Estatísticas da Wikiquote persa

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: setembro 2017
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
set 20170%   +11%   -50%    () 0%
ago 20170%   +2%   -57%    () +3%
jul 2017+3%   +7%   +36%    () +16%
jun 20170%   +3%   +99%    () +6%
mai 2017+1%   +2%   +100%    () +4%
abr 2017+1%   +1%   -37%    () +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
set 20172311617,3 k2312,2 1,2 k    ( ) 5,7 k
ago 20172301826,6 k513,3 2,4 k    ( ) 5,7 k
jul 201722971746,5 k1313,2 5,7 k    ( ) 5,5 k
jun 20172221726,1 k613,2 4,2 k    ( ) 4,8 k
mai 201722131125,9 k312,9 2,1 k    ( ) 4,5 k
abr 20172183915,8 k212,8 1,1 k    ( ) 4,3 k
mar 201721521215,7 k512,7 1,7 k    ( ) 4,3 k
fev 2017213 1025,6 k812,8 3,5 k    ( ) 4,1 k
jan 201721311025,3 k712,6 4,7 k    ( ) 3,7 k
dez 201621241325,1 k312,2 1,2 k    ( ) 3,1 k
nov 20162081715,0 k412,2 1,5 k    ( ) 3,0 k
out 2016207 924,9 k712,2 1,7 k    ( ) 3,0 k
set 201620771624,7 k1212,4 2,5 k    ( ) 3,0 k
ago 2016200 1224,3 k312,9 1,6 k    ( ) 2,8 k
jul 201620041014,2 k312,8 3,7 k    ( ) 2,7 k
jun 2016196 7 4,1 k 12,2 200    ( ) 2,5 k
mai 2016196 6 4,1 k 12,2 160    ( ) 2,5 k
abr 2016196 8 4,1 k 12,2 159    ( ) 2,5 k
mar 201619618 4,1 k 12,2 142    ( ) 2,5 k
fev 201619515 4,1 k 12,1 132    ( ) 2,5 k
jan 2016194 9 4,1 k112,1 166    ( ) 2,5 k
dez 2015194 5 4,1 k112,2 238    ( ) 2,5 k
nov 2015194211 4,1 k 12,1 161    ( ) 2,5 k
out 201519237 4,0 k 12,2 205    ( ) 2,5 k
set 201518921624,0 k312,1 858    ( ) 2,4 k
ago 201518751643,9 k2412,2 6,1 k    ( ) 2,4 k
jul 20151822923,2 k713,2 1,5 k    ( ) 1,6 k
jun 201518015 3,0 k113,6 180    ( ) 1,4 k
mai 201517939 2,9 k 13,7 248    ( ) 1,4 k
abr 201517628 2,9 k 13,6 160    ( ) 1,4 k
mar 20151742912,9 k413,6 506    ( ) 1,4 k
fev 20151721512,8 k 14 275    ( ) 1,4 k
jan 201517124 2,8 k 13,9 143    ( ) 1,4 k
dez 2014169 4 2,8 k 13,9 73    ( ) 1,4 k
nov 2014169 7 2,8 k 13,9 126    ( ) 1,4 k
out 20141693712,8 k313,8 388    ( ) 1,4 k
set 20141661612,7 k714,2 755    ( ) 1,4 k
ago 201416549 2,5 k115,1 391    ( ) 1,3 k
jul 20141611712,4 k615,2 751    ( ) 1,3 k
jun 20141602512,3 k 16,1 494    ( ) 1,2 k
mai 201415831022,3 k816 961    ( ) 1,2 k
abr 201415541032,0 k517,5 2,5 k    ( ) 1,1 k
mar 20141511821,9 k417,5 1,0 k    ( ) 977
fev 20141501431,7 k118,1 679    ( ) 890
jan 20141491611,7 k118 846    ( ) 872
dez 20131481621,7 k118 748    ( ) 795
nov 2013147 411,6 k218 586    ( ) 725
out 2013147 411,6 k 18,2 277    ( ) 597
set 20131471411,6 k118,2 529    ( ) 590
ago 201314631031,5 k118,1 992    ( ) 586
jul 201314326 1,5 k118 180    ( ) 573
jun 201314148 1,5 k 18,1 209    ( ) 566
mai 201313738 1,5 k 18,1 123    ( ) 566
abr 201313445 1,5 k 18 169    ( ) 565
mar 201313023 1,4 k 18,1 134    ( ) 559
fev 2013128 3 1,4 k 18,1 95    ( ) 551
jan 201312827 1,4 k 18,1 250    ( ) 551
dez 201212625 1,4 k 18 106    ( ) 545
nov 2012124 1 1,4 k 18 74    ( ) 543
out 201212413 1,4 k 18 113    ( ) 543
set 201212312 1,4 k118 177    ( ) 542
ago 201212214 1,4 k118,2 178    ( ) 540
jul 201212128 1,4 k 18,3 282    ( ) 537
jun 201211913 1,4 k 18,2 161    ( ) 535
mai 201211815 1,3 k 18,3 214    ( ) 533
abr 201211727 1,3 k118,3 266    ( ) 533
mar 20121152411,3 k 18,3 292    ( ) 530
fev 201211314 1,3 k 18,1 159    ( ) 528
jan 201211226 1,3 k 18 148    ( ) 527
dez 201111039 1,3 k 18 149    ( ) 525
nov 201110748 1,3 k 18 166    ( ) 522
out 20111031411,3 k 18 221    ( ) 522
set 201110225 1,3 k 17,8 125    ( ) 521
ago 201110012 1,3 k 17,8 130    ( ) 520
jul 201199 2 1,3 k 17,7 152    ( ) 519
jun 20119923 1,3 k 17,7 131    ( ) 516
mai 20119715 1,3 k 17,7 113    ( ) 513
abr 201196 6 1,3 k 17,7 204    ( ) 512
mar 20119631221,3 k117,6 575    ( ) 509
fev 2011934911,2 k317,4 664    ( ) 481
jan 20118961231,2 k318 863    ( ) 418
dez 201083 711,1 k 18,5 454    ( ) 371
nov 20108337 1,1 k 18,2 224    ( ) 371
out 20108037 1,1 k 18,1 174    ( ) 362
set 20107758 1,1 k 18 278    ( ) 360
ago 2010722911,0 k118 712    ( ) 353
jul 20107046 1,0 k 17,6 178    ( ) 351
jun 20106616 1,0 k 17,5 121    ( ) 349
mai 20106527 1,0 k 17,6 157    ( ) 348
abr 20106326 999 17,7 222    ( ) 348
mar 201061 7 988 17,7 214    ( ) 346
fev 20106148 975 17,7 216    ( ) 346
jan 201057 6 964 17,6 344    ( ) 340
dez 20095726 949 17,6 193    ( ) 338
nov 20095516 939 17,5 235    ( ) 337
out 200954162934117,4 512    ( ) 327
set 200953210 914117,2 269    ( ) 316
ago 200951181886 17,4 1,0 k    ( ) 307
jul 20095027 880116,4 198    ( ) 305
jun 200948 4 839117 154    ( ) 295
mai 20094815 799 17,6 262    ( ) 289
abr 200947 6 796 17,4 300    ( ) 284
mar 200947151789 17,1 489    ( ) 279
fev 200946381779116,7 439    ( ) 261
jan 20094316 758116,6 231    ( ) 225
dez 200842361736 16,8 305    ( ) 222
nov 200839 4 725 16,6 147    ( ) 214
out 20083916 717 16,6 172    ( ) 209
set 20083817 712116,5 248    ( ) 202
ago 200837172685316,8 422    ( ) 198
jul 200836 7 605118,3 179    ( ) 180
jun 20083625 585 18,6 139    ( ) 179
mai 200834271574218,7 562    ( ) 174
abr 200832282526119,4 645    ( ) 169
mar 20083015 502 19 223    ( ) 160
fev 200829 41497118,7 601    ( ) 158
jan 200829372474118,4 826    ( ) 154
dez 200726481439 18 497    ( ) 133
nov 200722 4 426 17,3 119    ( ) 131
out 200722242420 17,3 927    ( ) 130
set 200720151408 15,5 931    ( ) 125
ago 200719 51395 13,7 658    ( ) 114
jul 200719261387112,3 911    ( ) 109
jun 200717 21368 10,4 185    ( ) 104
mai 200717 31357 10,2 195    ( ) 98
abr 20071714 352 9,8 276    ( ) 94
mar 200716 21337 9,5 258    ( ) 91
fev 200716 1 332 8,8 119    ( ) 87
jan 200716 2 329 8,5 157    ( ) 86
dez 20061613 320 8,3 177    ( ) 85
nov 20061535 317 7,8 139    ( ) 84
out 200612 31304 7,7 199    ( ) 81
set 200612 5128917,4 296    ( ) 77
ago 20061213127316,8 205    ( ) 69
jul 20061136225516,4 502    ( ) 69
jun 20068 2122215,1 191    ( ) 48
mai 2006812119314,9 163    ( ) 41
abr 2006712 16714,7 129    ( ) 34
mar 2006613 14714,4 182    ( ) 30
fev 20065 2 10814,4 79    ( ) 24
jan 20065 1 93 4,2 49    ( ) 17
dez 20055 1 81 4,2 41    ( ) 14
nov 2005523 66 4,6 87    ( ) 12
out 20053 1 54 4 21    ( ) 10
set 2005312 53 3,7 44    ( ) 9
ago 20052   42 3,6 5    ( ) 6
jul 20052 1 4113,5 87    ( ) 5
jun 20052 2 15 3,9 26    ( ) 3
mai 20052   6 5,3 4    ( ) 2
abr 20052 1 6 4,7 17    ( ) 1
mar 2005211 3 3,7 10    ( ) 1
fev 20051            ( ) 1
jan 20051            ( ) 1
dez 20041            ( ) 1
nov 20041            ( ) 1
out 20041            ( ) 1
set 20041            ( ) 1
ago 200411      1    ( ) 1
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 2017122539121 2      64
abr 20171267119821 7      64
jan 20171214999221 2      64
out 201613 9611221 3      64
jul 201613881115321 3      64
abr 201613 11 15 20 21      64
jan 201612 9 141220 23      64
out 2015121013 14 20 16      64
jul 20151379714419 5      64
abr 201513119 15 18 20      64
jan 2015131116 15 18 23      64
out 201412610815618 13      64
jul 20141213101017313 6      64
abr 2014121210720312 8      64
jan 201412141212231211 9      64
out 201312 12723 9 15      64
jul 201312912 23119 16      64
abr 201313512 23 8 17      64
jan 2013131213 22 8 24      64
out 2012131724 21 8 30      64
jul 2012131513 21 8 18      64
abr 2012121114 21108 18      64
jan 2012131714 21 7 17      64
out 20111416231521 7 27      64
jul 201114 21 21 8 26      64
abr 201114 15 21 8 21      64
jan 2011155862158 7      63
out 201015712 21 7 17      63
jul 201016713 21 7 21      63
abr 2010181413 21   15      63
jan 201018 11 21   13      63
out 200918161282110  18      63
jul 200918910 209  15      63
abr 200918 12 21   18      63
jan 2009182114 2111  18      63
out 2008181414 21   20      63
jul 200817 13 2413  20      63
abr 200817111162411  10      63
jan 20081991272415  11      63
out 2007201317624   8      62
jul 2007201213152414  7      61
abr 2007201514 24   16      61
jan 200720 25 22   21      61
out 200622 171123   17      61
jul 2006211011102316  12      61
abr 2006261221 2615  18      60
jan 200630 28 26   29      60
out 200527 17 23   25      60
jul 200527 19 2010  15      59
abr 200522 15 30   19      59
jan 200529              57
out 200426              46
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  1000  5  10  100 
set 20172610642111 1  843211    125432      
ago 20172613863221    11443211   1275432     
jul 2017442617118422111 362017136111  4019117422 1  
jun 2017271075322111  1832211    181074322 11 
mai 201722121182221 1  742211    1164322  1  
abr 2017261296211     1463221    156411      
mar 2017351612105111    2174221    2364421     
fev 2017321810522211   11653211   12654422    
jan 201729161043221111 1896532    3217954321   
dez 20162516139322  11 1266421    1284421     
nov 2016268731111    532111    731111     
out 20162212974211    41        53311      
set 2016272016123221    11222      124322      
ago 201630141285211 11 15532      1362211     
jul 201616121084111111 13411      12211111    
jun 2016209733      6321      6211       
mai 2016248641      522       932        
abr 2016209851      52111     62111      
mar 2016188831      63        5          
fev 2016165531      221       62         
jan 20161912941      541       721        
dez 2015176542      42111     55411      
nov 201519141141      10321      6111    1  
out 20152210762   1  8421      1021     1  
set 201538201610421  1  1710731     1712941      
ago 201536211615134321   28171511722   34221713532    
jul 20152512963211    84322     1143332     
jun 2015149531      3         933111  1  
mai 20151812943      71111     543331     
abr 20152111842      115321  2221254211  11 
mar 2015181394311     148742  1111287642     
fev 201518115221      1795311    2010622      
jan 20152210442      85        931        
jul 2017442617118422111 362017136111  4019117422 1  
abr 2017261296211     1463221    156411      
jan 201729161043221111 1896532    3217954321   
out 20162212974211    41        53311      
jul 201616121084111111 13411      12211111    
abr 2016209851      52111     62111      
jan 20161912941      541       721        
out 20152210762   1  8421      1021     1  
jul 20152512963211    84322     1143332     
abr 20152111842      115321  2221254211  11 
jan 20152210442      85        931        
out 201417117431      105331     11322211    
jul 2014181075211     811       94322      
abr 201426131063321 1116211      134411   111
jan 201423864311     821       10432       
out 20131674321      4         1021        
jul 2013158642      43        10211       
abr 2013208531      42        13421       
jan 20132110742   11 4111      7       11 
out 2012164331   11 6111      73111      
jul 2012209853   11 8432      95311      
abr 20121910752   11 621111    611     2  
jan 2012271262       521111    9111       
out 20112074311      821111    11221       
jul 2011205211   11 31        8321       
abr 2011219632      41        611        
jan 20112915129531     103332     116432      
out 201030975       5111      12111       
jul 2010197652      4         1          
abr 20102212652   1  311       73111      
jan 2010239642      21        93321      
out 20091786442      5221      92221      
jul 2009239743      322       114211      
abr 2009199643   11 632       1375441     
jan 2009148642   11 3111      93321      
out 20081810621   11 411       85411      
jul 20081711742      511       73321      
abr 2008141086521  11 114311     95442      
jan 2008151175321  11 95521     74221      
out 200713643222  11112222      112221      
jul 200712864111     533       432111     
abr 200797442      3111      53321      
jan 200752211      3111      43221      
out 2006853211      2221      32211      
jul 20061286642      93221     933221  11 
abr 2006106222      7331      6321       
jan 200652111      3111      21111      
out 20051111                 1          
jul 200521111                11111      
abr 20051111       1         21111      
jan 2005                               
out 2004                               

