6 House (TV series) , 11 6 Mitch Hedberg , 12 6 Buffy the Vampire Slayer , 13 5 The Bible , 14 5 Snakes on a Plane , 15 5 Hannah Montana , 16 5 Gilmore Girls , 17 5 Mystery Science Theater 3000 , 18 5 Babylon 5 , 19 5 Futurama , 20 5 English proverbs , 21 5 Benjamin Franklin , 22 5 Douglas Adams , 23 5 Anonymous , 24 4 Abraham Lincoln , 25 4 The 4400

set 2006: 1 12 Steve Irwin , 2 8 Love , 3 8 Anonymous , 4 7 Stargate SG-1 , 5 7 List of television shows , 6 7 George W. Bush , 7 7 List of people by name , 8 6 List of films , 9 6 English proverbs , 10 6 Last words , 11 6 Adolf Hitler , 12 6 Mark Twain , 13 5 Betty Edwards , 14 5 Fictional last words , 15 5 Star Wars (film) , 16 5 Anarchism , 17 5 Grey's Anatomy , 18 5 House (TV series) , 19 5 Ann Richards , 20 5 Mystery Science Theater 3000 , 21 5 Buffy the Vampire Slayer , 22 5 Sex , 23 4 Politics , 24 4 Sidney Lanier , 25 4 Barbara Ehrenreich

out 2006: 1 11 George W. Bush , 2 7 List of films , 3 7 List of people by name , 4 7 Anonymous , 5 6 Fictional last words , 6 6 South Park , 7 6 List of television shows , 8 6 The Simpsons , 9 6 Albert Einstein , 10 5 Fire Emblem , 11 5 Metal Gear , 12 5 Futurama , 13 5 Benjamin Franklin , 14 5 Last words , 15 5 Bertrand Russell , 16 4 Solitude , 17 4 The Bible , 18 4 Thomas Jefferson , 19 4 John Pomfret , 20 4 Numb3rs , 21 4 Larry Bird , 22 4 John McKay , 23 4 The Thomas Crown Affair , 24 4 Bleach (manga) , 25 4 G. Edward Griffin

nov 2006: 1 17 List of people by name , 2 11 List of films , 3 9 House (TV series) , 4 9 Futurama , 5 9 Anonymous , 6 8 Metalocalypse , 7 8 South Park , 8 8 George W. Bush , 9 7 Buffy the Vampire Slayer , 10 7 English proverbs , 11 6 Love , 12 6 South Park/Season 10 , 13 6 MythBusters , 14 6 Atheism , 15 6 Friends (TV series) , 16 6 Fyodor Dostoyevsky , 17 6 Advertising slogans , 18 6 Last words , 19 5 Michael Richards , 20 5 Borat , 21 5 The Simpsons/Season 18 , 22 5 Lawrence Eagleburger , 23 5 Dane Cook , 24 5 Battlestar Galactica (2003) , 25 5 Fahrenheit 451

dez 2006: 1 12 George W. Bush , 2 9 List of films , 3 8 Love , 4 8 List of television shows , 5 7 House (TV series) , 6 7 List of people by name , 7 6 Happy Feet , 8 6 The Office (U.S. TV series) , 9 6 Last words , 10 5 Buffy the Vampire Slayer/Season 4 , 11 5 Fictional last words , 12 5 One Tree Hill , 13 5 Kim Possible , 14 5 Jimmy Wales , 15 5 John Adams , 16 5 Family Guy , 17 5 The Simpsons , 18 5 Advertising slogans , 19 5 English proverbs , 20 5 List of misquotations , 21 5 List of literary works , 22 5 Winston Churchill , 23 5 Albert Einstein , 24 4 Science , 25 4 Evil

jan 2007: 1 15 List of people by name , 2 11 List of films , 3 10 Love , 4 9 Last words , 5 8 Futurama , 6 8 George W. Bush , 7 7 Hannah Montana , 8 7 Sex , 9 7 English proverbs , 10 7 Anonymous , 11 7 Winston Churchill , 12 6 Friendship , 13 6 Urban decay , 14 6 José Rizal , 15 6 Metalocalypse , 16 6 Tenth Doctor , 17 6 Jack Thompson (attorney) , 18 6 Warcraft , 19 6 The Hitchhiker's Guide to the Galaxy , 20 6 Family Guy , 21 6 List of television shows , 22 6 Saddam Hussein , 23 5 God , 24 5 Elias Aslaksen , 25 5 Mike Huckabee

fev 2007: 1 11 House (TV series) , 2 10 List of films , 3 9 Jesus , 4 9 Grey's Anatomy , 5 8 Christianity , 6 8 Last words , 7 6 George Washington , 8 6 Fictional last words , 9 6 The Office (U.S. TV series) , 10 6 Muhammad Ali , 11 6 List of television shows , 12 6 Sex , 13 6 Mahatma Gandhi , 14 6 George W. Bush , 15 6 List of people by name , 16 5 War , 17 5 Thomas Jefferson , 18 5 The Simpsons/Season 9 , 19 5 The Empire Strikes Back , 20 5 MythBusters , 21 5 Scrubs (TV series) , 22 5 SpongeBob SquarePants , 23 5 Gilmore Girls , 24 5 Family Guy , 25 5 Futurama

mar 2007: 1 10 List of films , 2 9 300 (film) , 3 9 George W. Bush , 4 7 Love , 5 7 Jesus , 6 7 Islam , 7 7 Scrubs (TV series) , 8 7 Aqua Teen Hunger Force , 9 7 Futurama , 10 7 Muhammad , 11 7 Last words , 12 7 List of people by name , 13 6 Mark Twain , 14 5 Thomas Jefferson , 15 5 Borat , 16 5 Life on Mars (UK TV series) , 17 5 Grey's Anatomy , 18 5 Mitch Hedberg , 19 5 Sex , 20 5 Robert Frost , 21 5 Richard Nixon , 22 4 William Shakespeare , 23 4 God , 24 4 Ryōkan , 25 4 Ivan Turgenev

abr 2007: 1 20 List of people by name , 2 13 Tenth Doctor , 3 13 List of films , 4 10 List of television shows , 5 9 Naruto , 6 8 Kurt Vonnegut , 7 8 Last words , 8 8 Anonymous , 9 7 Blades of Glory (film) , 10 7 English proverbs , 11 7 Winston Churchill , 12 6 Scrubs (TV series) , 13 6 Futurama , 14 6 List of literary works , 15 6 Albert Einstein , 16 5 Edward Whittemore , 17 5 Patrick Pearse , 18 5 The Daleks , 19 5 The Office (U.S. TV series) , 20 5 House (TV series) , 21 5 SpongeBob SquarePants , 22 5 John Adams , 23 5 Firefly (TV series) , 24 5 Mystery Science Theater 3000 , 25 5 George W. Bush

mai 2007: 1 15 List of people by name , 2 14 List of films , 3 13 House (TV series) , 4 13 List of literary works , 5 11 Grey's Anatomy , 6 11 Anonymous , 7 10 Scrubs (TV series) , 8 10 Jimmy Wales , 9 10 Star Wars , 10 9 Tenth Doctor , 11 9 List of television shows , 12 9 George W. Bush , 13 9 Adolf Hitler , 14 8 Naruto , 15 7 Dragon Ball Z , 16 7 Heroes (TV series) , 17 7 Bleach (manga) , 18 7 Last words , 19 6 Pirates of the Caribbean: At World's End , 20 6 Futurama , 21 6 Advertising slogans , 22 5 Religion , 23 5 Charlotte Wilson , 24 5 Crash Tag Team Racing , 25 5 300 (film)

jun 2007: 1 13 Love , 2 12 Tenth Doctor , 3 11 Dragon Ball Z , 4 10 List of films , 5 10 List of people by name , 6 9 Naruto , 7 7 Bleach (manga) , 8 7 Anakin Skywalker , 9 6 Robot Chicken , 10 6 Mitch Hedberg , 11 6 Pokémon , 12 6 Jurassic Park (film) , 13 6 Buffy the Vampire Slayer , 14 6 English proverbs , 15 6 Albert Einstein , 16 5 Dragon Ball Z: Bio-Broly , 17 5 Dragon Ball Z: Wrath of the Dragon , 18 5 Fantastic Four: Rise of the Silver Surfer , 19 5 Knocked Up , 20 5 Dragon Ball GT , 21 5 The Simpsons/Season 7 , 22 5 Dragon Ball , 23 5 Hannah Montana , 24 5 Islam , 25 5 List of television shows

jul 2007: 1 11 List of people by name , 2 10 Harry Potter and the Deathly Hallows , 3 9 The Simpsons Movie , 4 9 List of films , 5 8 Islam , 6 8 Scrubs (TV series) , 7 8 Qur'an , 8 8 List of television shows , 9 7 Love , 10 7 Dragon Ball , 11 7 Harry Potter and the Order of the Phoenix , 12 7 Tenth Doctor , 13 6 The Pursuit of Happyness , 14 6 Transformers (film) , 15 6 300 (film) , 16 6 Harry Potter and the Philosopher's Stone , 17 6 Harry Potter and the Half-Blood Prince , 18 6 House (TV series) , 19 6 Barack Obama , 20 6 The Sopranos , 21 6 Futurama , 22 5 Harry Potter and the Order of the Phoenix (film) , 23 5 The Simpsons/Season 8 , 24 5 Bleach (manga) , 25 5 Ron Paul

ago 2007: 1 12 List of films , 2 10 List of people by name , 3 10 Albert Einstein , 4 9 List of television shows , 5 9 George W. Bush , 6 8 Ron Paul , 7 7 The Simpsons Movie , 8 6 Riaz Ahmed Gohar Shahi , 9 6 Firefly (TV series) , 10 6 Futurama , 11 5 Macy Gray , 12 5 What Women Want , 13 5 Saudi Arabia , 14 5 The Simpsons/Season 4 , 15 5 Tenth Doctor , 16 5 Bram Stoker's Dracula , 17 5 Gilmore Girls , 18 5 Last words , 19 5 Anonymous , 20 4 Love , 21 4 Judaism , 22 4 BioShock , 23 4 Superbad , 24 4 Stardust (2007 film) , 25 4 The Fly II

set 2007: 1 10 List of films , 2 10 George W. Bush , 3 9 BioShock , 4 9 List of people by name , 5 7 House (TV series) , 6 6 Warhammer 40,000: Dawn of War , 7 6 Scrubs (TV series) , 8 5 Zionism , 9 5 James Spader , 10 5 Naruto the Movie: Ninja Clash in the Land of Snow , 11 5 Thomas and Friends , 12 5 Anonymous , 13 4 Love , 14 4 God , 15 4 Family Guy/Season 6 , 16 4 Edgar Rice Burroughs , 17 4 Fictional last words in films , 18 4 Syracuse, Sicily , 19 4 Hannah Montana , 20 4 Stuart Merrill , 21 4 Kim Possible , 22 4 Jimmy Wales , 23 4 Ovadia Yosef , 24 4 SpongeBob SquarePants , 25 4 List of television shows

out 2007: 1 13 List of people by name , 2 11 Portal (game) , 3 8 Scrubs (TV series) , 4 7 Christianity , 5 6 Palindromes , 6 6 Rush Hour 3 , 7 6 The Office (U.S. TV series) , 8 6 Grey's Anatomy , 9 6 House (TV series) , 10 5 Muhammad , 11 4 Alice Bailey , 12 4 Rabbit-Proof Fence (film) , 13 4 The Big Bang Theory , 14 4 Material Girls , 15 4 Barney & Friends , 16 4 Metalocalypse , 17 4 Hannah Montana , 18 4 Benjamin N. Cardozo , 19 4 The Colbert Report , 20 4 Doris Lessing , 21 4 Hillary Clinton , 22 4 M*A*S*H (TV series) , 23 4 Jon Stewart , 24 4 The Matrix Reloaded , 25 4 List of films

nov 2007: 1 15 List of people by name , 2 9 Albert Einstein , 3 8 List of films , 4 8 Anonymous , 5 7 Adam Mickiewicz , 6 7 Futurama , 7 6 Mistakes , 8 6 The Office (U.S. TV series) , 9 5 God , 10 5 Synagogue , 11 5 Never , 12 5 Fictional last words in films , 13 5 Brett Favre , 14 5 Top Gear , 15 5 Scrubs (TV series) , 16 5 Hillary Clinton , 17 5 David Ben-Gurion , 18 5 The Simpsons , 19 5 Martin Luther King, Jr. , 20 4 Abraham Lincoln , 21 4 Friendship , 22 4 Time , 23 4 Rodney King , 24 4 Pushing Daisies , 25 4 Iran

dez 2007: 1 9 List of people by name , 2 8 House (TV series) , 3 8 Futurama , 4 8 List of films , 5 7 Ron Paul , 6 6 Jesus , 7 6 Barney & Friends , 8 6 Naruto , 9 6 List of television shows , 10 6 C. S. Lewis , 11 5 Love , 12 5 Howard Safir , 13 5 Reinhard Heydrich , 14 5 Scrubs (TV series) , 15 5 Metal Gear Solid 3: Snake Eater , 16 5 Adolf Hitler , 17 4 Turkey , 18 4 Alan Alda , 19 4 I Am Legend (film) , 20 4 Pakistan , 21 4 Benazir Bhutto , 22 4 Family Guy/Season 5 , 23 4 Metal Gear , 24 4 Barack Obama , 25 4 Stephen Jay Gould

jan 2008: 1 11 George W. Bush , 2 9 Chip Berlet , 3 8 List of films , 4 8 English proverbs , 5 7 Heath Ledger , 6 7 List of people by name , 7 6 Juno (film) , 8 6 Fictional last words in films , 9 6 Torchwood , 10 6 Rush Limbaugh , 11 6 Anonymous , 12 5 Edna St. Vincent Millay , 13 5 Barney & Friends , 14 5 Portal (game) , 15 5 The Simpsons/Season 13 , 16 5 The Suite Life of Zack & Cody , 17 5 Avatar: The Last Airbender , 18 5 Edmund Hillary , 19 5 Futurama , 20 5 Richard Feynman , 21 5 Advertising slogans , 22 4 Black Kettle , 23 4 Lawrence Ferlinghetti , 24 4 List of people by name, N–O , 25 4 List of people by name, D

fev 2008: 1 8 George W. Bush , 2 7 List of people by name, A , 3 7 John McCain , 4 7 Rush Limbaugh , 5 7 Hillary Clinton , 6 7 Martin Luther King, Jr. , 7 6 William Shakespeare , 8 6 List of people by name, N–O , 9 6 List of people by name, D , 10 6 Barack Obama , 11 6 George H. W. Bush , 12 6 Anonymous , 13 6 Albert Einstein , 14 5 Love , 15 5 Christianity , 16 5 The Bible , 17 5 Elephants , 18 5 Family Guy/Season 6 , 19 5 Fullmetal Alchemist , 20 5 Naruto , 21 5 List of films , 22 5 Isaac Newton , 23 5 Benjamin Franklin , 24 5 Oscar Wilde , 25 4 Abraham Lincoln

mar 2008: 1 9 List of people by name, S , 2 9 List of people by name, N–O , 3 9 George W. Bush , 4 8 List of television shows , 5 6 List of people by name, D , 6 6 Torchwood , 7 6 George H. W. Bush , 8 6 List of films , 9 5 Love , 10 5 Terminator: The Sarah Connor Chronicles , 11 5 List of people by name, A , 12 5 Dragon Ball Z , 13 5 Flavor Flav , 14 5 Rush Limbaugh , 15 5 Anatole France , 16 5 Internet , 17 4 William Shakespeare , 18 4 Jesus , 19 4 Cloverfield , 20 4 Rick Astley , 21 4 Juno (film) , 22 4 Nero Wolfe , 23 4 Thomas Jefferson , 24 4 Barney & Friends , 25 4 The Simpsons/Season 18

abr 2008: 1 13 Tenth Doctor , 2 9 List of television shows , 3 8 House (TV series) , 4 7 Barack Obama , 5 7 George W. Bush , 6 6 William Shakespeare , 7 6 Love , 8 6 List of people by name, S , 9 6 List of people by name, N–O , 10 6 List of people by name, A , 11 6 Barney & Friends , 12 6 Fullmetal Alchemist , 13 6 Noam Chomsky , 14 6 English proverbs , 15 6 Anonymous , 16 6 Albert Einstein , 17 5 Matt Sanchez , 18 5 The Simpsons/Season 19 , 19 5 The Mist (film) , 20 5 The Simpsons/Season 18 , 21 5 Warhammer 40,000: Dawn of War , 22 5 Sonic the Hedgehog , 23 5 Angel (1999 TV series) , 24 5 Rush Limbaugh , 25 5 Firefly (TV series)

mai 2008: 1 12 Tenth Doctor , 2 10 List of films , 3 8 List of people by name, N–O , 4 8 House (TV series) , 5 7 William the Silent , 6 7 Iron Man (2008 film) , 7 7 List of people by name, A , 8 7 Dane Cook , 9 7 Martin Luther King, Jr. , 10 6 Abraham Lincoln , 11 6 Matt Sanchez , 12 6 Indiana Jones and the Kingdom of the Crystal Skull , 13 6 Portal (game) , 14 6 John F. Kennedy , 15 6 George W. Bush , 16 5 God , 17 5 Short Circuit (1986 film) , 18 5 Joseph Gordon-Levitt , 19 5 David Allen (author) , 20 5 List of people by name, S , 21 5 Fictional last words in films , 22 5 American Dad! , 23 5 Winston Churchill , 24 5 Albert Einstein , 25 4 Religion

jun 2008: 1 14 Tenth Doctor , 2 8 List of people by name, A , 3 8 John McCain , 4 8 George Carlin , 5 7 Love , 6 7 George Washington , 7 7 Kung Fu Panda , 8 7 List of people by name, D , 9 7 Barney & Friends , 10 6 List of people by name, S , 11 6 List of people by name, N–O , 12 6 List of films , 13 6 Mark Twain , 14 5 War , 15 5 Life , 16 5 Dragon Ball Z: Season 4 , 17 5 Grand Theft Auto IV , 18 5 Dragon Ball Z: Cooler's Revenge , 19 5 Thomas Jefferson , 20 5 Dragon Ball Z , 21 5 Hannah Montana , 22 5 The Venture Bros. , 23 5 Arthur Wellesley, 1st Duke of Wellington , 24 5 Futurama , 25 5 Martin Luther King, Jr.

jul 2008: 1 18 Tenth Doctor , 2 15 The Dark Knight (film) , 3 8 Dr. Horrible's Sing-Along Blog , 4 8 Hancock (film) , 5 8 Futurama , 6 7 Matt Sanchez , 7 7 List of people by name, S , 8 7 John McCain , 9 6 List of films , 10 6 Adolf Hitler , 11 6 List of literary works , 12 5 Wanted (2008 film) , 13 5 List of people by name, N–O , 14 5 July 18 , 15 5 Pokémon , 16 5 Thomas Henry Huxley , 17 5 Anonymous , 18 4 Circles , 19 4 Randy Pausch , 20 4 Christopher McCandless , 21 4 Nazism , 22 4 Æon Flux (film) , 23 4 Hans Frank , 24 4 Fictional last words in films , 25 4 Charlotte Brontë

ago 2008: 1 8 The Dark Knight (film) , 2 8 John McCain , 3 7 Portal (game) , 4 7 List of films , 5 6 Whose Line Is It Anyway? , 6 6 List of people by name, N–O , 7 6 Barack Obama , 8 6 Bill O'Reilly (commentator) , 9 6 Last words , 10 5 Michael Phelps , 11 5 Michael Gambon , 12 5 Hank Aaron , 13 5 List of people by name, S , 14 5 List of people by name, D , 15 5 List of people by name, A , 16 5 English proverbs , 17 4 Mice , 18 4 I'm No Angel , 19 4 Gilbert du Motier, Marquis de Lafayette , 20 4 Fictional last words in films , 21 4 Jeff Dunham , 22 4 Stargate Atlantis , 23 4 Pat Robertson , 24 4 Scrubs (TV series) , 25 4 Ed, Edd, n Eddy

set 2008: 1 11 Sarah Palin , 2 9 Anonymous , 3 6 Barack Obama , 4 5 List of people by name, N–O , 5 5 Tenth Doctor , 6 5 September 22 , 7 5 John McCain , 8 5 Where in the World Is Carmen Sandiego? (TV show) , 9 5 Mystery Science Theater 3000 , 10 5 Isaac Newton , 11 5 Benjamin Franklin , 12 5 Last words , 13 4 Love , 14 4 Eugen Drewermann , 15 4 List of people by name, A , 16 4 October 1 , 17 4 The Suite Life of Zack & Cody , 18 4 Half-Life , 19 4 House (TV series) , 20 4 Angel (1999 TV series) , 21 4 Jimmy Wales , 22 4 Richard Feynman , 23 3 Quotations , 24 3 Life , 25 3 George Washington

out 2008: 1 9 List of literary works , 2 8 List of films , 3 7 October 31 , 4 7 October 16 , 5 6 Sarah Palin , 6 6 October 30 , 7 6 October 29 , 8 6 October 28 , 9 6 October 2 , 10 5 Abraham Lincoln , 11 5 Kenan Evren , 12 5 Pirates of the Caribbean: At World's End , 13 5 October 27 , 14 5 October 18 , 15 5 October 17 , 16 5 October 15 , 17 5 October 8 , 18 5 November 1 , 19 5 The Office (U.S. TV series) , 20 5 House (TV series) , 21 5 John McCain , 22 5 Barack Obama , 23 5 Mark Twain , 24 5 Albert Einstein , 25 4 Quotations

nov 2008: 1 14 Barack Obama , 2 9 November 30 , 3 8 It's Always Sunny in Philadelphia , 4 7 Love , 5 7 Sarah Palin , 6 7 30 Rock , 7 7 November 26 , 8 7 November 24 , 9 7 November 20 , 10 7 November 11 , 11 6 The Big Bang Theory , 12 6 November 28 , 13 6 November 22 , 14 6 November 18 , 15 6 November 16 , 16 6 November 15 , 17 6 November 14 , 18 6 November 13 , 19 6 November 4 , 20 6 December 1 , 21 6 Bambi , 22 6 The Office (UK TV series) , 23 6 Scrubs (TV series) , 24 6 James Bond (film series) , 25 6 List of literary works

dez 2008: 1 8 Love , 2 8 List of films , 3 7 December 5 , 4 6 Sarah Palin , 5 6 List of people by name, A , 6 6 Tenth Doctor , 7 6 December 9 , 8 6 Top Gear , 9 6 Benjamin Franklin , 10 5 30 Rock , 11 5 December 20 , 12 5 December 13 , 13 5 December 11 , 14 5 December 8 , 15 5 December 7 , 16 5 The Office (U.S. TV series) , 17 5 National Lampoon's Christmas Vacation , 18 5 House (TV series) , 19 5 Friends (TV series) , 20 5 Ayn Rand , 21 5 John F. Kennedy , 22 5 George W. Bush , 23 5 Last words , 24 4 Life , 25 4 Matthew Perry (actor)

jan 2009: 1 48 John Dewey , 2 8 Barack Obama , 3 8 List of films , 4 7 Jimmy Wales , 5 6 Muhammad , 6 6 English proverbs , 7 6 Last words , 8 6 John Lennon , 9 5 Truth , 10 5 Jalal Talabani , 11 5 Psych (TV series) , 12 5 Macedonia , 13 5 30 Rock , 14 5 Futurama , 15 5 George W. Bush , 16 5 Hamlet , 17 4 Politics , 18 4 Love , 19 4 Abraham Lincoln , 20 4 Freedom , 21 4 Matthew Barney , 22 4 James Rosenquist , 23 4 Arthur Rubinstein , 24 4 The Simpsons Hit & Run , 25 4 The Outline of History

fev 2009: 1 21 John Dewey , 2 8 List of people by name , 3 7 Barack Obama , 4 7 List of television shows , 5 7 List of literary works , 6 6 Catherine of Aragon , 7 6 List of films , 8 5 Love , 9 5 List of people by name, A , 10 5 Thomas Jefferson , 11 5 30 Rock , 12 5 Harry Potter and the Prisoner of Azkaban , 13 5 Hannah Montana , 14 5 John Adams , 15 5 Margaret Thatcher , 16 5 Advertising slogans , 17 5 George W. Bush , 18 5 Albert Einstein , 19 4 Total Drama Island , 20 4 Religion , 21 4 The Formation of Vegetable Mould through the Action of Worms , 22 4 Floyd Dell , 23 4 The Sword in the Stone (film) , 24 4 For a Few Dollars More , 25 4 The Nostalgia Critic

mar 2009: 1 11 Rachel Maddow , 2 9 List of television shows , 3 8 List of literary works , 4 7 List of people by name, D , 5 7 30 Rock , 6 7 List of films , 7 7 Albert Einstein , 8 6 William Shakespeare , 9 6 The Sword in the Stone (film) , 10 6 Wikipedia , 11 6 Yes, Minister , 12 6 The Hitchhiker's Guide to the Galaxy , 13 6 Gautama Buddha , 14 5 Love , 15 5 Genius , 16 5 Watchmen (film) , 17 5 Eastbound & Down , 18 5 Tristan Corbière , 19 5 Star Wars: The Clone Wars (film) , 20 5 Quantum of Solace , 21 5 Transformers: Animated , 22 5 List of people by name, A , 23 5 Harry Potter and the Prisoner of Azkaban , 24 5 March 17 , 25 5 March 14

abr 2009: 1 10 Patrick Henry , 2 8 Thomas Babington Macaulay, 1st Baron Macaulay , 3 8 Isaac Newton , 4 7 List of television shows , 5 6 Truth , 6 6 Star Wars (film) , 7 5 Love , 8 5 Abraham Lincoln , 9 5 30 Rock , 10 5 Tenth Doctor , 11 5 April 11 , 12 5 April 10 , 13 5 Camille Paglia , 14 5 Vladimir Lenin , 15 5 List of films , 16 5 Benjamin Franklin , 17 5 Edsger W. Dijkstra , 18 5 List of literary works , 19 5 Albert Einstein , 20 4 Amitabh Bachchan , 21 4 Suicide , 22 4 Luck , 23 4 Louis Riel , 24 4 Dionysius Lardner , 25 4 Star Wars: The Clone Wars (film)

mai 2009: 1 8 Benjamin Franklin , 2 7 30 Rock , 3 7 Last words , 4 6 Peace , 5 6 Star Trek (film) , 6 6 List of people by name, I–J , 7 6 List of people by name, D , 8 6 List of television shows , 9 6 List of films , 10 6 George W. Bush , 11 5 Quotations , 12 5 Sonia Sotomayor , 13 5 Patrick Henry , 14 5 Robert A. Heinlein , 15 5 The Shawshank Redemption , 16 5 George Bernard Shaw , 17 5 Bertrand Russell , 18 4 Love , 19 4 George Washington , 20 4 Maid , 21 4 Imre Kertész , 22 4 True Blood , 23 4 The Nostalgia Critic , 24 4 Michael Crichton , 25 4 List of people by name, S

jun 2009: 1 9 Michael Jackson , 2 5 Jaggi Vasudev , 3 5 Bryce Crawford , 4 5 Phineas and Ferb , 5 5 Top Gear , 6 5 Patrick Henry , 7 5 Metal Gear , 8 5 List of films , 9 5 Helen Keller , 10 5 Voltaire , 11 4 Sun , 12 4 Sky , 13 4 Whose Line Is It Anyway? , 14 4 Dragon Ball Z: Bardock - The Father of Goku , 15 4 List of people by name, A , 16 4 Zero Punctuation , 17 4 Cole Porter , 18 4 300 (film) , 19 4 The Simpsons/Season 1 , 20 4 June 22 , 21 4 Scientology , 22 4 Camille Paglia , 23 4 NCIS (TV series) , 24 4 Roger Ebert , 25 4 The Shawshank Redemption

jul 2009: 1 25 Charles Darwin , 2 21 Mahatma Gandhi , 3 20 Martin Luther King, Jr. , 4 19 William Shakespeare , 5 19 Thomas Kuhn , 6 17 Albert Einstein , 7 15 John F. Kennedy , 8 15 Voltaire , 9 14 Muhammad , 10 14 Helen Keller , 11 14 Aristotle , 12 13 Leo Tolstoy , 13 13 Confucius , 14 11 Michael Jackson , 15 11 Patrick Henry , 16 10 Religion , 17 10 Science , 18 10 Timothy Leary , 19 10 Richard Feynman , 20 9 William Saroyan , 21 9 T. S. Eliot , 22 8 The Cabinet of Dr. Caligari , 23 8 Gautama Buddha , 24 8 Emily Brontë , 25 8 Thomas Paine

ago 2009: 1 11 Patrick Henry , 2 9 StarCraft , 3 8 Love , 4 8 List of films , 5 7 Ted Kennedy , 6 5 Quotations , 7 5 Transformers: Revenge of the Fallen , 8 5 NCIS (TV series) , 9 4 Wentworth Miller , 10 4 Bethany Kennedy Scanlon , 11 4 Axl Rose , 12 4 Matt Sanchez , 13 4 Castle (TV series) , 14 4 True Blood , 15 4 List of people by name, I–J , 16 4 Command & Conquer 3: Tiberium Wars , 17 4 Phineas and Ferb , 18 4 Psych (TV series) , 19 4 Boxing , 20 4 Michael Jackson , 21 4 Rudolf Hess , 22 4 Dead Poets Society , 23 4 The Matrix (film) , 24 4 English proverbs , 25 3 Religion

set 2009: 1 15 Paulo Freire , 2 9 Benjamin Franklin , 3 7 The Transformers (TV series) , 4 6 List of films , 5 6 Mao Zedong , 6 6 Ralph Waldo Emerson , 7 5 Trust , 8 5 Manly P. Hall , 9 5 John Maynard Keynes , 10 5 Atlas Shrugged , 11 5 Martin Luther , 12 5 G. K. Chesterton , 13 4 Love , 14 4 Anthony Ashley Cooper, 1st Earl of Shaftesbury , 15 4 Angels & Demons (film) , 16 4 Bill McKibben , 17 4 Slobodan Milošević , 18 4 Leighton W. Smith, Jr. , 19 4 Telford Taylor , 20 4 Franco Frattini , 21 4 Ralph Barton Perry , 22 4 Michael Franti , 23 4 Transformers: Revenge of the Fallen , 24 4 Pan Tadeusz , 25 4 Snow White and the Seven Dwarfs (1937 film)

out 2009: 1 9 Rush Limbaugh , 2 7 Glee (TV series) , 3 7 Benjamin Franklin , 4 6 Patrick Henry , 5 5 Ivor Grattan-Guinness , 6 5 Anita Dunn , 7 5 List of people by name, N–O , 8 5 List of films , 9 4 Liberty , 10 4 Samuel Gompers , 11 4 Mary Harris Jones , 12 4 Henry J. Kaiser , 13 4 James Joseph Sylvester , 14 4 Polygamy , 15 4 Caroline Myss , 16 4 Mark Oliphant , 17 4 Barbara De Angelis , 18 4 Family Guy/Season 8 , 19 4 Miley Cyrus , 20 4 The Big Bang Theory , 21 4 Jo Grimond , 22 4 The Office (U.S. TV series) , 23 4 Who Framed Roger Rabbit , 24 4 John Maynard Keynes , 25 4 That '70s Show