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
11,129100.0%82,345100.0%
344939.8%81,27698.7%
1023020.4%80,00497.2%
32988.7%77,75794.4%
100534.7%75,50491.7%
316242.1%70,80986.0%
100090.8%63,74977.4%
316230.3%53,38664.8%
1000020.2%47,17857.3%
3162310.1%32,21539.1%

 

26 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
ChyahUC1 032,215386,63179set 10, 201025763,4174--
فرهنگ2016UC2 014,9631,1814,729281jul 28, 20164281,630701--
Nargess.nUC18+139613973jun 17, 2015835581--
CommonsDelinkerUC24 03244421mai 13, 20073792----
TaddahUC26 0269312-set 10, 2014111521---
SharakyUC30 019725119dez 20, 20162831---
DoostdarUC44 0128222010out 12, 201410839---
کافر مقدسUC51 010412-ago 07, 201411492---
محکUC52+110126-mar 01, 201027693---
Poria pdUC103+14305--set 08, 201575211---
MohammadUC118+112534151set 06, 2016388----
MasbeshUC130+1522441out 17, 2016347----
4nn1l2UC140+41917-set 02, 20157581---
پریسا دارک لگUC182...1414--set 14, 20171511--
GharouniUC222+711110-set 21, 20163731---
MahtabshadiUC376+5751--dez 22, 20156471---
SaeidasaliUC383...55--set 28, 20171----
HamedvahidUC407+86413-mar 25, 201123801---
Darvin jUC1122...11--set 09, 201720----
Qanea IIUC1123...11--set 15, 201714----
آذر فرنبغUC1124...11--set 21, 20178----
مهشید73UC1125...11--set 22, 20177----
AlamirUC1126...11--set 23, 20176----
AmirRezaAbrounUC1127...11--set 23, 20176----
SeyyedalithUC1128...11--set 25, 20174----
فدایی جوانUC1129...11--set 28, 20171----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AmouzandehUC36,208abr 11, 20064189mai 31, 20102678
RAHA68UC43,011abr 30, 20121978out 13, 2016351
ع م گUC51,913jul 15, 2015807ago 31, 2015760
SajadUC61,797mar 26, 20054570abr 27, 2016520
AnankeBotUC71,347dez 18, 20083207set 16, 20131474
TanhabotUC81,178abr 23, 20083446dez 08, 20102487
MardetanhaUC91,117ago 08, 20073705jul 14, 201777
مهدیUC10703fev 05, 20093158jan 27, 20131706
DexbotUC11672abr 08, 20141270abr 14, 20141264
JDiamondUC12646set 05, 20092946fev 01, 20112432
Jamal NazarethUC13643fev 01, 20112432abr 21, 20112353
TaranetUC14577jan 13, 20083547set 04, 2015756
MeaningnessUC15487mar 18, 2015926jul 23, 201768
WayiranUC16444abr 24, 20083445mai 30, 20112314
SahimrobotUC17410ago 14, 20102603ago 15, 20102602
Bilijacks~fawikiquoteUC19389nov 16, 20063970abr 20, 20141258
MohandesBotUC20366jun 02, 20141215jun 19, 20141198
FaraBotUC21343out 11, 20073641out 11, 20073641
MahanUC22335fev 16, 20141321set 14, 2015746
SialkgraphUC23325jul 23, 20131529jul 02, 2015820

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 5.224 edições foram feitas por usuários anônimos, de um total de 89.271 edições ( 5e %)
  


5 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
ChtitBotUC1966set 08, 20073674fev 06, 20112427--
EleferenBotUC2464fev 13, 20102785jan 13, 20131720--
AvicBotUC3254jul 30, 20112253set 24, 20175--
DinybotUC417mar 24, 20073842dez 16, 20073575--
AvocatoBotUC51abr 17, 20121991abr 17, 20121991--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
set 201713 k8701,9 k4651382933,2 k       217261
ago 201712 k8661,9 k4651382733,2 k       217261
jul 201712 k8621,8 k4651381233,0 k       217261
jun 201711 k8481,8 k4651379632,7 k       217261
mai 201710 k8221,8 k4651378932,4 k       217261
abr 201710 k8211,8 k4651378832,3 k       217261
mar 201710,0 k8181,8 k4651378732,3 k       217261
fev 20179,6 k8051,8 k4651177432,2 k       217261
jan 20179,0 k7831,8 k4651071532,0 k       217261
dez 20168,2 k7431,8 k4650665721,4 k       217261
nov 20168,1 k7381,8 k4650665521,4 k       217261
out 20167,9 k7361,8 k4650665511,2 k       217261
set 20167,7 k7331,8 k4650665511,2 k       217261
ago 20167,1 k7231,8 k4650665411,1 k       217261
jul 20166,9 k7181,8 k4650665111,1 k       217261
jun 20166,6 k7151,8 k465066511827       217261
mai 20166,6 k7111,8 k465066511827       217261
abr 20166,6 k7071,8 k465066451826       217261
mar 20166,6 k7041,8 k465066451826       217261
fev 20166,6 k7021,8 k465066451826       217261
jan 20166,6 k7011,8 k465066451825       217261
dez 20156,5 k6991,8 k465066441824       217261
nov 20156,5 k6931,8 k465066441822       217261
out 20156,5 k6911,8 k465066401822       217261
set 20156,5 k6851,8 k465066331822       217261
ago 20156,3 k6811,8 k465066331813       217261
jul 20154,8 k6721,7 k465036231694       217261
jun 20154,4 k6671,7 k465036221668       217261
mai 20154,4 k6621,7 k465036211668       217261
abr 20154,4 k6611,7 k465036211668       217261
mar 20154,3 k6561,7 k465036201668       217261
fev 20154,2 k6551,7 k464645961662       217261
jan 20154,2 k6481,7 k464635871661       217261
dez 20144,2 k6441,7 k464635861661       217261
nov 20144,2 k6431,7 k464635861661       217261
out 20144,2 k6351,7 k464635861661       217261
set 20144,1 k6261,7 k464115221649       217261
ago 20143,8 k6131,7 k463474921643       217261
jul 20143,7 k6071,7 k463464741642       217261
jun 20143,4 k6041,7 k463464731621       217261
mai 20143,4 k5961,7 k433454521621       215251
abr 20143,1 k5941,7 k433454521609       215251
mar 20142,8 k5891,7 k433454521602       215251
fev 20142,6 k5831,7 k433454521590       215251
jan 20142,6 k5771,7 k433454471581       215251
dez 20132,5 k5731,7 k433454461572       215251
nov 20132,3 k5701,7 k433454461566       215251
out 20132,2 k5641,7 k433364391541       215251
set 20132,1 k5591,7 k433364391540       215251
ago 20132,1 k5441,7 k433364381525       215251
jul 20132,1 k5381,7 k423364251434       214251
jun 20132,0 k5291,7 k413364251434       214241
mai 20132,0 k5251,7 k413364241434       214241
abr 20132,0 k5211,7 k413364241434       214241
mar 20132,0 k5141,7 k413364221430       214241
fev 20132,0 k5041,7 k413364221429       214241
jan 20132,0 k4971,7 k413364221426       214241
dez 20122,0 k4941,7 k413364221426       214241
nov 20122,0 k4851,7 k403364221426       213241
out 20122,0 k4821,7 k403364221425       213241
set 20121,9 k4781,7 k403364221425       213241
ago 20121,9 k4681,7 k403364221425       213241
jul 20121,9 k4621,7 k403364221425       213241
jun 20121,9 k4581,7 k403364211425       213241
mai 20121,9 k4361,7 k403364211425       213241
abr 20121,9 k4301,7 k393364211425       212241
mar 20121,8 k4221,7 k393364211425       212241
fev 20121,8 k4171,7 k393364211425       212241
jan 20121,8 k4071,7 k393364191425       212241
dez 20111,8 k4031,7 k393364191424       212241
nov 20111,8 k4001,7 k393364171424       212241
out 20111,8 k3851,7 k393364161422       212241
set 20111,8 k3751,7 k393364141422       212241
ago 20111,8 k3611,7 k393364121421       212241
jul 20111,8 k3571,7 k393364101421       212241
jun 20111,8 k3481,7 k393364101418       212241
mai 20111,8 k3401,7 k393364101418       212241
abr 20111,8 k3291,7 k393364081418       212241
mar 20111,8 k3221,7 k393364081418       212241
fev 20111,7 k3141,7 k383364011416       112241
jan 20111,6 k3011,6 k353293731401       19241
dez 20101,4 k2951,6 k343263611369       18241
nov 20101,4 k2911,6 k343263611369       18241
out 20101,4 k2871,6 k343263601368       18241
set 20101,4 k2781,6 k343263551368       18241
ago 20101,4 k2701,6 k333263511364       17241
jul 20101,4 k2541,6 k333262701360       17241
jun 20101,4 k2541,6 k323262701360       16241
mai 20101,4 k2411,6 k323252701360       16241
abr 20101,3 k2361,6 k323252701360       16241
mar 20101,3 k2291,5 k323252701360       16241
fev 20101,3 k2261,5 k323242671357       16241
jan 20101,3 k2221,5 k313242671356       1624 
dez 20091,3 k2081,5 k313242671356       1624 
nov 20091,3 k2011,4 k303242671356       1524 
out 20091,3 k1991,4 k303242671356       1524 
set 20091,2 k1941,4 k293242671354       1523 
ago 20091,2 k1841,3 k293242651352       1523 
jul 20091,2 k1841,3 k293242651352       1523 
jun 20091,1 k1781,3 k293232621352       1523 
mai 20091,1 k1761,2 k293232601352       1523 
abr 20091,1 k1741,2 k293232601352       1523 
mar 20091,1 k1621,2 k293232321339       1523 
fev 20091,0 k1481,2 k283231821203       1522 
jan 20099831391,1 k283231821141       1522 
dez 20089581361,1 k283231801139       1522 
nov 20089391321,1 k283231791138       1522 
out 20089261171,0 k283231741132       1522 
set 20089141031,0 k283201741132       1522 
ago 200888399986283201741131       1522 
jul 200878595954263191701130       1322 
jun 200876492924263191701129       1322 
mai 200874885924263191701129       1322 
abr 200869580893263141671125       1322 
mar 200866276828253141591122       1321 
fev 200865573798253141591122       1321 
jan 200862867766243141591122       1221 
dez 200757264736233141541104       1121 
nov 200755760703233141491104       1121 
out 200755058703233101481104       1121 
set 200753351642233101461104       1121 
ago 200750943609233101411100       1121 
jul 20074964057623310132195       1121 
jun 20074723954423310130193       1121 
mai 2007455395122229186192       1120 
abr 2007446374592229086192       1120 
mar 2007428354212228984186       1120 
fev 2007419343922124974171        120 
jan 2007415313672124974171        120 
dez 2006405313182123674171        120 
nov 2006401303022023640136         20 
out 2006385272522022837135         20 
set 2006366272162022537135         20 
ago 2006342261792022137135         20 
jul 2006324221382021933134         20 
jun 200627013952018628128         20 
mai 200623411652018627127         20 
abr 20062019352018527127         20 
mar 20061776182018527 24         20 
fev 20061325161918116 14         19 
jan 20061105151917014 14         19 
dez 2005954151816711 14         18 
nov 200578315181629 14         18 
out 20056421411556 14         1 
set 20056221411555 14         1 
ago 20054821311525 14         1 
jul 20054621311505 14         1 
jun 20051821011444 4         1 
mai 2005821011163 2         1 
abr 2005711011163 2         1 
mar 2005419 1163 2           
fev 20051   116              
jan 20051   116              
dez 20041   116              
nov 20041                  
out 20041                  
set 20041                  
ago 20041                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