nov 2009: 1 6 Tenth Doctor , 2 5 Family Guy/Season 8 , 3 5 Horton Hears a Who! (film) , 4 5 Barack Obama , 5 5 Claude Lévi-Strauss , 6 5 Fight Club (film) , 7 5 Winston Churchill , 8 4 Love , 9 4 Jesse Stuart , 10 4 Tip O'Neill , 11 4 The Twilight Saga: New Moon , 12 4 Alvaro De Rujula , 13 4 Serge Raynaud de la Ferriere , 14 4 Stuart Hall , 15 4 Ilan Halevi , 16 4 Sadegh Hedayat , 17 4 Sheikh Mujibur Rahman , 18 4 Boudica (film) , 19 4 Unification Church , 20 4 List of people by name, A , 21 4 Robert W. Bly , 22 4 The Big Bang Theory , 23 4 Derek Abbott , 24 4 V for Vendetta (film) , 25 4 How I Met Your Mother

dez 2009: 1 10 Dragon Ball GT: Season 1 , 2 10 Apocalypse Now , 3 8 V , 4 8 M (1931 film) , 5 7 Life , 6 7 Dragon Ball Z: Season 9 , 7 7 Dragon Ball GT: Season 2 , 8 7 Dragon Ball Z: Season 5 , 9 7 Dragon Ball Z: Season 3 , 10 7 Dragon Ball Z: Season 2 , 11 7 Erich von dem Bach , 12 7 Karl Dönitz , 13 7 Dragon Ball GT , 14 7 Tadamichi Kuribayashi , 15 7 Albert Einstein , 16 6 Dragon Ball Z: Season 6 , 17 6 Dragon Ball Z: Season 1 , 18 6 Akira Toriyama , 19 6 Dragon Ball Z: Wrath of the Dragon , 20 6 Dragon Ball Z , 21 6 Corbin Bleu , 22 5 Love , 23 5 Norman Lamm , 24 5 Harriet Auber , 25 5 Glee (TV series)

jan 2010: 1 8 Tenth Doctor , 2 7 Muhammad , 3 7 Advertising slogans , 4 6 Benjamin Franklin , 5 6 Hamlet , 6 5 George Washington , 7 5 Dimitrije Tucović , 8 5 3 Idiots , 9 5 Sherlock Holmes (2009 film) , 10 5 Hiromu Arakawa , 11 5 Eleventh Doctor , 12 5 Avatar (2009 film) , 13 5 Alan Greenspan , 14 4 William Shakespeare , 15 4 Daniel Bernoulli , 16 4 Conan O'Brien , 17 4 Smith Wigglesworth , 18 4 Andy Kessler (author) , 19 4 Helena Bonham Carter , 20 4 Mihira Bhoja I , 21 4 Freeman's Mind , 22 4 Martin Firrell , 23 4 Theodore Watts-Dunton , 24 4 The Big Bang Theory , 25 4 Howard Zinn

fev 2010: 1 7 Benjamin Franklin , 2 7 Albert Einstein , 3 6 Alessandra Torresani , 4 6 List of films , 5 6 Last words , 6 5 Syed Ahmed Khan , 7 5 Hal Varian , 8 5 Billy Davies , 9 5 John Reed (actor) , 10 5 Rita Hayworth , 11 5 Cui Weiping , 12 5 El secreto de sus ojos , 13 5 Thérèse of Lisieux , 14 5 Mass Effect 2 , 15 5 Burn Notice (TV series) , 16 4 Love , 17 4 Abraham Lincoln , 18 4 Knight Moves , 19 4 Solomon Kane , 20 4 Nicholas G. Carr , 21 4 Christ myth theory , 22 4 James Wesley Rawles , 23 4 Vernor Vinge , 24 4 Sebouh Chouldjian , 25 4 Archer (2009 TV series)

mar 2010: 1 9 Francisco Franco , 2 8 Alice in Wonderland (2010 film) , 3 8 Charles Darwin , 4 8 Benjamin Franklin , 5 8 Winston Churchill , 6 7 Robert A. Heinlein , 7 6 James Cameron (director) , 8 6 Patrick Henry , 9 6 Benito Mussolini , 10 6 Gautama Buddha , 11 5 Coco Chanel , 12 5 Hugh Blair , 13 5 Fatos Nano , 14 5 Tom Peters , 15 5 G.I. Joe: The Rise of Cobra , 16 5 William Fitzsimmons , 17 5 Riaz Ahmed Gohar Shahi , 18 5 Libertarianism , 19 5 Mao Zedong , 20 5 Animal Farm , 21 5 Albert Einstein , 22 4 Money , 23 4 Hope , 24 4 Health , 25 4 Education

abr 2010: 1 13 The Rescuers , 2 11 Dumbo , 3 11 The Fox and the Hound , 4 10 Bambi , 5 9 Patrick Henry , 6 8 Eleventh Doctor , 7 8 Charlotte's Web (1973 film) , 8 7 How to Train Your Dragon , 9 7 The SpongeBob SquarePants Movie , 10 7 Lady and the Tramp II: Scamp's Adventure , 11 7 Finding Nemo , 12 6 Riaz Ahmed Gohar Shahi , 13 6 Muhammad , 14 5 The Lion King 1½ , 15 5 Lilo & Stitch , 16 5 South Park , 17 5 Georg Wilhelm Friedrich Hegel , 18 5 The Lion King , 19 4 Aubrey Beardsley , 20 4 Lars Løkke Rasmussen , 21 4 George Lincoln Rockwell , 22 4 James G. Blaine , 23 4 Eagles (band) , 24 4 Beverly Hills Chihuahua , 25 4 Lady and the Tramp

mai 2010: 1 17 Patrick Henry , 2 9 Eleventh Doctor , 3 7 The Rescuers , 4 7 The Fox and the Hound , 5 6 Robert J. Marks II , 6 6 The Lion King 1½ , 7 6 Albert Einstein , 8 5 Miranda July , 9 5 Eric Roll, Baron Roll of Ipsden , 10 5 Kung Fu Panda , 11 5 The Fox and the Hound 2 , 12 5 Tenth Doctor , 13 5 Richard Dawkins , 14 4 War , 15 4 Love , 16 4 Abraham Lincoln , 17 4 Arthur M. Jolly , 18 4 George Best , 19 4 Sun Ra , 20 4 Legion (2010 film) , 21 4 Sonny With a Chance , 22 4 The SpongeBob SquarePants Movie , 23 4 In Plain Sight , 24 4 Lady Gaga , 25 4 Beverly Hills Chihuahua

jun 2010: 1 18 Eleventh Doctor , 2 5 Miss Foozie , 3 5 The Lion King II: Simba's Pride , 4 5 Tenth Doctor , 5 4 Love , 6 4 Marisa Miller , 7 4 Gregory Colbert , 8 4 Sebastian Vettel , 9 4 Fasting , 10 4 Daniel Tosh , 11 4 Helen Thomas , 12 4 Wilhelm Reich , 13 4 Roger Ebert , 14 4 Monk (TV series) , 15 4 Doctor Who , 16 4 The Lion King , 17 4 List of films , 18 4 English proverbs , 19 4 Last words , 20 4 Pierre Trudeau , 21 4 Albert Einstein , 22 3 Jesus , 23 3 Philipp Melanchthon , 24 3 Ingeborg Refling Hagen , 25 3 Julian Assange

jul 2010: 1 7 Love , 2 7 Julian Assange , 3 7 Eleventh Doctor , 4 7 List of films , 5 5 Mallika Sherawat , 6 5 Psych (TV series) , 7 4 Health , 8 4 Ma Zhongying , 9 4 Jean-Baptiste Say , 10 4 Karl Bowman , 11 4 Arthur Laffer , 12 4 Melody (1971 film) , 13 4 It's a Mad, Mad, Mad, Mad World , 14 4 F. S. Flint , 15 4 Sarah Palin , 16 4 Daniel Tosh , 17 4 List of television shows , 18 4 Futurama , 19 4 Muhammad , 20 4 Che Guevara , 21 3 Religion , 22 3 Money , 23 3 Education , 24 3 Alcoholic beverages , 25 3 Belief

ago 2010: 1 9 Bob Dole , 2 7 Inception (film) , 3 7 Albert Einstein , 4 6 Last words , 5 6 Karl Marx , 6 5 House (TV series) , 7 5 List of television shows , 8 5 Bill Gates , 9 4 Abraham Lincoln , 10 4 Failure , 11 4 Emil Zátopek , 12 4 Dennis Skinner , 13 4 Nishapur , 14 4 Nigel Slater , 15 4 Wesley Willis , 16 4 Audrey Niffenegger , 17 4 Johann Gottfried Herder , 18 4 İsmail Enver , 19 4 Psych (TV series) , 20 4 The Simpsons/Season 6 , 21 4 Daniel Tosh , 22 4 Peter Pan (2003 film) , 23 4 Futurama , 24 4 The Matrix (film) , 25 4 List of films

set 2010: 1 7 Love , 2 6 Konrad Lorenz , 3 6 Eleventh Doctor , 4 6 Søren Kierkegaard , 5 6 John Lennon , 6 5 The Big Bang Theory , 7 4 Politics , 8 4 Laughter , 9 4 Failure , 10 4 Jesus , 11 4 Ronald Knox , 12 4 Mike + The Mechanics , 13 4 Powder (film) , 14 4 Suhayl ibn Amr , 15 4 Sheila Walsh (singer) , 16 4 Yo soy Bea , 17 4 Hans-Georg Gadamer , 18 4 Justin Bieber , 19 4 Hot Fuzz , 20 4 Psych (TV series) , 21 4 J. M. Coetzee , 22 4 Patrick Henry , 23 4 NCIS (TV series) , 24 4 Wikipedia , 25 4 The Hitchhiker's Guide to the Galaxy

out 2010: 1 10 Love , 2 7 Albert Einstein , 3 6 Religion , 4 6 Michael Crichton , 5 5 Freedom , 6 5 Jesus , 7 5 George Monck, 1st Duke of Albemarle , 8 5 Georges Bernanos , 9 5 Christian de Duve , 10 5 Radicalism , 11 5 List of people by name, S , 12 5 The Big Bang Theory , 13 5 Final Fantasy , 14 5 List of films , 15 5 Mahatma Gandhi , 16 5 Benjamin Franklin , 17 5 Ralph Waldo Emerson , 18 5 Aristotle , 19 4 Courage , 20 4 Charles Murray (author) , 21 4 Christine O'Donnell , 22 4 Todor Zhivkov , 23 4 Arthur Desmond , 24 4 Glee (TV series) , 25 4 The Hangover

nov 2010: 1 6 Yevgeniy Chazov , 2 6 Eleventh Doctor , 3 6 Friends (TV series) , 4 6 Albert Einstein , 5 5 Epifanio de los Santos , 6 5 Dan Patrick , 7 5 William A. Henry III , 8 5 William John Macquorn Rankine , 9 5 Snow Crash , 10 5 English proverbs , 11 4 History , 12 4 Alex Agase , 13 4 Timothy Ferriss , 14 4 Ben Stiller , 15 4 Kris Kristofferson , 16 4 Agis IV , 17 4 Robert Hayne , 18 4 List of people by name, B , 19 4 Glee (TV series) , 20 4 Mario Vargas Llosa , 21 4 Thomas Jefferson , 22 4 Tenth Doctor , 23 4 How I Met Your Mother , 24 4 Bruce Lee , 25 4 Ayn Rand

dez 2010: 1 8 Douglas Adams , 2 6 Fred Perry , 3 6 Tangled , 4 6 The Big Bang Theory , 5 5 Abraham Lincoln , 6 5 Friendship , 7 5 Glee (TV series) , 8 5 Henry Kissinger , 9 5 Jimmy Wales , 10 5 Joseph Stalin , 11 5 List of television shows , 12 5 John F. Kennedy , 13 5 Last words , 14 5 Anonymous , 15 5 Bertrand Russell , 16 4 Journalism , 17 4 Books , 18 4 George Washington , 19 4 Françoise Sagan , 20 4 Thomas Flanagan (political scientist) , 21 4 Julian Assange , 22 4 Sarah Palin , 23 4 Australia , 24 4 Psych (TV series) , 25 4 Wikipedia

jan 2011: 1 8 List of films , 2 6 Abraham Lincoln , 3 5 United States , 4 5 Quarantine (2008 film) , 5 5 Dan Aykroyd , 6 5 Eleventh Doctor , 7 5 The Wizard of Oz (1939 film) , 8 5 Franklin D. Roosevelt , 9 4 Conspiracy , 10 4 George Washington , 11 4 Bartolomeo Vanzetti , 12 4 Steve Maraboli , 13 4 Hostel: Part II , 14 4 A Night at the Opera (film) , 15 4 Don Cherry , 16 4 Julian Assange , 17 4 Sherlock Holmes (2009 film) , 18 4 Saw VI , 19 4 Daniel Tosh , 20 4 Tenth Doctor , 21 4 How I Met Your Mother , 22 4 Chess , 23 4 Richard Feynman , 24 4 Dune , 25 4 Mahatma Gandhi

fev 2011: 1 8 List of films , 2 7 Thomas Jefferson , 3 6 The Big Bang Theory , 4 5 Millennium '73 , 5 5 Hosni Mubarak , 6 5 Justin Bieber , 7 5 Eleventh Doctor , 8 5 English proverbs , 9 4 Homi J. Bhabha , 10 4 Ziaur Rahman , 11 4 Namboku Mizuno , 12 4 John Pilger , 13 4 Anders Fogh Rasmussen , 14 4 Community (TV series) , 15 4 The Simpsons/Season 3 , 16 4 How I Met Your Mother , 17 4 Glenn Beck , 18 4 Benjamin Franklin , 19 4 Bill Gates , 20 4 Winston Churchill , 21 4 Albert Einstein , 22 3 Mothers , 23 3 Law , 24 3 George Washington , 25 3 Jocelyn Bell Burnell

mar 2011: 1 8 Charlie Sheen , 2 8 List of films , 3 7 Albert Einstein , 4 6 Eleventh Doctor , 5 6 Winston Churchill , 6 5 Love , 7 5 Allen West (politician) , 8 5 Rex Ryan , 9 5 30 Rock , 10 5 Tenth Doctor , 11 5 Ninth Doctor , 12 5 Franklin D. Roosevelt , 13 5 Mahatma Gandhi , 14 5 English proverbs , 15 5 List of literary works , 16 4 God , 17 4 Christianity , 18 4 Jesus , 19 4 George Washington , 20 4 Tim Powers , 21 4 Whose Line Is It Anyway? , 22 4 Simon van der Meer , 23 4 Sarah Palin , 24 4 The Simpsons Movie , 25 4 Scent of a Woman

abr 2011: 1 14 Eleventh Doctor , 2 9 Portal 2 , 3 7 Portal (game) , 4 6 Abraham Lincoln , 5 6 How I Met Your Mother , 6 6 Albert Einstein , 7 5 The Big Bang Theory , 8 5 Thomas Jefferson , 9 5 Coming to America , 10 5 Dylan Moran , 11 5 Donald Trump , 12 5 Joseph Stalin , 13 5 List of television shows , 14 5 Leonardo da Vinci , 15 5 Franklin D. Roosevelt , 16 4 Opinion , 17 4 God , 18 4 Edgar Zilsel , 19 4 Poles , 20 4 Charles Sumner , 21 4 Henry Schriver , 22 4 Judah Loew ben Bezalel , 23 4 Henry S. Haskins , 24 4 F. J. Duarte , 25 4 John Elkann