mar 2005: 1 1 ضرب‌المثل‌های عربی

abr 2005: 1 1 آدولف هیتلر

mai 2005: 1 1 ضرب‌المثل‌های فارسی

jun 2005: 1 2 آقامحمدخان قاجار , 2 2 عزیز نسین , 3 2 صفحهٔ اصلی , 4 1 محمود احمدی‌نژاد

jul 2005: 1 2 ناشناس , 2 1 ویلیام فالکنر

ago 2005: 1 2 صفحهٔ اصلی , 2 1 فهرست بر اساس فيلم‌ها

set 2005: 1 3 صفحهٔ اصلی , 2 2 علی بن ابی‌طالب , 3 2 ناشناس , 4 1 ارنستو چه گوارا

out 2005: 1 1 فهرست افراد براساس نام

nov 2005: 1 2 کورش مدرسی , 2 2 منصور حکمت , 3 2 حمید تقوایی , 4 2 محمود احمدی‌نژاد , 5 1 دوگ لارسون

dez 2005: 1 1 امبرتو اکو

jan 2006: 1 2 اپیکور , 2 2 ارنستو چه گوارا , 3 1 کانت

fev 2006: 1 2 آلبر کامو , 2 2 محمد بن عبدالله , 3 1 محمدتقی مصباح یزدی

mar 2006: 1 2 توماس جفرسون , 2 2 ماتریکس , 3 2 فهرست آثار ادبی , 4 2 فهرست افراد بر پایه نام , 5 2 صفحهٔ اصلی , 6 1 کارلوس کاستاندا

abr 2006: 1 4 صفحهٔ اصلی , 2 3 هرمان هسه , 3 2 مارتین لوتر , 4 2 ضرب‌المثل‌های هلندی , 5 2 استانیسلاو لم , 6 2 ارنست همینگوی , 7 2 مایکل جکسون , 8 2 آلبرت اینشتین

mai 2006: 1 2 رابرت آنسون هاین‌لاین , 2 2 رفیق شامی , 3 2 مولوی , 4 2 داگلاس آدامز , 5 2 فرانسوا لارشفوکو , 6 2 ضرب‌المثل‌های لاتینی , 7 2 واشنگتن ایروینگ , 8 2 توماس جفرسون , 9 1 محمد خیابانی

jun 2006: 1 2 فرانسوا دو سلینیاک دو لا موت فنولون , 2 2 ژان دو لا فونتن , 3 2 وینستون چرچیل , 4 2 فهرست افراد بر پایه نام , 5 2 صفحهٔ اصلی , 6 1 رنه دکارت

jul 2006: 1 3 هلن کلر , 2 3 آیان حرصی علی , 3 3 آرزو , 4 3 آندره ژید , 5 3 آرتور شوپنهاور , 6 2 مرتضی آوینی , 7 2 الویس پرسلی , 8 2 مسیر سبز , 9 2 کازابلانکا (فیلم) , 10 2 رستگاری در شاوشنک , 11 2 ژولیا کریستوا , 12 2 محمود فلکی , 13 2 منوچهر آتشی , 14 2 جنگ عراق , 15 2 باباطاهر , 16 2 ویلیام سارویان , 17 2 کارل سندبرگ , 18 2 اقبال لاهوری , 19 2 فدریکو فلینی , 20 2 فریدریش شیلر , 21 2 رنه دکارت , 22 2 امیرخسرو دهلوی , 23 2 علی‌اکبر دهخدا , 24 2 مارکی دو کندورسه , 25 2 افلاطون

ago 2006: 1 3 ضرب‌المثل‌های آذربایجانی , 2 3 صفحهٔ اصلی , 3 2 صادق هدایت , 4 2 سووشون , 5 2 شازده کوچولو , 6 1 سید محمدحسین شهریار

set 2006: 1 4 صفحهٔ اصلی , 2 3 فهرست افراد بر پایه نام , 3 2 بيل گيتس , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 عمر خیام , 6 2 حافظ , 7 2 میکل‌ آنژ , 8 2 محمود احمدی‌نژاد , 9 1 شهریار

out 2006: 1 2 ژان پل , 2 2 حسن تقی‌زاده , 3 2 ضرب‌المثل‌های آذربایجانی , 4 2 حافظ , 5 2 وودی آلن , 6 2 سعدی , 7 2 فهرست افراد بر پایه نام , 8 1 فرانکا ماگنانی

nov 2006: 1 2 باران کوثری , 2 2 کارل گوستاو یونگ , 3 2 برتولت برشت , 4 2 فهرست افراد بر پایه نام , 5 2 صفحهٔ اصلی , 6 1 محمدرضا شفیعی کدکنی

dez 2006: 1 2 غلامرضا روحانی , 2 2 باران کوثری , 3 2 دنیای سوفی , 4 2 جنگ , 5 2 آلبرت اینشتین , 6 2 فهرست آثار ادبی , 7 1 ریچارد رورتی

jan 2007: 1 3 پدرخوانده (فیلم) , 2 2 ریچارد نیکسون , 3 2 نیکوس کازانتزاکیس , 4 2 ری بردبری , 5 2 محمد بن زکریای رازی , 6 2 محمود احمدی‌نژاد , 7 2 صفحهٔ اصلی , 8 1 ضرب‌المثل‌های اندونزیایی

fev 2007: 1 2 قیصر (فیلم) , 2 2 صفحهٔ اصلی , 3 1 انجیل متی

mar 2007: 1 3 لودویگ فان بتهوون , 2 3 فریدریش نیچه , 3 2 رمکو کامپرت , 4 2 محمدرضا شفیعی کدکنی , 5 2 کلیم کاشانی , 6 2 بایگانی نقل‌قول روز , 7 2 سعدی , 8 2 صفحهٔ اصلی , 9 1 در جستجوی زمان از دست رفته

abr 2007: 1 3 فریدریش نیچه , 2 2 داستان سیندرلا , 3 2 کما , 4 2 تقاطع , 5 2 مهمان (فیلم) , 6 2 اخراجی‌ها , 7 2 فریدون جنیدی , 8 2 ابوریحان بیرونی , 9 2 وحید قزوینی , 10 2 عمر خیام , 11 2 فردوسی , 12 2 مولوی , 13 2 مارتین لوتر

mai 2007: 1 2 راه بی‌پایان , 2 2 تله , 3 2 میم مثل مادر , 4 2 هنر , 5 2 جرج برنارد شاو , 6 2 فهرست آثار ادبی , 7 2 ناشناس , 8 1 اسدی طوسی

jun 2007: 1 2 جان رید , 2 2 مائو تسه تونگ , 3 2 باران کوثری , 4 2 محمد خیابانی , 5 2 عشق , 6 1 سرمایه‌داری

jul 2007: 1 2 سگ , 2 2 گربه , 3 2 عباس کیارستمی , 4 2 نیکلا سارکوزی , 5 2 روز سوم , 6 2 فریدریش انگلس , 7 2 مائو تسه تونگ , 8 2 فریدون جنیدی , 9 2 کارل مارکس , 10 2 سیسرو , 11 2 ضرب‌المثل‌های آلمانی , 12 2 علی شریعتی , 13 2 عشق , 14 1 کد داوینچی

ago 2007: 1 3 سیاست , 2 3 ضرب‌المثل‌های فارسی , 3 2 کریستین بوبن , 4 2 سید روح‌الله خمینی , 5 2 ازدواج , 6 2 آزادی , 7 2 ولادیمیر لنین , 8 2 کارل مارکس , 9 2 علویه خانم , 10 2 ضرب‌المثل‌های اسپانیایی , 11 2 مرتضی آوینی , 12 2 داگلاس آدامز , 13 2 هنر , 14 2 دانش , 15 2 دوستی , 16 2 جنگ , 17 1 سنگسار

set 2007: 1 3 لئون تروتسکی , 2 3 محمود احمدی‌نژاد , 3 2 شتر , 4 2 قلعه حیوانات , 5 2 ۱۹۸۴ (رمان) , 6 2 ملالی جویا , 7 2 سید روح‌الله خمینی , 8 2 فاطمه زهرا/گفتار هایی از فاطمه زهرا , 9 2 فاطمه زهرا در شعر فارسی , 10 2 فاطمه زهرا/فاطمه زهرا در نگاه امامان شیعه , 11 2 ولادیمیر لنین , 12 2 ایرج‌میرزا , 13 2 اهلی شیرازی , 14 2 نقل‌قول روز , 15 2 باران کوثری , 16 2 ضرب‌المثل‌های ارمنی , 17 2 ضرب‌المثل‌های ایتالیایی , 18 2 افلاطون , 19 2 دانش , 20 2 آندره ژید , 21 2 جرج هربرت , 22 2 موریس مترلینک , 23 2 فهرست فیلم‌ها , 24 2 لئو بوسکالیا , 25 2 سورن کی‌یر کگارد

out 2007: 1 3 کارل مارکس , 2 3 باران کوثری , 3 3 ضرب‌المثل‌های آذربایجانی , 4 3 ژان دو لا برویر , 5 3 سنایی , 6 3 رقص , 7 3 فهرست فیلم‌ها , 8 2 آندری تارکوفسکی , 9 2 جان لاک , 10 2 شتر , 11 2 اسب , 12 2 خر , 13 2 گرگ , 14 2 موش , 15 2 ملالی جویا , 16 2 لئون تروتسکی , 17 2 احمد بهمنیار , 18 2 ازدواج , 19 2 مهدی بازرگان , 20 2 رمز داوینچی (فیلم) , 21 2 سگ , 22 2 گربه , 23 2 فریدریش انگلس , 24 2 سعید نفیسی , 25 2 پروین اعتصامی

nov 2007: 1 3 علی بن ابی‌طالب , 2 2 داوید آلفارو سی‌که‌ایروس , 3 2 جیمز ناکس پولک , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 فیلم , 6 1 انقلاب

dez 2007: 1 5 فهرست افراد بر پایه نام , 2 4 دیوارنوشته , 3 4 ویلیام شکسپیر , 4 3 جلیل ضیاءپور , 5 3 خانه‌ای روی آب , 6 3 صلح , 7 3 فریدریش نیچه , 8 3 صفحهٔ اصلی , 9 2 ماهی , 10 2 انقلاب , 11 2 جورج دبلیو بوش , 12 2 سید محمدحسین شهریار , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 ضرب‌المثل‌های اسپانیایی , 15 2 فهرست نمایش‌های تلویزیونی , 16 2 ابن سینا , 17 2 عشق , 18 2 فهرست فیلم‌ها

jan 2008: 1 5 لوئیس بونوئل , 2 4 فهرست افراد بر پایه نام , 3 4 ضرب‌المثل‌های فارسی , 4 3 جنون , 5 3 سید محمدحسین شهریار , 6 3 ژان دارک , 7 3 محمود احمدی‌نژاد , 8 2 طبیعت , 9 2 جورج اورول , 10 2 دیوانگی , 11 2 زنبور , 12 2 مرگ , 13 2 خنده , 14 2 مکس پین , 15 2 کودک , 16 2 خوب، بد، زشت , 17 2 رومن رولان , 18 2 سیمین دانشور , 19 2 مادر , 20 2 فروغ فرخزاد , 21 2 کتاب , 22 2 عطار نیشابوری , 23 2 نیشابور , 24 2 جورج دبلیو بوش , 25 2 دنیای سوفی

fev 2008: 1 3 روشنفکر , 2 2 گل , 3 2 شراب , 4 2 سیمون دو بووار , 5 2 مرگ , 6 2 منیرو روانی‌پور , 7 2 فروغ فرخزاد , 8 2 کتاب , 9 2 تاریخ , 10 2 نقل‌قول روز , 11 2 نیکوس کازانتزاکیس , 12 2 ضرب‌المثل‌های ترکی , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 هنر , 15 2 عشق , 16 1 عارف قزوینی

mar 2008: 1 3 اورسن ولز , 2 3 فهرست افراد بر پایه نام , 3 2 مائو تسه‌تونگ , 4 2 سنگسار , 5 2 عشق , 6 2 کارلایل

abr 2008: 1 4 ژیل دلوز , 2 3 چنین گفت زرتشت , 3 3 سید علی خامنه‌ای , 4 3 شارلوت برونته , 5 3 فردریک هگل , 6 3 باروخ اسپینوزا , 7 3 ساموئل اسمایلز , 8 3 فهرست افراد بر پایه نام , 9 3 ناپلئون بناپارت , 10 3 صفحهٔ اصلی , 11 2 سید جمال‌الدین اسدآبادی , 12 2 محمد فضولی , 13 2 تقی ارانی , 14 2 کارلوس کاستاندا , 15 2 شیون فومنی , 16 2 لوچیو کولتی , 17 2 هربرت مارکوزه , 18 2 نیکوس پولانزاس , 19 2 گئورگ ویلهلم فریدریش هگل , 20 2 خنده , 21 2 لبخند , 22 2 مگس , 23 1 سید جمال الدین اسدآبادی

mai 2008: 1 6 فهرست افراد بر پایه نام , 2 3 حسین پناهی , 3 3 عشق , 4 3 صفحهٔ اصلی , 5 2 پروانه , 6 2 لرد بایرون , 7 2 پاپلی یزدی , 8 2 بلبل هزاردستان , 9 2 هانا آرنت , 10 2 دایره زنگی , 11 2 عارف قزوینی , 12 2 امیلی برونته , 13 2 دانش , 14 2 آرزو , 15 2 موریس مترلینک , 16 1 کسایی مروزی

jun 2008: 1 2 هنری دیوید ثورو , 2 2 لنگستون هیوز , 3 2 ستارخان , 4 2 شراب , 5 2 سنگسار , 6 2 بزرگمهر , 7 1 هدی شعراوی

jul 2008: 1 4 طاهره قرةالعین , 2 3 گوساله , 3 3 عباس کیارستمی , 4 3 فهرست افراد بر پایه نام , 5 2 مرد سوم , 6 2 نیمتاج سلماسی , 7 2 هوشنگ گلشیری , 8 2 نقش رستم , 9 2 تخت جمشید , 10 2 محمد محیط طباطبایی , 11 2 رشحه , 12 2 حسین پناهی , 13 2 اورسن ولز

ago 2008: 1 3 بوسه , 2 2 داستان دو شهر , 3 2 سکوت , 4 2 ۱۷ فوریه , 5 2 گراهام گرین , 6 2 هانیبال الخاص , 7 2 فضل‌الله نوری , 8 2 صائب تبریزی , 9 2 آندری تارکوفسکی , 10 2 لودویگ فان بتهوون , 11 2 مارتین لوتر کینگ جونیور , 12 2 عشق , 13 2 آلبرت اینشتین , 14 2 محمود احمدی‌نژاد , 15 1 اریش فروم

set 2008: 1 3 گربه روی شیروانی داغ (نمایشنامه) , 2 2 امیر نادری , 3 2 محمدحسین پاپلی یزدی , 4 2 تنسی ویلیامز , 5 2 دیپاک چوپرا , 6 2 پاپلی یزدی , 7 1 ۲ مه

out 2008: 1 2 حسام‌الدین خویی , 2 2 میرزا علی‌اکبر صابر , 3 2 امام محمد غزالی , 4 2 علی اکبر دهخدا , 5 1 حسام الدین خویی

nov 2008: 1 4 فهرست افراد بر پایه نام , 2 3 باراک اوباما , 3 1 ژان سیبلیوس

dez 2008: 1 2 گروچو مارکس , 2 2 لویی آرمسترانگ , 3 2 فردوسی , 4 2 سعدی , 5 2 اسکار وایلد