mai 2011: 1 15 Eleventh Doctor , 2 8 Osama bin Laden , 3 7 Portal 2 , 4 5 Abraham Lincoln , 5 5 The Big Bang Theory , 6 5 Barack Obama , 7 5 English proverbs , 8 4 Thomas D'Arcy McGee , 9 4 Judy LaMarsh , 10 4 Ajaib Singh , 11 4 Viola Spolin , 12 4 Manmohan Acharya , 13 4 Derren Brown , 14 4 John James Audubon , 15 4 Revolution , 16 4 Stupidity , 17 4 Money , 18 4 Kissing , 19 4 Glee (TV series) , 20 4 In Plain Sight , 21 4 Ninth Doctor , 22 4 How I Met Your Mother , 23 4 NCIS (TV series) , 24 4 The Catcher in the Rye , 25 4 List of television shows

jun 2011: 1 10 Eleventh Doctor , 2 6 Mahatma Gandhi , 3 6 Richard Nixon , 4 5 Kurien Kunnumpuram , 5 5 Time , 6 5 Ninth Doctor , 7 5 List of films , 8 5 English proverbs , 9 4 Ken Robinson , 10 4 Larry LeSueur , 11 4 X-Men: First Class , 12 4 Ta-Nehisi Coates , 13 4 Health , 14 4 Portal 2 , 15 4 The Hangover , 16 4 Phineas and Ferb , 17 4 Tenth Doctor , 18 4 Barack Obama , 19 4 Pokémon , 20 4 Duke Nukem , 21 4 Thomas Carlyle , 22 4 Mark Twain , 23 4 Aristotle , 24 4 Albert Einstein , 25 3 Valya Dudycz Lupescu

jul 2011: 1 5 Helmut Newton , 2 5 Rāmabhadrācārya , 3 5 John H. Disher , 4 5 Ayman al-Zawahiri , 5 5 Ronald Reagan , 6 5 English proverbs , 7 5 Douglas Adams , 8 4 Harry Potter and the Deathly Hallows – Part 2 , 9 4 Vivian Stanshall , 10 4 Dawud Wharnsby , 11 4 Women , 12 4 The Virginian , 13 4 Phineas and Ferb , 14 4 Torchwood , 15 4 Aung San Suu Kyi , 16 4 Back to the Future , 17 4 Muhammad , 18 4 List of films , 19 4 List of people by name , 20 4 Bertrand Russell , 21 4 Albert Einstein , 22 3 Eleanor H. Porter , 23 3 Dominicus Corea , 24 3 Mario television series , 25 3 George Woodcock

ago 2011: 1 9 Eleventh Doctor , 2 5 Jack Layton , 3 5 A.C. Cuza , 4 5 Albert Einstein , 5 4 Kelsang Gyatso , 6 4 Ravi Gomatam , 7 4 Edmund Cooper , 8 4 Poetry , 9 4 Breaking Bad , 10 4 Eugène Delacroix , 11 4 Slavoj Žižek , 12 4 Bill Hicks , 13 4 Winston Churchill , 14 3 Peter Dicken , 15 3 H. M. Tomlinson , 16 3 Calgacus , 17 3 Hayley Williams , 18 3 Kerry Ellis , 19 3 Final Destination 5 , 20 3 Jimmy Quillen , 21 3 Sidney Hillman , 22 3 Philip Murray , 23 3 Lucian Truscott , 24 3 David Wood (philosopher) , 25 3 Ian Brown

set 2011: 1 10 Agnosticism , 2 9 Oscar Wilde , 3 7 Eleventh Doctor , 4 6 Albert Einstein , 5 5 Amos Bronson Alcott , 6 5 The Big Bang Theory , 7 5 Hannah Montana , 8 4 Joe Kehoskie , 9 4 Martha Gellhorn , 10 4 Nycole Turmel , 11 4 Marriage , 12 4 Education , 13 4 How I Met Your Mother , 14 4 Ayn Rand , 15 4 List of films , 16 4 English proverbs , 17 4 W. H. Auden , 18 3 Person of Interest (TV series) , 19 3 John Joseph Griffin , 20 3 Stedman Graham , 21 3 Frederic G. Kenyon , 22 3 Nur Muhammad Taraki , 23 3 Patrick Kavanagh , 24 3 Rozen Maiden , 25 3 Halvard Lange

out 2011: 1 14 Steve Jobs , 2 9 Eleventh Doctor , 3 7 Abraham Lincoln , 4 7 Jesus , 5 7 Muammar Gaddafi , 6 7 Albert Einstein , 7 6 Love , 8 6 Big Time Rush , 9 6 Gautama Buddha , 10 5 Dennis Ritchie , 11 5 Life , 12 5 The Angry Video Game Nerd , 13 5 SpongeBob SquarePants , 14 5 Ralph Waldo Emerson , 15 4 Philip Morrison , 16 4 Religious views of Adolf Hitler , 17 4 Eknath Easwaran , 18 4 Mozi , 19 4 Sebastian de Grazia , 20 4 T S Satyan , 21 4 Leo Babauta , 22 4 John Wayne , 23 4 Religion , 24 4 William Shakespeare , 25 4 God

nov 2011: 1 11 Merlin Mann , 2 6 Advertising slogans , 3 6 Bill Gates , 4 5 God , 5 5 Martin Luther , 6 5 Charles Darwin , 7 5 List of television shows , 8 5 Albert Einstein , 9 4 Arlo Guthrie , 10 4 Frederick Brotherton Meyer , 11 4 Pimp C , 12 4 Bushwick Bill , 13 4 Michael von Faulhaber , 14 4 Once Upon a Time (TV series) , 15 4 Abraham Lincoln , 16 4 Hell , 17 4 Heart , 18 4 Growth , 19 4 Glee (TV series) , 20 4 The Nostalgia Critic , 21 4 Eminem , 22 4 House (TV series) , 23 4 Pokémon , 24 4 Steve Jobs , 25 4 Joseph Stalin

dez 2011: 1 8 Christopher Hitchens , 2 7 Václav Havel , 3 6 Call of Duty: Modern Warfare 3 , 4 6 Gautama Buddha , 5 6 English proverbs , 6 5 War , 7 5 Love , 8 5 Anthony Trollope , 9 5 Wikipedia , 10 4 Hans Küng , 11 4 Dhirubhai Ambani , 12 4 World War III , 13 4 Ma Anand Sheela , 14 4 Life , 15 4 God , 16 4 Friendship , 17 4 Epitaphs , 18 4 Community (TV series) , 19 4 Jean-Luc Picard , 20 4 Steve Jobs , 21 4 Georg Wilhelm Friedrich Hegel , 22 4 Nineteen Eighty-Four , 23 4 Friedrich Nietzsche , 24 3 Hometown , 25 3 Carmine Crocco

jan 2012: 1 9 Albert Einstein , 2 7 List of films , 3 6 Rocky Marciano , 4 5 Josette Sheeran , 5 5 Charles Scott Sherrington , 6 5 Anaximander , 7 5 Quotations , 8 5 The Nostalgia Critic , 9 5 Lil Wayne , 10 5 Muhammad Ali , 11 5 English proverbs , 12 4 Marjorie Boulton , 13 4 Gustavo Gutierrez , 14 4 William Pfaff , 15 4 Dmitri Mendeleev , 16 4 John Cassian , 17 4 Isadora Duncan , 18 4 Otto Dix , 19 4 Z-Ro , 20 4 Ludwig Hohl , 21 4 Mustafa Abdul Jalil , 22 4 Eazy-E , 23 4 Ludacris , 24 4 Nonsense , 25 4 War

fev 2012: 1 6 List of films , 2 5 Ram Dass , 3 5 Total Drama Island , 4 5 Ruth Nanda Anshen , 5 5 Erma Bombeck , 6 5 Candles , 7 5 Joan Maragall , 8 5 Johan Cruyff , 9 5 Josh Homme , 10 5 Lewis Pugh , 11 5 Victorious , 12 5 On Writing , 13 5 Rick Santorum , 14 5 John F. Kennedy , 15 5 Albert Einstein , 16 4 Keiji Nishitani , 17 4 Sheldon Wolin , 18 4 Paul de Lagarde , 19 4 Nastassja Kinski , 20 4 Tarja Halonen , 21 4 Religion , 22 4 Heaven , 23 4 Sherlock (TV series) , 24 4 How I Met Your Mother , 25 4 Earth

mar 2012: 1 6 Last words , 2 6 Albert Einstein , 3 5 The Lorax (film) , 4 5 Patrick Henry , 5 5 Dr. Seuss , 6 5 Mahatma Gandhi , 7 5 Ronald Reagan , 8 5 René Descartes , 9 4 Marilyn Frye , 10 4 Meles Zenawi , 11 4 Howard Thurman , 12 4 Rahul Dravid , 13 4 The Happening (2008 film) , 14 4 Love , 15 4 Eleventh Doctor , 16 4 William Cobbett , 17 4 Star Wars (film) , 18 4 Tenzin Gyatso, 14th Dalai Lama , 19 4 Feminism , 20 4 Leonardo da Vinci , 21 4 List of misquotations , 22 4 Mark Twain , 23 3 The Hunger Games , 24 3 Pedantry , 25 3 Charles H. Fernald

abr 2012: 1 6 The Hunger Games (film) , 2 5 The Big Bang Theory , 3 5 Muammar Gaddafi , 4 4 Ernesto Grassi , 5 4 Herta Müller , 6 4 Violet Trefusis , 7 4 Piper Laurie , 8 4 My Little Pony: Friendship is Magic , 9 4 Jesus , 10 4 Community (TV series) , 11 4 How I Met Your Mother , 12 4 Incorrect predictions , 13 4 Little Richard , 14 4 The Lion King , 15 4 The Matrix (film) , 16 4 English proverbs , 17 4 Theodore Roosevelt , 18 4 Albert Einstein , 19 3 In the Bedroom , 20 3 Boyd K. Packer , 21 3 Johannes Brahms , 22 3 Manav Gupta , 23 3 William Feller , 24 3 Dick Clark , 25 3 Aki Kaurismäki

mai 2012: 1 15 The Avengers (2012 film) , 2 7 Abraham Lincoln , 3 7 Jesus , 4 7 Muammar Gaddafi , 5 7 George Bernard Shaw , 6 5 Vanna Bonta , 7 5 Return of the Jedi , 8 5 Patrick Henry , 9 5 George Orwell , 10 4 Penelope Fitzgerald , 11 4 Jeff Beck , 12 4 Serbia , 13 4 Rob Ford , 14 4 Hubert Selby, Jr. , 15 4 Augusto Boal , 16 4 George Washington , 17 4 The Big Bang Theory , 18 4 Werner Erhard , 19 4 Family , 20 4 Not Another Teen Movie , 21 4 Pokémon , 22 4 Morality , 23 4 Rudyard Kipling , 24 4 List of television shows , 25 4 Franklin D. Roosevelt

jun 2012: 1 6 List of films , 2 5 John Varley , 3 5 Eleventh Doctor , 4 5 Ray Bradbury , 5 5 English proverbs , 6 5 Albert Einstein , 7 4 Transparency , 8 4 Roger Haight , 9 4 Sultan bin Salman bin Abdul-Aziz Al Saud , 10 4 Sister Nivedita , 11 4 Dejan Stojanovic , 12 4 Prometheus (2012 film) , 13 4 Albert Memmi , 14 4 John M. Rodgers , 15 4 Faith , 16 4 New York City , 17 4 Hawaii Five-0 (2010 TV series) , 18 4 Werner Erhard , 19 4 Tenth Doctor , 20 4 Atheism , 21 4 Bobby Fischer , 22 4 Stan Lee , 23 4 Mahatma Gandhi , 24 3 Christopher Wood (writer) , 25 3 LeBron James

jul 2012: 1 12 The Dark Knight Rises , 2 6 God , 3 5 Jerzy Vetulani , 4 5 David Bomberg , 5 5 Wilson Harris , 6 5 Barack Obama , 7 5 Carl Sagan , 8 5 Albert Einstein , 9 4 Leszek Kołakowski , 10 4 George Goodman , 11 4 Radio Télévision Libre des Mille Collines , 12 4 Richard Rohr , 13 4 Elizabeth May , 14 4 A Bridge Too Far (film) , 15 4 Rayner Heppenstall , 16 4 Chris Patten , 17 4 The Newsroom (U.S. TV series) , 18 4 Abraham Lincoln , 19 4 Thomas Henry Huxley , 20 4 Al Gore , 21 4 Thomas Mann , 22 4 Helen Keller , 23 4 Latin proverbs , 24 3 Organization , 25 3 Susan Cooper

ago 2012: 1 12 The Dark Knight Rises , 2 10 List of television shows , 3 9 Mitt Romney , 4 8 Barack Obama , 5 7 Dragon Ball Z: Season 1 , 6 6 Evelyn Underhill , 7 6 The Avengers (2012 film) , 8 6 Supernatural (U.S. TV series) , 9 6 Karl Popper , 10 5 SummerSlam , 11 5 Thomas Jefferson , 12 5 How I Met Your Mother , 13 5 Daffy Duck , 14 5 James Madison , 15 5 Mahatma Gandhi , 16 5 List of literary works , 17 5 Latin proverbs , 18 4 James Howard Kunstler , 19 4 Robert Adair (physicist) , 20 4 V. V. S. Laxman , 21 4 Aramaic proverbs , 22 4 Dan Millman , 23 4 Eek! the Cat , 24 4 Eddie Cantor , 25 4 Gurren Lagann

set 2012: 1 11 Eleventh Doctor , 2 10 Dragon Ball Z: Season 6 , 3 7 Albert Einstein , 4 6 Dragon Ball: General Blue Saga , 5 6 Dragon Ball , 6 6 Mitt Romney , 7 6 Terence McKenna , 8 5 Robert Greene (American author) , 9 5 Camilla, Duchess of Cornwall , 10 5 Religion , 11 5 Dragon Ball: Commander Red Saga , 12 5 Dragon Ball: Tournament Saga , 13 5 Dragon Ball GT: Season 2 , 14 5 Dragon Ball Z: Season 4 , 15 5 Ysabella Brave , 16 5 Dragon Ball GT , 17 5 English proverbs , 18 4 Stella Gibbons , 19 4 Linh Nga , 20 4 Kirby Page , 21 4 Stella Adler , 22 4 Dragon Ball: Piccolo Jr. Saga , 23 4 Dragon Ball: Tien Shinhan Saga , 24 4 Dragon Ball Z: Season 9 , 25 4 Dragon Ball Z: Season 8

out 2012: 1 7 Albert Einstein , 2 6 Lewis H. Morgan , 3 6 Con Houlihan , 4 6 Thomas Jefferson , 5 6 Mitt Romney , 6 6 English proverbs , 7 5 Salman Khan , 8 5 A History of the Warfare of Science with Theology in Christendom , 9 5 Education , 10 5 NCIS (TV series) , 11 5 Last words , 12 4 Farah Pahlavi , 13 4 MediaWiki , 14 4 Walter Raleigh (professor) , 15 4 Derek Jeter , 16 4 Andrei Zhdanov , 17 4 Punjabi proverbs , 18 4 Cloud Atlas (film) , 19 4 Juhani Pallasmaa , 20 4 English proverbs (alphabetically by proverb) , 21 4 Death , 22 4 Dragon Ball: Piccolo Jr. Saga , 23 4 Dragon Ball: Tien Shinhan Saga , 24 4 Dragon Ball: Commander Red Saga , 25 4 Michelle Obama