jan 2009: 1 3 محمد بن عبدالله , 2 2 امیلی دیکنسن , 3 2 گلادیاتور (فیلم ۲۰۰۰) , 4 2 کشمیری , 5 2 کشمیر , 6 1 ۱۴ ژانویه

fev 2009: 1 3 زن , 2 3 محمد علی کلی , 3 2 ماهواره امید , 4 2 حسن طبری آملی , 5 2 سید محمد‌کاظم شریعتمداری , 6 2 ولایت فقیه , 7 2 خلفای راشدین , 8 2 اردبیل , 9 2 شاهین نجفی , 10 2 دایره زنگی , 11 2 وحشی بافقی , 12 2 ابوریحان بیرونی , 13 2 خیلی دور، خیلی نزدیک , 14 2 قیصر (فیلم) , 15 2 آلفونس کار , 16 2 پائولو کوئلیو , 17 1 محیط طباطبائی

mar 2009: 1 2 علی اکبر شیرودی , 2 2 بهاریه , 3 2 حسن لاهوتی اشکوری , 4 2 حسن طبری آملی , 5 2 شارلوت برونته , 6 2 حسین بن علی , 7 2 هاینریش هاینه , 8 2 گابریل گارسیا مارکز , 9 2 رنه دکارت , 10 2 ژان دو لا فونتن , 11 2 رودکی , 12 2 ابن سینا , 13 2 عمر خیام , 14 2 استانیسلاو لم , 15 2 آلبر کامو , 16 2 تالس , 17 2 آلبرت اینشتین , 18 2 جرج برنارد شاو , 19 2 مارشال مک‌لوهان , 20 1 علی صیاد شیرازی

abr 2009: 1 4 فهرست افراد بر پایه نام , 2 3 حسین بن منصور حلاج , 3 2 ریچارد براتیگان , 4 2 آنا آخماتووا , 5 2 فروغ فرخزاد , 6 2 عطار نیشابوری , 7 2 سعدی , 8 2 یوهان ولفگانگ گوته , 9 2 آلبرت اینشتین , 10 2 منصور حکمت , 11 1 مهدی رجب بیگی

mai 2009: 1 5 فهرست افراد بر پایه نام , 2 2 عماد مغنیه , 3 2 صلح , 4 2 سید روح‌الله خمینی , 5 2 فردوسی

jun 2009: 1 2 تبریز , 2 2 جرج برناردشاو , 3 2 لئوناردو داوینچی , 4 2 دارودسته‌های نیویورکی , 5 1 لئونارد داوینچی

jul 2009: 1 4 علی بن ابی‌طالب , 2 2 زن , 3 2 استیون واینبرگ , 4 1 توماس هنری هاکسلی

ago 2009: 1 4 احمد مفتی‌زاده , 2 4 شعارهای جنبش سبز , 3 4 ضرب‌المثل‌های چینی , 4 3 میرحسین موسوی , 5 3 آبراهام لینکلن , 6 3 علی بن ابی‌طالب , 7 3 محمود احمدی‌نژاد , 8 2 گیتی نوین , 9 2 شهادت , 10 2 اتو فون بیسمارک , 11 2 تائو ته جینگ , 12 2 ریچارد براتیگان , 13 2 اکبر هاشمی رفسنجانی , 14 2 هنری دیوید ثورو , 15 2 کبک , 16 2 فخرالدین اسعد گرگانی , 17 2 جورج اورول , 18 2 لبخند , 19 2 پلنگ , 20 2 شیر , 21 2 سید روح‌الله خمینی , 22 2 گربه , 23 2 ضرب‌المثل‌های مصری , 24 2 ضرب‌المثل‌های مازندرانی , 25 2 ضرب‌المثل‌های ایتالیایی

set 2009: 1 3 سید محمد خاتمی , 2 3 علی شریعتی , 3 3 فهرست افراد بر پایه نام , 4 2 در بروژ , 5 2 احمد مفتی‌زاده , 6 2 شعارهای جنبش سبز , 7 2 میرحسین موسوی , 8 2 دزدان دریایی کارائیب: صندوق مرد مرده , 9 2 حسین پناهی , 10 2 سید علی خامنه‌ای , 11 2 کورش بزرگ , 12 2 کارل سندبرگ , 13 1 پیامک

out 2009: 1 3 جنگ , 2 3 چارلز دیکنز , 3 3 فهرست افراد بر پایه نام , 4 2 خواب , 5 2 ابریشم , 6 2 امام سجاد , 7 2 بهلول , 8 2 جرج واشنگتن , 9 2 امام محمد باقر , 10 2 جعفر صادق , 11 2 جیم موریسون , 12 2 اتو فون بیسمارک , 13 2 میرحسین موسوی , 14 2 لئوناردو داوینچی , 15 2 لائوتسه , 16 2 ضرب‌المثل‌های فنلاندی , 17 2 زیگموند فروید , 18 2 کار , 19 2 مائو تسه‌تونگ , 20 2 انقلاب , 21 2 سگ , 22 2 ضرب‌المثل‌های فرانسوی , 23 2 ولادیمیر لنین , 24 2 سرمایه‌داری , 25 2 استانیسلاو یرسی لخ

nov 2009: 1 4 محمود احمدی‌نژاد , 2 2 ضرب‌المثل‌های فرانسوی , 3 2 تاریخ , 4 2 عشق , 5 2 ژان پل سارتر , 6 2 ماهاتما گاندی , 7 1 چه‌گوارا

dez 2009: 1 2 کارل مارکس , 2 2 مایکل جکسون , 3 1 سید احمد علم‌الهدی

jan 2010: 1 2 ریاضی , 2 2 محمدرضا شجریان , 3 2 سید احمد علم‌الهدی , 4 2 اسفندیار رحیم‌مشایی , 5 2 میرحسین موسوی , 6 2 ضرب‌المثل‌های آذربایجانی , 7 1 بیماری

fev 2010: 1 3 جنبش سبز , 2 3 فهرست فیلم‌ها , 3 2 لئوناردو داوینچی , 4 1 پل ورلن

mar 2010: 1 2 شعارهای جنبش سبز , 2 2 جی. دی. سالینجر , 3 2 چارلز داروین , 4 2 فهرست افراد بر پایه نام , 5 1 کورش کوچک

abr 2010: 1 5 بهاءالله , 2 3 محمود احمدی‌نژاد , 3 2 هرات , 4 2 سید حسن فیروزآبادی , 5 2 اسکندر بزرگ , 6 2 میرحسین موسوی , 7 2 ناپلئون هیل , 8 2 سید علی خامنه‌ای , 9 2 حافظه (جانداران) , 10 2 آنتون چخوف , 11 2 افلاطون , 12 2 هنر , 13 2 وودی آلن , 14 1 پیامک

mai 2010: 1 2 بهاءالله , 2 2 محمدرضا شجریان , 3 2 فردوسی , 4 1 سلام

jun 2010: 1 3 سید روح‌الله خمینی , 2 2 کاظم صدیقی , 3 2 سید علی خامنه‌ای , 4 2 ریچارد داوکینز , 5 2 جورج دبلیو بوش , 6 2 ژوزف استالین , 7 2 فهرست افراد بر پایه نام , 8 1 حاتم طایی

jul 2010: 1 2 خوزستان , 2 2 بدبیاری‌ها , 3 2 آین رند , 4 2 معجزه , 5 2 چارلز داروین , 6 2 استانیسلاو لم , 7 2 حسین الهی قمشه‌ای , 8 2 جرج برنارد شاو , 9 2 علی بن ابی‌طالب , 10 2 ضرب‌المثل‌های فارسی , 11 1 عین القضاة همدانی

ago 2010: 1 4 دخانیات , 2 4 محمود احمدی‌نژاد , 3 3 حامد کرزی , 4 3 خلیج فارس , 5 3 خوزستان , 6 3 سید علی‌محمد دستغیب , 7 3 نیشابور , 8 3 فریدریش نیچه , 9 3 فهرست افراد بر پایه نام , 10 3 ناپلئون بناپارت , 11 3 ضرب‌المثل‌های فارسی , 12 2 پیامک , 13 2 محمدرضا رحیمی , 14 2 آیزاک آسیموف , 15 2 چای , 16 2 فاجعه قطار نیشابور , 17 2 افغانستان , 18 2 ابراهیم یسری , 19 2 آین رند , 20 2 سلام , 21 2 هرات , 22 2 سید حسن فیروزآبادی , 23 2 توماس ادیسون , 24 2 مهدی کروبی , 25 2 آمریکا