nov 2012: 1 6 Chris Colfer , 2 6 Barack Obama , 3 6 List of television shows , 4 6 English proverbs , 5 5 Richard T. Ely , 6 5 Love , 7 5 The Big Bang Theory , 8 5 Thomas Paine , 9 5 Albert Einstein , 10 4 Patrice O'Neal , 11 4 William Gilbert (astronomer) , 12 4 Hipponax , 13 4 William Luther Pierce , 14 4 Klemens von Metternich , 15 4 Isaac Deutscher , 16 4 Sleeper (1973 film) , 17 4 Eduard Pestel , 18 4 Mihajlo D. Mesarovic , 19 4 The Librarian: Curse of the Judas Chalice , 20 4 Salman al-Ouda , 21 4 Liam Hemsworth , 22 4 Justin Bieber , 23 4 Software , 24 4 The Empire Strikes Back , 25 4 Men in Black (film)

dez 2012: 1 7 Eleventh Doctor , 2 7 Albert Einstein , 3 6 Marlene Dietrich , 4 5 Elizabeth Stuart Phelps Ward , 5 4 Kip McKean , 6 4 The Wild One , 7 4 Arnold Lunn , 8 4 Sandy Hook Elementary School shooting , 9 4 Elizabeth Drew Stoddard , 10 4 Alice Meynell , 11 4 Diederik Stapel , 12 4 Edward Higgins White , 13 4 Matilda (film) , 14 4 Isoroku Yamamoto , 15 4 Ronald Reagan , 16 4 Henry Miller , 17 4 Theodore Roosevelt , 18 4 Chinese proverbs , 19 3 James Grant Wilson , 20 3 The Monkees , 21 3 The Odd Couple (film) , 22 3 David Cronenberg , 23 3 Ronnie Radke , 24 3 Wild Strawberries (film) , 25 3 E. W. Howe

jan 2013: 1 7 Thomas Jefferson , 2 6 Michael Dummett , 3 6 Men in Black (film) , 4 6 Bertrand Russell , 5 5 Nicki Minaj , 6 5 Henry Gee , 7 5 The Dark Knight Rises , 8 5 Religion , 9 5 Abraham Lincoln , 10 5 The Big Bang Theory , 11 5 Barack Obama , 12 5 Charles Darwin , 13 5 René Descartes , 14 4 Gottlob Frege , 15 4 Fausto Cercignani , 16 4 Aaron Swartz , 17 4 Welcome to the N.H.K. , 18 4 Norman Maclean , 19 4 Zakir Naik , 20 4 Elia Kazan , 21 4 R. P. Blackmur , 22 4 Dane Clark , 23 4 S. M. Krishna , 24 4 Thomas Dewar, 1st Baron Dewar , 25 4 Ibn Saud

fev 2013: 1 6 Fausto Cercignani , 2 6 Jesus , 3 6 The Dark Crystal , 4 6 Phineas and Ferb , 5 6 The Big Bang Theory , 6 6 Curtis Sittenfeld , 7 6 Charles Darwin , 8 6 Thomas and Friends , 9 5 Roy E. Disney , 10 5 Jussi Halla-aho , 11 5 Ben Carson , 12 5 Marcin Malek , 13 5 Love , 14 5 Men in Black II , 15 5 War of the Worlds (2005 film) , 16 5 Richard Feynman , 17 5 Terminator 2: Judgment Day , 18 5 Aristotle , 19 4 Malcolm Azania , 20 4 Carole Morin , 21 4 Hafizullah Amin , 22 4 Nguyen Khanh , 23 4 Psy , 24 4 Sam Keen , 25 4 Omar Mukhtar

mar 2013: 1 6 Hell's Kitchen (uncensored) , 2 6 Hugo Chávez , 3 5 Ernest Dimnet , 4 5 Thomas and Friends , 5 5 George Carlin , 6 5 Bertrand Russell , 7 4 Zheng Yuanjie , 8 4 Evalyn Gates , 9 4 Bassel Khartabil , 10 4 Pope Francis , 11 4 R. K. Narayan , 12 4 Dagobert von Gerhardt , 13 4 Tao Yuanming , 14 4 René Guénon , 15 4 Education , 16 4 The Dark Crystal , 17 4 Censorship , 18 4 Michel de Montaigne , 19 4 List of television shows , 20 4 Firearm , 21 4 John F. Kennedy , 22 4 English proverbs , 23 4 Linus Torvalds , 24 3 Val Kilmer , 25 3 Anti-intellectualism

abr 2013: 1 9 Margaret Thatcher , 2 8 Benjamin Franklin , 3 7 George Washington , 4 7 Eleventh Doctor , 5 6 Love , 6 6 Roger Ebert , 7 6 Albert Einstein , 8 5 Mohamed Nasheed , 9 5 Death and funeral of Margaret Thatcher , 10 5 Joan Crawford , 11 5 David Feherty , 12 5 Pietro Mennea , 13 5 George Orwell , 14 4 Conformity , 15 4 Dialectic , 16 4 Yeh Kuang-shih , 17 4 Henri Peyre , 18 4 Remy de Gourmont , 19 4 Paul Foot , 20 4 Pauline Johnson , 21 4 Archibald Lampman , 22 4 Argo (2012 film) , 23 4 San Francisco , 24 4 Time , 25 4 Nayef Al-Rodhan

mai 2013: 1 8 Eleventh Doctor , 2 7 Mahatma Gandhi , 3 7 Albert Einstein , 4 5 Milton S. Mayer , 5 5 The Big Bang Theory , 6 5 The Truman Show , 7 5 Richard Feynman , 8 5 List of films , 9 4 Tyler Perry , 10 4 Why the lucky stiff , 11 4 Star Trek Into Darkness , 12 4 Scott Pelley , 13 4 Iron Man 3 , 14 4 Neamat Imam , 15 4 Julie Christie , 16 4 Jacopone da Todi , 17 4 John Woolman , 18 4 Francis J. Grimké , 19 4 Ted Cruz , 20 4 Keith Roberts , 21 4 Jiang Yi-huah , 22 4 Love , 23 4 Abraham Lincoln , 24 4 Kitchen Nightmares , 25 4 The Nostalgia Critic

jun 2013: 1 8 Jimmy Wales , 2 7 Doubt , 3 7 Mark Twain , 4 6 Abraham Lincoln , 5 5 Hassan Rouhani , 6 5 Aldo Capitini , 7 5 Genius , 8 5 Freedom of speech , 9 5 Thomas Jefferson , 10 5 English proverbs , 11 5 Oscar Wilde , 12 5 Albert Einstein , 13 4 Julia Gillard , 14 4 L. S. Lowry , 15 4 Sidney Morgenbesser , 16 4 Edward Snowden , 17 4 Greg Mankiw , 18 4 Alternative medicine , 19 4 Olaf Stapledon , 20 4 Alan Rusbridger , 21 4 William Shakespeare , 22 4 Journalism , 23 4 God , 24 4 Education , 25 4 Enemies

jul 2013: 1 7 Edward Snowden , 2 5 Muhammad Asad , 3 5 Mehdi Akhavan-Sales , 4 5 Sohrab Sepehri , 5 5 List of television shows , 6 5 List of films , 7 5 Mahatma Gandhi , 8 5 Oscar Wilde , 9 4 A Walk to Remember (novel) , 10 4 Julian Trevelyan , 11 4 Malala Yousafzai , 12 4 Shirley MacLaine , 13 4 Napoleon Chagnon , 14 4 Vietnam War , 15 4 Mohamed Morsi , 16 4 William Shakespeare , 17 4 Hell's Kitchen (uncensored) , 18 4 July 30 , 19 4 Return of the Jedi , 20 4 Thomas and Friends , 21 4 Muhammad , 22 4 List of literary works , 23 4 List of people by name , 24 4 Albert Einstein , 25 3 Claude Fayette Bragdon

ago 2013: 1 8 Breaking Bad , 2 5 George Gaylord Simpson , 3 5 Negotiations , 4 5 Vedas , 5 5 Love , 6 5 Democracy , 7 5 Barack Obama , 8 5 Martin Luther King, Jr. , 9 4 Jacque Fresco , 10 4 Charles Cotesworth Pinckney , 11 4 Jonathan Richardson , 12 4 Mozah bint Nasser Al Missned , 13 4 Abraham Lincoln , 14 4 Time , 15 4 Rahul Gandhi , 16 4 The Nostalgia Critic , 17 4 Star Wars: Episode III – Revenge of the Sith , 18 4 List of films , 19 4 René Descartes , 20 4 Albert Einstein , 21 3 Alphonsus Maria de' Liguori , 22 3 Tony Conrad , 23 3 Jules Feiffer , 24 3 Subbayya Sivasankaranarayana Pillai , 25 3 Richard Miles (historian)

set 2013: 1 9 Breaking Bad , 2 6 Muhammad , 3 6 Bill Clinton , 4 5 Love , 5 5 George Washington , 6 5 Ben Croshaw , 7 5 Barack Obama , 8 5 Aristotle , 9 5 Winston Churchill , 10 4 Agents of S.H.I.E.L.D. , 11 4 Grand Theft Auto V , 12 4 Prabowo Subianto , 13 4 The Very Same Munchhausen , 14 4 Religion , 15 4 Truth , 16 4 Abraham Lincoln , 17 4 The Nostalgia Critic , 18 4 King Kong (1933 film) , 19 4 Jiddu Krishnamurti , 20 4 List of films , 21 4 Benjamin Franklin , 22 4 Cicero , 23 4 Albert Einstein , 24 3 Ravindra Prabhat , 25 3 Alfred Legoyt

out 2013: 1 9 Breaking Bad , 2 5 Malala Yousafzai , 3 5 George Washington , 4 5 List of films , 5 5 Isaac Newton , 6 5 Albert Einstein , 7 4 Downfall (2004 film) , 8 4 Life of Pi (film) , 9 4 Jesus , 10 4 The Nostalgia Critic , 11 4 Moral Essays , 12 4 Ernest Renan , 13 4 Lou Reed , 14 4 George Orwell , 15 4 Mahatma Gandhi , 16 4 George W. Bush , 17 4 Voltaire , 18 3 Ernest J. Gaines , 19 3 Hal Colebatch , 20 3 Reggie Watts , 21 3 Walter Rodney , 22 3 First love , 23 3 Steve Stewart-Williams , 24 3 The Strenuous Life: Essays and Addresses , 25 3 Dutch proverbs

nov 2013: 1 5 Abraham Lincoln , 2 5 Tenth Doctor , 3 5 Barack Obama , 4 5 Hillary Clinton , 5 5 Last words , 6 5 Albert Einstein , 7 4 Agents of S.H.I.E.L.D. , 8 4 My Little Pony: Friendship is Magic , 9 4 Love , 10 4 Christianity , 11 4 Eleventh Doctor , 12 4 The Nostalgia Critic , 13 4 1259 , 14 4 How I Met Your Mother , 15 4 L. Ron Hubbard , 16 4 Socrates , 17 4 Titanic (1997 film) , 18 4 Mahatma Gandhi , 19 4 John F. Kennedy , 20 4 Benjamin Franklin , 21 3 C. V. Raman , 22 3 Mohammed VI of Morocco , 23 3 Paul Conrad , 24 3 American Horror Story , 25 3 Homeland (TV series)

dez 2013: 1 13 Nelson Mandela , 2 10 Eleventh Doctor , 3 6 Isaac Newton , 4 5 Paul Eldridge , 5 5 Slavery , 6 5 Breaking Bad , 7 5 The Big Bang Theory , 8 5 A Christmas Carol , 9 5 How I Met Your Mother , 10 5 Last words , 11 5 Aristotle , 12 5 Winston Churchill , 13 4 Mikhail Kalashnikov , 14 4 Hema Malini , 15 4 Tyagaraja , 16 4 James Finlay Weir Johnston , 17 4 American Horror Story , 18 4 Hope , 19 4 God , 20 4 Democracy , 21 4 The Angry Video Game Nerd , 22 4 Paul Walker , 23 4 Bhagavad Gita , 24 4 The Incredibles , 25 4 Søren Kierkegaard

jan 2014: 1 9 Dragon Ball Z: Season 2 , 2 9 Ariel Sharon , 3 8 Dragon Ball: Emperor Pilaf Saga , 4 8 Dragon Ball Z: Season 9 , 5 8 Dragon Ball GT: Season 1 , 6 8 Dragon Ball Z: Season 6 , 7 8 Dragon Ball Z: Season 5 , 8 8 Dragon Ball Z: Season 4 , 9 8 Dragon Ball Z: Season 3 , 10 8 Dragon Ball Z: Bio-Broly , 11 8 Dragon Ball Z: Bojack Unbound , 12 8 Carl Sagan , 13 7 Dragon Ball: Piccolo Jr. Saga , 14 7 Dragon Ball Z: Season 8 , 15 7 Dragon Ball GT: Season 2 , 16 7 Dragon Ball Z: Season 7 , 17 7 The Sopranos: Season 6 , 18 7 The Sopranos: Season 1 , 19 7 Dragon Ball Z: Season 1 , 20 7 Dragon Ball Z: Lord Slug , 21 7 Dragon Ball Z: Broly: Second Coming , 22 7 List of television shows , 23 6 Mahinda Rajapaksa , 24 6 German proverbs , 25 6 Abraham Lincoln

fev 2014: 1 5 George Washington , 2 5 Eleventh Doctor , 3 5 How I Met Your Mother , 4 5 Marquis de Sade , 5 5 Mahatma Gandhi , 6 5 Karl Marx , 7 4 Ellen Page , 8 4 Jackie Chan , 9 4 Arno Gruen , 10 4 Philomena (film) , 11 4 Khem Veasna , 12 4 My Little Pony: Friendship is Magic , 13 4 Hope , 14 4 Dreams , 15 4 The Nostalgia Critic , 16 4 Bones (TV series) , 17 4 Richard Rorty , 18 4 Bob Marley , 19 4 Morgan Freeman , 20 4 Wikipedia , 21 4 John Maynard Keynes , 22 4 Friends (TV series) , 23 4 Steve Jobs , 24 4 Muhammad , 25 4 Carl Sagan

mar 2014: 1 11 Bob Marley , 2 8 Peace , 3 8 Love , 4 7 Abraham Lincoln , 5 6 Harry Harrison (writer) , 6 6 How I Met Your Mother , 7 6 List of films , 8 6 Bertrand Russell , 9 5 World Soul , 10 5 Eve , 11 5 United 93 (film) , 12 5 Annie Besant , 13 5 True Detective , 14 5 Intelligence (U.S. TV series) , 15 5 Frozen (2013 film) , 16 5 Michael Jackson , 17 5 Virgil , 18 5 Freeman Dyson , 19 5 English proverbs , 20 5 Aristotle , 21 5 Albert Einstein , 22 4 G. Stanley Hall , 23 4 Roy Campanella , 24 4 Ethical movement , 25 4 Kannada proverbs

abr 2014: 1 6 Fahrenheit 451 , 2 6 Jean-Jacques Rousseau , 3 6 Harry S. Truman , 4 5 Hannibal (TV series) , 5 5 Materialism , 6 5 Breaking Bad , 7 5 How I Met Your Mother , 8 5 Advertising slogans , 9 5 John F. Kennedy , 10 5 Theodore Roosevelt , 11 5 Albert Einstein , 12 4 Muhammad Ilyas Qadri , 13 4 Joseph B. Soloveitchik , 14 4 Georgios Papadopoulos , 15 4 Adoration , 16 4 Adrian Newey , 17 4 Aliko Dangote , 18 4 Pratibha Patil , 19 4 Thiago Silva , 20 4 Sumit Chowdhury , 21 4 Sudhir Ruparelia , 22 4 This Is the End , 23 4 The Avengers (2012 film) , 24 4 Abraham Lincoln , 25 4 Victorious

mai 2014: 1 10 Elliot Rodger , 2 7 Benjamin Franklin , 3 6 Henry Ford , 4 5 Katie Hopkins , 5 5 Neil Harbisson , 6 5 Work , 7 5 Love , 8 5 Kristen Stewart , 9 5 Eleventh Doctor , 10 5 Noam Chomsky , 11 5 Albert Einstein , 12 4 Teen Titans/Season 2 , 13 4 Fear of God , 14 4 Holly Johnson , 15 4 Sung Jae-gi , 16 4 Rajiv Gandhi , 17 4 Money , 18 4 Abraham Lincoln , 19 4 Freedom , 20 4 F. E. Smith, 1st Earl of Birkenhead , 21 4 Barry Michaels , 22 4 James A. Garfield , 23 4 Super Metroid , 24 4 Friedrich Hayek , 25 4 Michelangelo

jun 2014: 1 6 The Incredibles , 2 6 Steve Jobs , 3 5 Love , 4 5 Theodore Roosevelt , 5 5 Niels Bohr , 6 5 Bertrand Russell , 7 4 Hermeneutics , 8 4 Richard Burton , 9 4 Jean-Baptiste-Camille Corot , 10 4 J. Gordon Melton , 11 4 Camille Pissarro , 12 4 Impressionism , 13 4 WWE Raw , 14 4 My Little Pony: Friendship is Magic , 15 4 Abraham Lincoln , 16 4 Life , 17 4 Liberty , 18 4 Pierre-Auguste Renoir , 19 4 Josef Albers , 20 4 Total Recall (1990 film) , 21 4 Claude Monet , 22 4 Ben 10 (2005 TV series) , 23 4 Simone Weil , 24 4 Sam Harris , 25 4 Joseph Stalin

jul 2014: 1 7 Albert Einstein , 2 6 Earthquake , 3 6 Theodore Roosevelt , 4 5 Perfection , 5 5 Time , 6 5 The Nostalgia Critic , 7 5 Boxing , 8 5 Wikipedia , 9 5 Isaac Newton , 10 4 Lucy (2014 film) , 11 4 Joep Lange , 12 4 Calculus , 13 4 How to Marry a Millionaire , 14 4 Geology , 15 4 Jordan , 16 4 Allan Kardec , 17 4 Spiritism , 18 4 Lorde , 19 4 RuPaul , 20 4 William Shakespeare quotes about war , 21 4 War , 22 4 Life , 23 4 Dreams , 24 4 Ambition , 25 4 Israel

ago 2014: 1 10 Benjamin Franklin , 2 9 Robin Williams , 3 6 Catherine II of Russia , 4 6 Chinese proverbs , 5 5 Guardians of the Galaxy (film) , 6 5 Abraham Lincoln , 7 5 Alfred Kinsey , 8 5 Albert Einstein , 9 4 William Graham Sumner , 10 4 Sania Mirza , 11 4 Akshay Kumar , 12 4 Allegheny Mountains , 13 4 Libeled Lady , 14 4 Phoenix, Arizona , 15 4 Samuel T. Cohen , 16 4 Twelfth Doctor , 17 4 Law , 18 4 Evil , 19 4 George Washington , 20 4 New York City , 21 4 The Nostalgia Critic , 22 4 Michelle Obama , 23 4 Elvis Costello , 24 4 Law & Order , 25 4 The Hitchhiker's Guide to the Galaxy

set 2014: 1 8 Twelfth Doctor , 2 6 Matilda (film) , 3 6 List of television shows , 4 5 Love , 5 5 Marcus Garvey , 6 5 List of films , 7 5 Albert Einstein , 8 4 Joseph Ritson , 9 4 Carry On Cruising , 10 4 Rudy Rucker , 11 4 War , 12 4 Christianity , 13 4 Eleventh Doctor , 14 4 The Nostalgia Critic , 15 4 Thomas Jefferson , 16 4 Philo , 17 4 The Empire Strikes Back , 18 4 Star Wars: Episode III – Revenge of the Sith , 19 4 Who Framed Roger Rabbit , 20 4 Eduard Shevardnadze , 21 4 Friedrich Hayek , 22 4 Shrek , 23 3 Marissa Mayer , 24 3 Henry IV of France , 25 3 Orange Is the New Black

out 2014: 1 6 Drake & Josh , 2 5 Twelfth Doctor , 3 5 Malala Yousafzai , 4 5 Abraham Lincoln , 5 5 Intelligence , 6 4 Ebola virus disease , 7 4 Yrjö Kallinen , 8 4 Kailash Satyarthi , 9 4 Introspection , 10 4 Alex Salmond , 11 4 Now , 12 4 Intellectual , 13 4 The All , 14 4 Peace , 15 4 Truth , 16 4 Philosophy , 17 4 God , 18 4 Architecture , 19 4 George Washington , 20 4 Taken (film) , 21 4 The Big Bang Theory , 22 4 Follow the Rabbit Proof Fence , 23 4 Hinduism , 24 4 Sex and the City , 25 4 William James

nov 2014: 1 9 Twelfth Doctor , 2 7 VeggieTales , 3 6 Love , 4 6 Master (Doctor Who) , 5 6 Augustine of Hippo , 6 5 Peace , 7 5 George Washington , 8 5 Last words in Disney animated films , 9 5 Katherine Mansfield , 10 5 Virginia Woolf , 11 5 Albert Einstein , 12 4 Paul von Hindenburg , 13 4 Necropolis , 14 4 Alec Reed , 15 4 The Flash (2014 TV series) , 16 4 This Is the End , 17 4 Pope Francis , 18 4 The Civil War (documentary) , 19 4 Mercy , 20 4 Abraham Lincoln , 21 4 God , 22 4 Democracy , 23 4 Diversity , 24 4 Dragon Ball Z: The World's Strongest , 25 4 Michelle Obama

dez 2014: 1 7 VeggieTales , 2 7 George Washington , 3 7 Hell's Kitchen (uncensored) , 4 7 Elizabeth I of England , 5 6 Barack Obama , 6 6 Steve Jobs , 7 5 Assata Shakur , 8 5 Ridley Scott , 9 5 Wreck-It Ralph , 10 5 James D. Watson , 11 5 John F. Kennedy , 12 5 Dwight D. Eisenhower , 13 4 Jason Biggs , 14 4 Interstellar (film) , 15 4 Big Hero 6 (film) , 16 4 Pope Francis , 17 4 Pittsburgh , 18 4 God , 19 4 Akira Toriyama , 20 4 Law & Order: Special Victims Unit , 21 4 Matilda (film) , 22 4 Master (Doctor Who) , 23 4 Final Fantasy Tactics Advance , 24 4 Hercules (1997 film) , 25 4 Wikipedia

jan 2015: 1 7 Frozen (2013 film) , 2 7 George W. Bush , 3 6 John Senior , 4 6 Fuck (film) , 5 6 Action , 6 5 Twelfth Doctor , 7 5 Nobility , 8 5 George Washington , 9 5 A Christmas Carol , 10 5 David Duke , 11 5 Barack Obama , 12 5 J. R. R. Tolkien , 13 5 List of films , 14 4 E (mathematical constant) , 15 4 Legend of the Guardians: The Owls of Ga'Hoole , 16 4 Henry Calvert Simons , 17 4 Ada Lovelace , 18 4 Apollonius of Tyana , 19 4 American Reunion , 20 4 The Hobbit: The Battle of the Five Armies , 21 4 Iggy Azalea , 22 4 Peace , 23 4 Love , 24 4 Faith , 25 4 Kalki

fev 2015: 1 8 List of films , 2 7 Lyndon B. Johnson , 3 6 War , 4 6 George Washington , 5 5 Alexander II of Russia , 6 5 Abraham Lincoln , 7 5 Justin Bieber , 8 5 The Truman Show , 9 5 Barack Obama , 10 5 Arnold Schwarzenegger , 11 5 Martin Luther King, Jr. , 12 4 Upbuilding Discourses in Various Spirits , 13 4 Mind–body problem , 14 4 Mind , 15 4 Shrek , 16 4 Alexander the Great , 17 4 Ronald Reagan , 18 4 Mark Twain , 19 3 Game of Death , 20 3 Horrible Bosses 2 (film) , 21 3 Barry Mazur , 22 3 What's Wrong with the World , 23 3 Mia Couto , 24 3 Better Call Saul , 25 3 Shepard Smith

mar 2015: 1 7 Benjamin Franklin , 2 5 George Washington , 3 5 Barack Obama , 4 5 G. K. Chesterton , 5 5 Terry Pratchett , 6 5 Friedrich Nietzsche , 7 5 Mark Twain , 8 4 The Game of Death , 9 4 Milky Way , 10 4 Love , 11 4 God , 12 4 Jesus , 13 4 The Nostalgia Critic , 14 4 Benjamin Netanyahu , 15 4 Otto von Bismarck , 16 4 Friedrich Hayek , 17 4 Lyndon B. Johnson , 18 4 Bruce Lee , 19 4 Margaret Thatcher , 20 4 Into the Woods , 21 4 Thomas Browne , 22 4 List of films , 23 4 Race , 24 4 John F. Kennedy , 25 4 Albert Einstein

abr 2015: 1 5 Game of Thrones , 2 5 Barack Obama , 3 5 Friends (TV series) , 4 5 Steve Jobs , 5 5 List of television shows , 6 4 Hell's Kitchen (uncensored) , 7 4 CSI: Crime Scene Investigation , 8 4 John Brown (abolitionist) , 9 4 Law & Order: Special Victims Unit , 10 4 Matilda (film) , 11 4 Robot Chicken , 12 4 Star Trek: The Original Series , 13 4 How I Met Your Mother , 14 4 Law & Order , 15 4 The Hitchhiker's Guide to the Galaxy , 16 4 Plato , 17 4 C. S. Lewis , 18 4 Publilius Syrus , 19 4 Adolf Hitler , 20 4 Winston Churchill , 21 4 Albert Einstein , 22 3 Mexico , 23 3 Supernatural (season 10) , 24 3 Mordechai Anielewicz , 25 3 Daredevil (TV series)

mai 2015: 1 7 Albert Einstein , 2 5 Game of Thrones , 3 5 Brave New World , 4 4 Dean Martin , 5 4 Avengers: Age of Ultron , 6 4 Jesus , 7 4 Australia , 8 4 Full House , 9 4 John Forbes Nash, Jr. , 10 4 Socrates , 11 4 Adolf Hitler , 12 3 Jacques Lipchitz , 13 3 Genetics , 14 3 Works of Love (Kierkegaard) , 15 3 Maneka Gandhi , 16 3 Jacques-Louis Ménétra , 17 3 Kingdom of France , 18 3 François Hollande , 19 3 Rosie Malek-Yonan , 20 3 Pamela Geller , 21 3 Book of Jeremiah , 22 3 One Direction , 23 3 Door , 24 3 Love , 25 3 Justice

jun 2015: 1 6 Game of Thrones , 2 6 The Nostalgia Critic , 3 5 Hope Solo , 4 4 Special agent dale cooper , 5 4 Avengers: Age of Ultron , 6 4 Louis XIV of France , 7 4 Law & Order , 8 4 Toy Story , 9 4 Patrick Henry , 10 4 Barack Obama , 11 4 Helen Keller , 12 4 Thomas Paine , 13 4 George W. Bush , 14 3 Maximilien Misson , 15 3 Hans Keller , 16 3 Du Fu , 17 3 Paul Celan , 18 3 Nicholas Rescher , 19 3 Arnold Berleant , 20 3 Leda Cosmides , 21 3 Fifty Shades of Grey (film) , 22 3 John L. Heilbron , 23 3 Racism in South Korea , 24 3 Korea under Japanese rule , 25 3 Dambisa Moyo

jul 2015: 1 6 Love , 2 6 The Nostalgia Critic , 3 6 List of misquotations , 4 5 True Detective , 5 5 My Little Pony: Friendship is Magic , 6 5 Slavery , 7 5 Marriage , 8 5 Fictional last words in films , 9 5 Barack Obama , 10 5 Gautama Buddha , 11 4 Francis George , 12 4 Pat Sajak , 13 4 Gluttony , 14 4 Yane Sandanski , 15 4 Threads , 16 4 Motion , 17 4 Suffering , 18 4 Frailty , 19 4 Failure , 20 4 Matilda (film) , 21 4 American Civil War , 22 4 The Grim Adventures of Billy & Mandy , 23 4 Arthur (TV series) , 24 4 Plato , 25 4 Donald Trump

ago 2015: 1 7 Love , 2 6 George W. Bush , 3 6 Theodore Roosevelt , 4 5 Atheism , 5 5 John Quincy Adams , 6 5 Romeo and Juliet , 7 4 Time management , 8 4 Dictatorship of the proletariat , 9 4 Centrism , 10 4 South Korea , 11 4 Jesus , 12 4 George Washington , 13 4 Willy Russell , 14 4 Cuba , 15 4 Socialism , 16 4 Calvin Coolidge , 17 4 Lyndon B. Johnson , 18 4 Barack Obama , 19 4 Plato , 20 4 Donald Trump , 21 4 Joseph Stalin , 22 4 Socrates , 23 4 Firearm , 24 4 David Hume , 25 4 Mahatma Gandhi

set 2015: 1 8 Alaska Thunderfuck 5000 , 2 8 John Hancock , 3 8 Yogi Berra , 4 7 Fred Hampton , 5 6 Science and religion , 6 6 Abraham Lincoln , 7 5 No Gun Ri Massacre , 8 5 The Legend of Korra , 9 5 War , 10 5 American Revolution , 11 5 Ovid , 12 5 Donald Trump , 13 5 James Madison , 14 5 Adolf Hitler , 15 5 Aristotle , 16 5 Albert Einstein , 17 4 William Nordhaus , 18 4 God is dead , 19 4 Akeel Bilgrami , 20 4 Brad Garrett , 21 4 Inside Out (2015 film) , 22 4 Twelfth Doctor , 23 4 William Shakespeare , 24 4 Love , 25 4 Freedom

out 2015: 1 5 Love , 2 5 List of people by name, S , 3 5 Sonic the Hedgehog , 4 5 Barack Obama , 5 5 Augustine of Hippo , 6 4 Marianne von Werefkin , 7 4 Spacetime , 8 4 Hafez , 9 4 Mattin , 10 4 Kenji Goto , 11 4 Jim Henson , 12 4 Power , 13 4 Casper (film) , 14 4 Milton Friedman , 15 4 Willy Wonka & the Chocolate Factory , 16 4 Donald Trump , 17 4 Ayn Rand , 18 4 Mahatma Gandhi , 19 4 Albert Einstein , 20 3 Chinese language , 21 3 Henry Becque , 22 3 Undertale , 23 3 Giorgio de Santillana , 24 3 Kenneth Noland , 25 3 Walter Eucken

nov 2015: 1 7 Donald Trump , 2 7 Back to the Future , 3 6 Jim Henson , 4 6 Abraham Lincoln , 5 6 Barack Obama , 6 5 November 2015 Paris attacks , 7 5 Jean Jullien , 8 5 Twelfth Doctor , 9 5 Love , 10 5 Sailor Moon , 11 5 Wikipedia , 12 5 Joseph Stalin , 13 5 Confucius , 14 4 Olavo de Carvalho , 15 4 Benedetto Croce , 16 4 Godzilla (1954 film) , 17 4 Ben Carson , 18 4 God , 19 4 George Washington , 20 4 Snow White and the Seven Dwarfs (1937 film) , 21 4 Australia , 22 4 Thomas Jefferson , 23 4 Star Wars (film) , 24 4 Mighty Morphin Power Rangers , 25 4 Vladimir Putin