set 2010: 1 5 علی بن ابی‌طالب , 2 5 فهرست افراد بر پایه نام , 3 3 سهیل پسر عمرو , 4 3 عمرو عاص , 5 3 محمد علی کلی , 6 3 باراک اوباما , 7 3 حسین بن علی , 8 2 جلال‌الدین فارسی , 9 2 ابوالحسن بنی‌صدر , 10 2 معاویه پسر ابی‌سفیان , 11 2 میدان نقش جهان , 12 2 دمشق , 13 2 یوسف صانعی , 14 1 پیامک

out 2010: 1 2 قهوه تلخ , 2 2 آنتون چخوف , 3 2 ریچارد فاینمن , 4 2 علی بن ابی‌طالب , 5 2 جکسون براون , 6 2 ضرب‌المثل‌های فارسی , 7 1 قهوه تلخ (سریال)

nov 2010: 1 3 قهوه تلخ , 2 3 جرج برنارد شاو , 3 2 غلامحسین ساعدی , 4 2 غلامعلی بسکی , 5 2 محسن قرائتی , 6 2 سکوت , 7 2 آلبرت شوایتزر , 8 2 علی شریعتی , 9 2 آناتول فرانس , 10 1 هارون‌الرشید

dez 2010: 1 3 آبراهام لینکلن , 2 3 آلبرت اینشتین , 3 2 سنگسار در اسلام , 4 2 حامد کرزی , 5 2 سید حسن فیروزآبادی , 6 2 صخره (فیلم) , 7 2 تغییر چهره , 8 2 بروس لی , 9 2 جرج واشنگتن , 10 2 زن , 11 2 سید محمد‌کاظم شریعتمداری , 12 2 جیمی ولز , 13 2 سید علی خامنه‌ای , 14 2 وحشی بافقی , 15 2 باران , 16 2 رومن گاری , 17 2 سنگسار , 18 2 فروغ فرخزاد , 19 2 آنتون چخوف , 20 2 داگلاس آدامز , 21 2 آموزش , 22 2 دوستی , 23 2 جنگ , 24 2 آلبرت شوایتزر , 25 2 رالف والدو امرسن

jan 2011: 1 4 علی بن ابی‌طالب , 2 3 افغانستان , 3 3 علی‌رضا افتخاری , 4 3 آمریکا , 5 3 دوستی , 6 3 فهرست فیلم‌ها , 7 3 محمد بن عبدالله , 8 3 محمود احمدی‌نژاد , 9 2 پیامک , 10 2 مهدی , 11 2 توبه , 12 2 رضی‌الدین نیشابوری , 13 2 ابرهه بن صباح , 14 2 قاسم بن محمد , 15 2 عبدالله بن شبرمه , 16 2 امانوئل لاسکر , 17 2 شطرنج , 18 2 ابی بن کعب , 19 2 عایشه , 20 2 جواد عزتی , 21 2 ابن عباس , 22 2 ابن قیم الجوزیه , 23 2 حسن بصری , 24 2 زین‌العابدین مراغه‌ای , 25 2 مصر

fev 2011: 1 3 خلیج فارس , 2 3 ایران , 3 2 معمر قذافی , 4 2 مأمون , 5 2 مشورت , 6 2 مدینه , 7 2 حسنی مبارک , 8 2 شعارهای انقلاب ۲۰۱۱ مصر , 9 2 نام‌گذاری فرزند , 10 2 ضرب‌المثل‌های موصلی , 11 2 عمر بن خطاب , 12 2 ابوبکر , 13 2 عزت‌الله سحابی , 14 2 توماس ادیسون , 15 2 عبدالکریم سروش , 16 2 میرحسین موسوی , 17 2 گلادیاتور (فیلم ۲۰۰۰) , 18 2 محمدحسین پاپلی یزدی , 19 2 آنتون چخوف , 20 2 منوچهر آتشی , 21 2 عمر خیام , 22 1 شعارهای انقلاب ۲۰۱۱ لیبی

mar 2011: 1 5 علی بن ابی‌طالب , 2 4 آدولف هیتلر , 3 3 جواد عزتی , 4 3 عمر بن خطاب , 5 3 ابوبکر , 6 3 توماس ادیسون , 7 3 لائوتسه , 8 3 مار , 9 3 اسب , 10 3 گرگ , 11 3 تاریخ , 12 3 نیشابور , 13 3 ضرب‌المثل‌های چینی , 14 2 علی ابن ابی‌طالب , 15 2 کیم وو چونگ , 16 2 طاهر بن حسین , 17 2 فاروق , 18 2 ابوعثمان سعید مغربی , 19 2 سید حسن مدرس , 20 2 نجم‌الدین اربکان , 21 2 روژه گارودی , 22 2 معمر قذافی , 23 2 قدس , 24 2 عبدالجواد ادیب نیشابوری , 25 2 اندیشه

abr 2011: 1 2 ابوسعید ابوالخیر , 2 2 ضرب‌المثل‌های خراسانی , 3 2 حافظ , 4 2 چارلی چاپلین , 5 2 مارک تواین , 6 1 لودویک زامنهوف

mai 2011: 1 2 جفرسون دیویس , 2 2 خواجه عبدالله انصاری , 3 2 علویه خانم , 4 2 مولوی , 5 2 سعدی , 6 2 علی بن ابی‌طالب , 7 1 ناصر حجازی

jun 2011: 1 2 ابوبکر , 2 2 ایران , 3 1 آشنایی با مادر

jul 2011: 1 2 داگلاس آدامز , 2 1 علی بن ابیطالب

ago 2011: 1 3 عمر بن خطاب , 2 2 کورش بزرگ , 3 1 میرزا حسین‌علی نوری

set 2011: 1 3 فهرست آثار ادبی , 2 2 جرم (فیلم) , 3 2 فرینج , 4 2 نیشابور , 5 2 کازابلانکا (فیلم) , 6 2 فهرست فیلم‌ها , 7 1 هوشنگ ایرانی

out 2011: 1 2 جدایی نادر از سیمین , 2 2 ویکیگفتاورد:قهوهخانه , 3 2 دنیای قشنگ نو , 4 2 هرودوت , 5 2 مارتین نیمولر , 6 2 نیشابور , 7 2 ضرب‌المثل‌های چینی , 8 2 پدرخوانده (فیلم) , 9 2 آلبرت اینشتین , 10 1 اینشتین

nov 2011: 1 4 ازدواج , 2 3 مبارزه متعالی , 3 2 شعور خلاق , 4 2 کلام خلاق , 5 2 قضاوت , 6 2 محمدحسین پاپلی یزدی , 7 2 زندگی , 8 1 یوحنای مجنون

dez 2011: 1 3 ایلیا میم , 2 2 پیمان فتاحی , 3 2 هامون , 4 2 محمدرضا پهلوی , 5 2 محمد مصدق , 6 2 دوستی , 7 2 مایکل جکسون , 8 2 فهرست آثار ادبی

jan 2012: 1 3 ضرب‌المثل‌های فارسی , 2 2 علاءالدین ملماسی , 3 2 سید روح‌الله خمینی , 4 2 فریدون جنیدی , 5 2 بيل گيتس , 6 2 ارنست همینگوی , 7 2 فهرست فیلم‌ها , 8 1 هوپ‌هوپ‌نامه

fev 2012: 1 2 آمل , 2 1 طالب آملی

mar 2012: 1 2 پیمان فتاحی , 2 2 مولوی , 3 2 مریلین منسون , 4 2 فهرست آثار ادبی , 5 2 فهرست افراد بر پایه نام

abr 2012: 1 5 ماهواره امید , 2 3 فهرست افراد بر پایه نام , 3 2 تمایل جنسی , 4 2 بایزید بسطامی , 5 2 جانی دپ , 6 2 مذهب , 7 2 علی شریعتی , 8 2 امبرتو اکو , 9 1 شادی

mai 2012: 1 3 مارک تواین , 2 2 پرویز شهریاری , 3 2 شاهین نجفی , 4 2 جرج برنارد شاو , 5 2 فهرست افراد بر پایه نام , 6 1 کارل سیگن

jun 2012: 1 2 سیروان خسروی , 2 1 بابک خرمدین

jul 2012: 1 3 رضاشاه , 2 2 ارباب کمان نقره‌ای , 3 2 نرم‌افزار آزاد , 4 2 قرآن , 5 2 ضرب‌المثل‌های آذربایجانی , 6 2 فهرست فیلم‌ها , 7 2 جرج برنارد شاو , 8 2 مارک تواین , 9 1 اتاقی از آن خود