dez 2015: 1 8 Star Wars: The Force Awakens , 2 7 Donald Trump , 3 6 Downfall (2004 film) , 4 6 Star Wars: Episode I – The Phantom Menace , 5 6 Barack Obama , 6 6 Fascism , 7 5 Death , 8 5 United States , 9 5 Star Wars: Episode III – Revenge of the Sith , 10 5 Libertarianism , 11 5 Beetlejuice , 12 5 John F. Kennedy , 13 4 Max Payne 3 , 14 4 Babes in Toyland (1934 film) , 15 4 Centralisation , 16 4 Mark of Love , 17 4 Love , 18 4 Cloudy with a Chance of Meatballs (film) , 19 4 The Lord of the Rings: The Fellowship of the Ring , 20 4 One Flew Over the Cuckoo's Nest (film) , 21 4 Return of the Jedi , 22 4 The Empire Strikes Back , 23 4 Star Wars (film) , 24 4 Time Bandits , 25 4 Augustine of Hippo

jan 2016: 1 10 Donald Trump , 2 9 Barack Obama , 3 7 Franklin D. Roosevelt , 4 7 Albert Einstein , 5 6 Death , 6 5 Moe (slang) , 7 5 Slavery , 8 5 Education , 9 5 United States , 10 5 Thomas Jefferson , 11 5 Capitalism , 12 5 Adolf Hitler , 13 4 Cleansing of the Temple , 14 4 Batman: The Brave and the Bold , 15 4 Star Wars: The Force Awakens , 16 4 Genocide , 17 4 Islamic State of Iraq and the Levant , 18 4 Japan , 19 4 Bernie Sanders , 20 4 Malala Yousafzai , 21 4 Gurren Lagann , 22 4 The Dark Knight Rises , 23 4 Science , 24 4 Money , 25 4 Abraham Lincoln

fev 2016: 1 9 Antonin Scalia , 2 7 Star Wars: The Force Awakens , 3 6 Pope Francis , 4 6 Education , 5 5 X-Men: Days of Future Past , 6 5 Jesus , 7 5 Terrorism , 8 4 Peter Ladefoged , 9 4 Finland , 10 4 Head , 11 4 Bernie Sanders , 12 4 Anonymous (group) , 13 4 X-Men: First Class , 14 4 Youth , 15 4 Money , 16 4 Abraham Lincoln , 17 4 Freedom , 18 4 George Washington , 19 4 How I Met Your Mother , 20 4 Donald Trump , 21 4 John Locke , 22 4 Firearm , 23 4 Franklin D. Roosevelt , 24 4 Ronald Reagan , 25 4 Animal Farm

mar 2016: 1 7 Donald Trump , 2 7 Adolf Hitler , 3 5 Star Wars: The Force Awakens , 4 5 Socialism , 5 5 Benito Mussolini , 6 5 Albert Einstein , 7 4 Portia de Rossi , 8 4 Zootopia , 9 4 Mark Hertling , 10 4 Porphyry (philosopher) , 11 4 Roger MacBride , 12 4 Cosmos: A Spacetime Odyssey , 13 4 Malala Yousafzai , 14 4 Argo (2012 film) , 15 4 Religion , 16 4 Politics , 17 4 War , 18 4 Love , 19 4 Democracy , 20 4 The Giver , 21 4 Mario (franchise) , 22 4 The Wedding Singer , 23 4 Thomas Jefferson , 24 4 William G. Boykin , 25 4 Star Wars (film)

abr 2016: 1 6 Batman v Superman: Dawn of Justice , 2 5 Supergirl (TV series) , 3 5 Robbie Coburn , 4 5 Eric Foner , 5 5 The Flash (2014 TV series) , 6 5 War , 7 5 Superman , 8 5 Hillary Clinton , 9 5 Albert Einstein , 10 4 Zootopia , 11 4 Science , 12 4 Quotations , 13 4 Electricity , 14 4 Prince (musician) , 15 4 Torture , 16 4 Socialism , 17 4 Patrick Henry , 18 4 Barack Obama , 19 4 Fascism , 20 4 Mahatma Gandhi , 21 3 John Palfrey , 22 3 William J. Locke , 23 3 Molecular clock , 24 3 Comparison of Fascism and Socialism , 25 3 Mark W. Clark

mai 2016: 1 6 Nigel Cumberland , 2 6 Donald Trump , 3 6 Mahatma Gandhi , 4 5 The Flash (2014 TV series) , 5 5 X-Men: First Class , 6 5 Barack Obama , 7 5 Muhammad , 8 5 Last words , 9 4 Captain America: Civil War , 10 4 Supergirl (TV series) , 11 4 X-Men: Days of Future Past , 12 4 Government , 13 4 September 11 attacks , 14 4 X2 (film) , 15 4 Batman (1989 film) , 16 4 G. H. Hardy , 17 4 X-Men (film) , 18 4 Mark Twain , 19 4 Albert Einstein , 20 3 X-Men: Apocalypse , 21 3 South Vietnam , 22 3 Religion in the United States , 23 3 Jill Stein , 24 3 Elbridge G. Spaulding , 25 3 Lucifer (TV series)

jun 2016: 1 9 Donald Trump , 2 8 Hillary Clinton , 3 7 Barack Obama , 4 6 David Duke , 5 6 Friedrich Nietzsche , 6 5 Game of Thrones/Season 6 , 7 5 Work , 8 5 Muhammad Ali , 9 5 Benito Mussolini , 10 4 Non-Euclidean geometry , 11 4 Nazism , 12 4 The Dark Knight (film) , 13 4 Osama bin Laden , 14 4 Last words , 15 4 Winston Churchill , 16 3 Sodom and Gomorrah , 17 3 Democratic Republic of the Congo , 18 3 Wyoming , 19 3 The Day of the Triffids (film) , 20 3 Milo Yiannopoulos , 21 3 Martyn Percy , 22 3 David Mumford , 23 3 Kenan Malik , 24 3 One Million Years B.C. , 25 3 Captain America: Civil War

jul 2016: 1 10 Donald Trump , 2 6 Osama bin Laden , 3 6 Benito Mussolini , 4 5 Mike Pence , 5 5 Ken Ham , 6 5 William Luther Pierce , 7 5 Kent Hovind , 8 5 Franklin D. Roosevelt , 9 4 Manuel Valls , 10 4 Francesca Carrara , 11 4 Gay Talese , 12 4 Batman v Superman: Dawn of Justice , 13 4 The Nostalgia Critic/Season 8 , 14 4 Division of labor , 15 4 Religion , 16 4 War , 17 4 Love , 18 4 Law , 19 4 Prussian Blue , 20 4 Elie Wiesel , 21 4 Hillary Clinton , 22 3 Ashraf Pahlavi , 23 3 Leonard Jimmie Savage , 24 3 Ivanka Trump , 25 3 Léon Blum

ago 2016: 1 9 Donald Trump , 2 9 Albert Einstein , 3 7 War , 4 6 Khizr and Ghazala Khan , 5 6 Hillary Clinton , 6 5 A. James Gregor , 7 5 Zootopia , 8 5 Love , 9 5 Barack Obama , 10 5 Arthur Schopenhauer , 11 5 Friedrich Nietzsche , 12 4 Suicide Squad (film) , 13 4 Tibor R. Machan , 14 4 William J. Baumol , 15 4 Fyodor Dan , 16 4 The Fresh Prince of Bel-Air (season 4) , 17 4 Politics , 18 4 Happiness , 19 4 The Angry Video Game Nerd , 20 4 Republican Party (United States) , 21 4 V for Vendetta (film) , 22 4 Fascism , 23 4 Ronald Reagan , 24 4 Mark Twain , 25 3 Julie Adams

set 2016: 1 7 Hillary Clinton , 2 7 Mother Teresa , 3 7 Donald Trump , 4 4 Denis Mack Smith , 5 4 Antonine Maillet , 6 4 Love , 7 4 Toy Story , 8 3 Donald Trump Jr. , 9 3 Frank Sherwood Rowland , 10 3 Pacatus Drepanius , 11 3 The Big Bang Theory (season 10) , 12 3 Vladimir Voevodsky , 13 3 Louis Hémon , 14 3 Jules Michelet , 15 3 Jules Sandeau , 16 3 Ilia Chavchavadze , 17 3 The Night Walker (film) , 18 3 Robert A. Hall , 19 3 Joseph Masclet , 20 3 Wheeler L. Baker , 21 3 How I Met Your Mother (season 6) , 22 3 Sergio Leone , 23 3 Reinhard Selten , 24 3 Pokémon/Season 7 , 25 3 Monsters University

out 2016: 1 9 Donald Trump , 2 6 Winston Churchill , 3 5 François Furet , 4 5 William Shakespeare quotes about death , 5 5 Hillary Clinton , 6 5 Alfred North Whitehead , 7 4 Detroit , 8 4 Great Recession , 9 4 Pramukh Swami Maharaj , 10 4 Deadpool (film) , 11 4 Spectre (2015 film) , 12 4 Love , 13 4 Alan Moore , 14 4 André Malraux , 15 4 Benito Mussolini , 16 4 Mahatma Gandhi , 17 4 Leo Tolstoy , 18 4 Albert Einstein , 19 3 Hiroshima (book) , 20 3 Bret Hart , 21 3 Hong Kong , 22 3 Jessica Drake , 23 3 The West (film) , 24 3 Robert Cormier , 25 3 Epistle of Jude

nov 2016: 1 13 Donald Trump , 2 9 Fidel Castro , 3 6 Democracy , 4 5 Doctor Strange (film) , 5 5 Love , 6 5 Hillary Clinton , 7 4 Götz Aly , 8 4 Evan McMullin , 9 4 Future , 10 4 The Wire , 11 4 Leonard Cohen , 12 4 Fascism , 13 4 Johann Wolfgang von Goethe , 14 4 Elvis Presley , 15 4 Mark Twain , 16 3 David Berg , 17 3 Michael T. Flynn , 18 3 Khalid A. Al-Falih , 19 3 Muhyiddin Yassin , 20 3 Yes , 21 3 Horseshoe theory , 22 3 Tracey Ullman's Show , 23 3 Ichiro Suzuki , 24 3 Harry Harlow , 25 3 Anna Sui

dez 2016: 1 10 Donald Trump , 2 7 Last words , 3 6 Rogue One , 4 6 George Orwell , 5 5 Upton Sinclair , 6 4 The Black Cauldron (film) , 7 4 Twelfth Doctor , 8 4 John Glenn , 9 4 Science , 10 4 Russia , 11 4 Saki , 12 4 James Mattis , 13 4 Glenn Beck , 14 4 Hillary Clinton , 15 3 Debbie Reynolds , 16 3 Pigs (1992 film) , 17 3 Charlie Ergen , 18 3 Shriekback , 19 3 Mo Yan , 20 3 Erwan Le Corre , 21 3 Roger A. Caras , 22 3 Yasser Harrak , 23 3 Don Tregonning , 24 3 Karl Georg von Raumer , 25 3 Zeev Sternhell

jan 2017: 1 13 Donald Trump , 2 6 Sean Spicer , 3 6 Kellyanne Conway , 4 6 Rogue One , 5 5 Reince Priebus , 6 5 Science , 7 5 Education , 8 5 Fascism , 9 4 George Kelly (psychologist) , 10 4 Stanley G. Payne , 11 4 Steve Bannon , 12 4 Proletarian nation , 13 4 Islamic State of Iraq and the Levant , 14 4 Tamil proverbs , 15 4 Patience , 16 4 Marriage , 17 4 Love , 18 4 Life , 19 4 Jesus , 20 4 Julian Assange , 21 4 Wikipedia , 22 4 Europe , 23 4 Barack Obama , 24 4 Internet , 25 4 Muhammad

fev 2017: 1 14 Donald Trump , 2 5 Muhammad , 3 5 Gautama Buddha , 4 4 Sindh , 5 4 Max Velmans , 6 4 Rogue One , 7 4 Milo Yiannopoulos , 8 4 South Korea , 9 4 North Korea , 10 4 Star Wars: Episode III – Revenge of the Sith , 11 4 Mulan (1998 film) , 12 4 Muhammad Ali , 13 4 Fyodor Dostoyevsky , 14 3 David Bossie , 15 3 Drew Scott , 16 3 Amar Singh Thapa , 17 3 John Horgan (journalist) , 18 3 Pope Pius II , 19 3 Dan Coats , 20 3 Sonny Perdue , 21 3 Harish-Chandra , 22 3 Ryan Zinke , 23 3 Scott Pruitt , 24 3 C. S. Seshadri , 25 3 Alexander Acosta

mar 2017: 1 10 Abraham Lincoln , 2 8 Donald Trump , 3 5 Logan (film) , 4 5 Tamil proverbs , 5 5 Albert Einstein , 6 4 Fabius Maximus , 7 4 Lisa Wilcox , 8 4 Morcheeba , 9 4 LCD Soundsystem , 10 4 Roy A. Childs, Jr. , 11 4 La Dolce Vita , 12 4 Gil Vicente , 13 4 Matt Drudge , 14 4 Parks and Recreation (season 6) , 15 4 SpongeBob SquarePants/Season 3 , 16 4 Grand Theft Auto V , 17 4 Truth , 18 4 Birth , 19 4 Germany , 20 4 Ted Nugent , 21 4 Wikipedia , 22 4 Confucius , 23 4 Winston Churchill , 24 3 Felix Klein , 25 3 W. V. D. Hodge

abr 2017: 1 8 Donald Trump , 2 6 Abraham Lincoln , 3 5 Adolf Hitler , 4 4 Free society , 5 4 Georges Sorel , 6 4 Beauty and the Beast (2017 film) , 7 4 Steve Blank , 8 4 Confederate States of America , 9 4 God is dead , 10 4 History , 11 4 United States , 12 4 Samurai Jack , 13 4 Toy Story 3 , 14 4 Monsters, Inc. , 15 4 Stephen A. Douglas , 16 4 Vegetarianism , 17 4 Robert M. Pirsig , 18 4 H. L. Mencken , 19 3 Leigh Snowden , 20 3 Lori Nelson , 21 3 Ginger Stanley , 22 3 Pat Conroy , 23 3 Pat Farenga , 24 3 Kim Dae-jung , 25 3 Lester del Rey

mai 2017: 1 13 Donald Trump , 2 5 Dada Vaswani , 3 5 Guardians of the Galaxy Vol. 2 , 4 5 James Comey , 5 5 The Empire Strikes Back , 6 5 Jeff Sessions , 7 5 Monsters, Inc. , 8 5 Mahatma Gandhi , 9 4 Ghostbusters (2016 film) , 10 4 Anti-Americanism , 11 4 The Flash (2014 TV series) , 12 4 Twelfth Doctor , 13 4 Wreck-It Ralph , 14 4 France , 15 4 Mitch McConnell , 16 4 Toy Story 2 , 17 4 Ice Age (2002 film) , 18 4 Toy Story , 19 4 Chicago , 20 4 Shrek , 21 4 Oprah Winfrey , 22 4 Isaac Asimov , 23 4 Karl Marx , 24 4 George Bernard Shaw , 25 4 Animal Farm

jun 2017: 1 6 A Bug's Life , 2 6 Donald Trump , 3 5 Cars 3 , 4 5 Guardians of the Galaxy Vol. 2 , 5 5 Fictional last words in films , 6 5 Winston Churchill , 7 4 Paranormal Activity , 8 4 Logan (film) , 9 4 Rogue One , 10 4 Last words in Marvel Cinematic Universe media , 11 4 Twelfth Doctor , 12 4 Hotel Transylvania , 13 4 Cars 2 , 14 4 Austin Powers in Goldmember , 15 4 Toy Story 2 , 16 4 Monsters, Inc. , 17 4 Muhammad , 18 3 Pat Carroll (actress) , 19 3 Paul Clement (lawyer) , 20 3 Joan Larsen , 21 3 Robert P. Young Jr. , 22 3 Jordan Peterson , 23 3 David Stras , 24 3 Brett Kavanaugh , 25 3 Lee Meriwether

jul 2017: 1 10 Donald Trump , 2 6 God , 3 5 George A. Romero , 4 5 Twelfth Doctor , 5 5 The Dark Knight (film) , 6 5 Arnold Schwarzenegger , 7 5 Winston Churchill , 8 4 June Vincent , 9 4 Game of Thrones/Season 7 , 10 4 Death , 11 4 The Angry Video Game Nerd , 12 4 Toy Story , 13 4 Willy Wonka & the Chocolate Factory , 14 4 George W. Bush , 15 3 The Circle (2017 film) , 16 3 Rick Baker , 17 3 Night of the Living Dead (1990 film) , 18 3 Sholay , 19 3 Spider-Man: Homecoming , 20 3 MS Dhoni , 21 3 Shooter (film) , 22 3 Skeleton Warriors , 23 3 Sauli Niinistö , 24 3 Claud William Wright , 25 3 The Great Silence

ago 2017: 1 10 Donald Trump , 2 7 Albert Einstein , 3 6 God , 4 5 Lesbian sexual practices , 5 5 Mahatma Gandhi , 6 5 George W. Bush , 7 5 Adolf Hitler , 8 5 Winston Churchill , 9 4 Akshay Agrawal , 10 4 Cub Swanson , 11 4 Game of Thrones/Season 7 , 12 4 Cars 3 , 13 4 Judaism , 14 4 Freedom , 15 4 Education , 16 4 United States , 17 4 Communism , 18 4 Barack Obama , 19 4 Steve Jobs , 20 4 John Lennon , 21 4 Aristotle , 22 3 Marvin Harris , 23 3 J. Reuben Clark , 24 3 Tobin Bell , 25 3 Jason Blum

set 2017: 1 8 Love , 2 7 Wikipedia , 3 6 Education , 4 6 Adolf Hitler , 5 5 Friends (season 3) , 6 5 Religion , 7 5 God , 8 5 Children , 9 5 Karl Marx , 10 4 It (2017 film) , 11 4 Game of Thrones/Season 7 , 12 4 Friends (season 5) , 13 4 Racism in the United States , 14 4 Rick and Morty , 15 4 Freedom , 16 4 United States , 17 4 The Angry Video Game Nerd , 18 4 Fictional last words in films , 19 4 September 30 , 20 4 The Powerpuff Girls , 21 4 Donald Trump , 22 4 Stephen King , 23 4 George W. Bush , 24 3 Political midlife crisis , 25 3 Harvey Danger

out 2017: 1 6 God , 2 6 Donald Trump , 3 6 Mahatma Gandhi , 4 5 Death , 5 4 Sean Duffy , 6 4 Karen Pence , 7 4 Narada Maha Thera , 8 4 Racism in the United States , 9 4 Star Trek: The Next Generation , 10 3 Rajasthan , 11 3 Hindu–Islamic relations , 12 3 Fridtjof Nansen , 13 3 Robert McRuer , 14 3 Mary Lasker , 15 3 Digital Underground , 16 3 Matthew Mitcham , 17 3 Marjorie Dannenfelser , 18 3 Alexander Mackenzie (politician) , 19 3 Game of Thrones/Season 7 , 20 3 Spider-Man: Homecoming , 21 3 Rex Tillerson , 22 3 List of The Simpsons crank calls , 23 3 Star Wars: The Force Awakens , 24 3 History of science , 25 3 Twelfth Doctor

nov 2017: 1 4 It (2017 film) , 2 4 Pedophilia , 3 4 Love , 4 4 Home Alone 2: Lost in New York , 5 4 Barack Obama , 6 4 Donald Trump , 7 4 Adolf Hitler , 8 3 Mike Cernovich , 9 3 Mark Manson , 10 3 David Krakauer , 11 3 Iburi Izō , 12 3 Jill Vogel , 13 3 Incel , 14 3 Luke Cage (TV series) , 15 3 Stranger Things , 16 3 Supergirl (TV series) , 17 3 Synergy , 18 3 The Flash (2014 TV series) , 19 3 Peace , 20 3 Power , 21 3 Death , 22 3 United States , 23 3 Last words in Disney animated films , 24 3 Fictional last words in films , 25 3 Pedro Calderón de la Barca

dez 2017: 1 7 Last words , 2 6 John Constable , 3 6 Donald Trump , 4 5 Star Wars: The Last Jedi , 5 5 First Doctor , 6 5 Napoleon I of France , 7 4 Lockheed Martin F-35 Lightning II , 8 4 Edward T. Hall , 9 4 Crisis on Earth-X , 10 4 Jesus , 11 4 Barack Obama , 12 4 Star Wars , 13 4 Winston Churchill , 14 4 Albert Einstein , 15 3 H. Richard Niebuhr , 16 3 Dave Brat , 17 3 Rebecca Solnit , 18 3 Kenneth Goldsmith , 19 3 Amiri Baraka , 20 3 Clair Cameron Patterson , 21 3 Jorja Fox , 22 3 Ramón Valdés , 23 3 Wang Zhihuan , 24 3 Peter Mayhew , 25 3 Rachele Brooke Smith

jan 2018: 1 15 Donald Trump , 2 10 Star Wars: The Last Jedi , 3 6 Mahatma Gandhi , 4 5 It (2017 film) , 5 5 Love , 6 5 Ursula K. Le Guin , 7 4 Chaim Weizmann , 8 4 Dolores O'Riordan , 9 4 Mindhunter (TV series) , 10 4 Coco (2017 film) , 11 4 Supergirl (TV series) , 12 4 The Flash (2014 TV series) , 13 4 George Washington , 14 4 Pythagoras , 15 4 Søren Kierkegaard , 16 4 Last words , 17 4 Adolf Hitler , 18 4 Karl Marx , 19 4 Winston Churchill , 20 3 On the Concept of Irony with Continual Reference to Socrates , 21 3 Adam Gopnik , 22 3 Jacob Bernoulli , 23 3 Ferdinand Hodler , 24 3 Jonathan P. Jackson , 25 3 Chuck Dixon

fev 2018: 1 8 Star Wars: The Last Jedi , 2 7 Donald Trump , 3 6 Fictional last words in animated television series , 4 6 Barack Obama , 5 5 Democracy , 6 5 Winston Churchill , 7 5 Albert Einstein , 8 4 Black Panther (film) , 9 4 Racial views of Donald Trump , 10 4 Charles R. Drew , 11 4 Željko Glasnović , 12 4 Ivo Pogorelić , 13 4 Thomas E. G. Ransom , 14 4 Coco (2017 film) , 15 4 The Final Destination , 16 4 Billy Graham , 17 4 Fictional last words in films , 18 4 John Perry Barlow , 19 4 Thomas Aquinas , 20 4 Walt Disney , 21 4 Noam Chomsky , 22 4 Isaac Newton , 23 4 Benjamin Franklin , 24 4 Karl Marx , 25 4 Jean-Paul Sartre

mar 2018: 1 7 Stephen Hawking , 2 7 Albert Einstein , 3 6 Black Panther (film) , 4 6 Barack Obama , 5 5 God , 6 4 Steve Alten , 7 4 Steve Smith (cricketer) , 8 4 Clara Barton , 9 4 Star Wars: The Last Jedi , 10 4 Stranger Things , 11 4 Aurangzeb , 12 4 Ken Dodd , 13 4 Muhammad Ali , 14 4 Donald Trump , 15 4 Socrates , 16 4 Last words , 17 3 Mike Zwerin , 18 3 Shoichi Yokoi , 19 3 Georgie Hyde-Lees , 20 3 Ralph Yarborough , 21 3 Quo Vadis (1951 film) , 22 3 Miracle Davis , 23 3 Andreas Vesalius , 24 3 James Robert Flynn , 25 3 Sara García

abr 2018: 1 9 Donald Trump , 2 8 Nelson Mandela , 3 8 Mahatma Gandhi , 4 6 Muhammad , 5 5 Alfred von Waldersee , 6 5 Kevin Devine , 7 5 Star Wars: The Last Jedi , 8 5 Kim Jong-un , 9 5 Freedom of the press , 10 5 James Spader , 11 5 SpongeBob SquarePants , 12 5 John Quincy Adams , 13 5 Leonardo da Vinci , 14 5 Franklin D. Roosevelt , 15 5 Noam Chomsky , 16 5 Stephen Hawking , 17 5 Bill Gates , 18 5 Aristotle , 19 4 Bat Ye'or , 20 4 Adonis Georgiadis , 21 4 Austin Grossman , 22 4 Raphael , 23 4 Jerry Cantrell , 24 4 Black Panther (film) , 25 4 Timur

mai 2018: 1 14 Avengers: Infinity War , 2 6 Terence McKenna , 3 5 Harry Styles , 4 5 Richard R. Wright Jr. , 5 5 Last words in Marvel Cinematic Universe media , 6 5 Fictional last words in video games , 7 4 Louis Tomlinson , 8 4 Niall Horan , 9 4 Liam Payne , 10 4 Zayn Malik , 11 4 Luke Rhinehart , 12 4 Giambattista Vico , 13 4 Elinor Wylie , 14 4 Black Panther (film) , 15 4 Star Wars: The Last Jedi , 16 4 SpongeBob SquarePants/Season 11 , 17 4 Lionel Messi , 18 4 Alex Jones , 19 4 William Shakespeare , 20 4 Full Metal Jacket , 21 4 Philip Roth , 22 4 Muhammad , 23 4 Mahatma Gandhi , 24 4 George W. Bush , 25 4 Chinese proverbs

jun 2018: 1 6 Solo: A Star Wars Story , 2 6 Charles Krauthammer , 3 6 Albert Einstein , 4 5 War , 5 5 Anthony Bourdain , 6 4 Muharrem İnce , 7 4 Paul Dacre , 8 4 Mary Meeker , 9 4 Dalida , 10 4 Fatima Jinnah , 11 4 Avengers: Infinity War , 12 4 Hsing Yun , 13 4 Mortimer Caplin , 14 4 Vincent van Gogh , 15 4 Fernando Pessoa , 16 3 Daniele Amati , 17 3 Walerian Krasiński , 18 3 Epiphanius of Salamis , 19 3 Friedrich von Wieser , 20 3 Tokyo Sexwale , 21 3 William Earsman , 22 3 Ashin Wirathu , 23 3 Alexander Cunningham , 24 3 Takeda Shingen , 25 3 Gianni Agnelli

jul 2018: 1 9 Jimmy Wales , 2 8 McDonald's , 3 7 Donald Trump , 4 5 James Clapper , 5 5 Charlie Sifford , 6 5 Cars (film) , 7 5 Winston Churchill , 8 4 Jeffrey Epstein , 9 4 Huston Huddleston , 10 4 George Young, Baron Young of Cookham , 11 4 Christianity in India , 12 4 Konrad Heiden , 13 4 Nina Kiriki Hoffman , 14 4 Harry F. Ward , 15 4 List of films (D–F) , 16 4 Xi Jinping , 17 4 Islam , 18 4 Thomas Babington Macaulay, 1st Baron Macaulay , 19 4 Barack Obama , 20 4 Aladdin (1992 Disney film) , 21 4 Muhammad , 22 4 Adolf Hitler , 23 4 Mao Zedong , 24 4 Confucius , 25 4 A Tale of Two Cities

ago 2018: 1 17 McDonald's , 2 10 Jimmy Wales , 3 9 Barack Obama , 4 8 John McCain , 5 6 V. S. Naipaul , 6 4 Karl Schiller , 7 4 Jun Hong Lu , 8 4 Helen H. Gardener , 9 4 John Churchill, 1st Duke of Marlborough , 10 4 Victor Davis Hanson , 11 4 Avengers: Infinity War , 12 4 Tommy Robinson , 13 4 Breakfast , 14 4 John Reid, Baron Reid of Cardowan , 15 4 Aretha Franklin , 16 4 Cattle , 17 4 Personal responsibility , 18 4 Justin Bieber , 19 4 Star Trek: The Original Series , 20 4 Girls , 21 4 Kofi Annan , 22 3 Dean Winslow , 23 3 Small Time Crooks , 24 3 Anirvan , 25 3 New Zealand

set 2018: 1 10 Justin Bieber , 2 7 Megan Fox , 3 6 Harry Styles , 4 6 Xi Jinping , 5 6 Tim Allen , 6 6 Drake (entertainer) , 7 6 Tom Hanks , 8 6 Eminem , 9 6 Elizabeth II of the United Kingdom , 10 6 Albert Einstein , 11 5 Lea Michele , 12 5 Racism in South Korea , 13 5 Psy , 14 5 Nicki Minaj , 15 5 Ashley Tisdale , 16 5 Miley Cyrus , 17 5 Lil Wayne , 18 5 Steve Jobs , 19 4 David Harbour , 20 4 R. A. Torrey , 21 4 Dianne Feinstein , 22 4 William B. Ruger , 23 4 Avengers: Infinity War , 24 4 Racial views of Donald Trump , 25 4 Theresa May

out 2018: 1 7 Justin Bieber , 2 6 Jamal Khashoggi , 3 6 Abraham Lincoln , 4 6 Eminem , 5 5 Howard Ray Carey , 6 5 Michelle Goldberg , 7 5 Tim Wise , 8 5 Jair Bolsonaro , 9 5 Government , 10 5 God , 11 5 Tim Allen , 12 5 Rihanna , 13 5 50 Cent , 14 5 Vladimir Lenin , 15 4 Scott Sigler , 16 4 Rich Cronin , 17 4 E.M.S , 18 4 Agni Yoga , 19 4 Roy Barnes , 20 4 Alex Webb (photographer) , 21 4 Coraline Ada Ehmke , 22 4 Venom (film) , 23 4 Spider-Man: Homecoming , 24 4 Ariana Grande , 25 4 McDonald's

nov 2018: 1 7 Donald Trump , 2 6 Ben Shapiro , 3 6 Justin Bieber , 4 6 Albert Einstein , 5 5 Jabir ibn Hayyan , 6 5 Breaking Bad (season 2) , 7 5 Pope Francis , 8 5 Cars 2 , 9 5 Toy Story 2 , 10 5 India , 11 5 A Few Good Men , 12 5 A Beautiful Mind (film) , 13 4 Red Cloud , 14 4 Tamara De Anda , 15 4 Mauricio Macri , 16 4 Joel Achenbach , 17 4 Horrible Bosses , 18 4 Breaking Bad (season 5) , 19 4 Breaking Bad (season 4) , 20 4 Breaking Bad (season 1) , 21 4 House of Cards (season 1) , 22 4 SpongeBob SquarePants/Season 1 , 23 4 Daredevil (TV series) , 24 4 McDonald's , 25 4 God

dez 2018: 1 11 A Few Good Men , 2 10 Breaking Bad (season 5) , 3 9 Donald Trump , 4 8 Joseph Stalin , 5 8 George H. W. Bush , 6 8 Muhammad , 7 7 Breaking Bad (season 2) , 8 6 Greta Thunberg , 9 6 Horrible Bosses , 10 5 Pier Giorgio Perotto , 11 5 Breaking Bad (season 3) , 12 5 William H. McRaven , 13 5 Seinfeld (season 4) , 14 5 Seinfeld (season 3) , 15 5 Ted (film) , 16 5 Barack Obama , 17 5 Gautama Buddha , 18 5 Dante Alighieri , 19 5 George Carlin , 20 5 Albert Einstein , 21 4 Mark E. Smith , 22 4 Liu Xiao Ling Tong , 23 4 Mainstream media , 24 4 Edward E. David Jr. , 25 4 Marcelo Gleiser

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:28 (final run)

Dump file enwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 148 Mb as gz -> 1007 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:42 after 7 min, 12 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.