ago 2012: 1 3 فهرست فیلم‌ها , 2 2 دیوانه‌ای از قفس پرید (فیلم ۱۳۸۱) , 3 2 سفر به انتهای شب , 4 2 خاطرات خون‌آشام , 5 2 عمر بن خطاب , 6 2 هانا آرنت , 7 2 صادق هدایت , 8 1 زیستن چون پروانه

set 2012: 1 1 بهار ۶۳

out 2012: 1 2 فهرست افراد بر پایه نام , 2 1 ضرب‌المثل‌های کردی

nov 2012: 1 5 فهرست افراد بر پایه نام , 2 2 عمر بن خطاب , 3 1 محمود کریمی حکاک

dez 2012: 1 2 مصطفی دلشاد تهرانی , 2 2 فهرست افراد بر پایه نام , 3 1 امیر قلعه نویی

jan 2013: 1 3 عمر بن خطاب , 2 2 جورج اورول , 3 2 مسیر سبز , 4 2 عشق , 5 2 محمد بن عبدالله , 6 2 فهرست افراد بر پایه نام , 7 1 لیلا صادقی

fev 2013: 1 2 ناجی العلی , 2 2 آسیا عبدالله

mar 2013: 1 2 سید علی خامنه‌ای , 2 1 انیو موریکونه

abr 2013: 1 3 ماکسیمیلیان روبسپیر , 2 3 لوئی آنتوان دو سن-ژوست , 3 3 انیو موریکونه , 4 3 مختارنامه (مجموعه تلویزیونی) , 5 2 حرفه‌اي , 6 2 حرفه‌ای , 7 2 سید محمد‌کاظم شریعتمداری , 8 1 عماد خراسانی

mai 2013: 1 4 دینو بوتزاتی , 2 4 آزادی , 3 3 عماد خراسانی , 4 3 ضرب‌المثل‌های بختیاری , 5 3 فریدون مشیری , 6 1 ماکسیم گورکی

jun 2013: 1 3 بيل گيتس , 2 2 مالکوم لطیف شباز , 3 2 حسن روحانی , 4 2 آین رند , 5 2 مائو تسه‌تونگ , 6 2 بنجامین فرانکلین , 7 2 ژان ژاک روسو , 8 1 آبراهام مزلو

jul 2013: 1 2 ایندیرا گاندی , 2 1 100 گفتار

ago 2013: 1 3 توماس هاکسلی , 2 3 حسن روحانی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 2 محمد بن موسی خوارزمی , 6 2 فرزندان , 7 2 داوید هیلبرت , 8 2 محمدعلی جمال‌زاده , 9 2 پینوکیو (فیلم ۱۹۴۰) , 10 2 ناخدا خورشید , 11 2 باغ‌های کندلوس , 12 2 لودویگ ویتگنشتاین , 13 2 والتر اسکات , 14 2 راینر ماریا ریلکه , 15 2 کاشان , 16 2 البرت هوبارد , 17 2 ایندیرا گاندی , 18 2 دوایت آیزنهاور , 19 2 فرانک تایگر , 20 2 آلیس واکر , 21 2 لوئی آنتوان دو سن-ژوست , 22 2 پایتخت (مجموعه تلویزیونی) , 23 2 داریوش یکم , 24 2 گشت ارشاد , 25 2 بهاءالدین عاملی

set 2013: 1 3 پینوکیو (فیلم ۱۹۴۰) , 2 3 فهرست افراد بر پایه نام , 3 2 شمع , 4 2 زیر پوست شهر , 5 2 دوستان (مجموعه تلویزیونی) , 6 2 جیمز جویس , 7 2 گی دو موپاسان , 8 2 جان استاین‌بک , 9 2 ابوبکر کرجی , 10 2 آنه فرانک , 11 2 اولتیماتوم بورن (فیلم) , 12 2 بی‌خوابی (فیلم) , 13 2 کسب و کار ایتالیایی , 14 2 هفت سامورایی , 15 2 اسکای‌فال , 16 1 پاتریس لومومبا

out 2013: 1 2 نورعلی الهی , 2 2 پینوکیو (فیلم ۱۹۴۰) , 3 2 ایرانی , 4 2 سید محمد خاتمی , 5 2 فهرست فیلم‌ها , 6 2 علی بن ابی‌طالب , 7 1 شمس تبریزی

nov 2013: 1 2 دوستان , 2 2 خردمند , 3 2 محمدجواد ظریف , 4 2 نورعلی الهی , 5 2 لودویگ ویتگنشتاین , 6 2 شطرنج , 7 2 عشق , 8 2 علی بن ابی‌طالب , 9 1 علی زین العابدین

dez 2013: 1 4 دانش , 2 3 جینا جیمسون , 3 3 ارتداد در اسلام , 4 3 سنگسار در اسلام , 5 3 جرج واشنگتن , 6 3 کورش بزرگ , 7 2 سفیر بودن , 8 2 سفارت , 9 2 فریدریش هایک , 10 2 خرما , 11 2 نهنگ , 12 2 جوزف کمبل , 13 2 لوییزا می الکات , 14 2 هشت صبح , 15 2 سید علی‌اصغر دستغیب , 16 2 نلسون ماندلا , 17 2 مبارزه متعالی , 18 2 بخشندگی , 19 2 ابوسعید ابوالخیر , 20 2 زکات , 21 2 شطرنج , 22 2 ناصر مکارم شیرازی , 23 2 میرزا کوچک خان جنگلی , 24 2 نماز (اسلام) , 25 2 زن

jan 2014: 1 3 اسماعیل دوم , 2 3 آلبرت اشپر , 3 3 علی بن موسی الرضا , 4 2 یاس (خواننده) , 5 2 آل کاپون , 6 2 پول , 7 2 اخلاق , 8 2 اراده , 9 2 جوانی , 10 2 حسادت , 11 2 خرد , 12 2 تجربه , 13 2 طمع , 14 2 ارحام , 15 2 استبداد , 16 2 جهان , 17 2 بیابان , 18 2 حسن روحانی , 19 2 اندیشه , 20 2 عمر بن خطاب , 21 2 زیبایی آمریکایی , 22 2 انسان , 23 2 حسن بن علی , 24 2 زن , 25 2 بوسه

fev 2014: 1 3 ژوزه ساراماگو , 2 3 کورش بزرگ , 3 2 تحقیر , 4 2 کرت وانه‌گت , 5 2 علی کریمی , 6 2 آلکساندر سولژنیتسین , 7 2 شمس تبریزی , 8 2 ملاله یوسف‌زی , 9 2 جان استاین‌بک , 10 2 صدام حسین , 11 2 گهواره گربه , 12 2 شوالیه تاریکی , 13 2 بغداد , 14 2 معمر قذافی , 15 2 حج , 16 2 ابوبکر , 17 2 حامد کرزی , 18 2 سجاد , 19 2 جعفر صادق , 20 2 ایران , 21 2 تهران , 22 2 محمدرضا پهلوی , 23 2 حسین بن علی , 24 2 مخمصه (فیلم ۱۹۹۵) , 25 2 رستگاری در شاوشنک

mar 2014: 1 4 زندگی , 2 3 حسن روحانی , 3 3 عمر مختار , 4 3 انسان , 5 2 پریکلس , 6 2 مجید مجیدی , 7 2 بیل برایسون , 8 2 توپاک شکور , 9 2 کریستوفر مارلو , 10 2 ادگار واتسون هاو , 11 2 پیک , 12 2 ساموئل جانسون , 13 2 کلارنس دارو , 14 2 سو تاونسند , 15 2 والتر رالی , 16 2 جان ماری گیبون , 17 2 جان هیت استابز , 18 2 رالف ریچاردسون , 19 2 اشرف ریفی , 20 2 حکومت , 21 2 سال بلو , 22 2 آرت بوخوالد , 23 2 سیلماریلیون , 24 2 دایدو , 25 2 اسلام

abr 2014: 1 3 والتر گروپیوس , 2 3 فاطمه زهرا , 3 3 ویلیام سارویان , 4 3 ریچارد فاینمن , 5 3 آنتونی رابینز , 6 2 حسین محدث نوری , 7 2 هریت بیچر استو , 8 2 مارکی دو ساد , 9 2 راشل کارسون , 10 2 ژان-ماری گوستاو لو کلزیو , 11 2 پسرعمه زا , 12 2 احمد مسجدجامعی , 13 2 کورمک مک‌کارتی , 14 2 جورج کارلین , 15 2 رضا نظری , 16 2 کریستوفر مارلو , 17 2 فضل‌الله زاهدی , 18 2 رجب طیب اردوغان , 19 2 عبدالله بن عبدالعزیز , 20 2 محسن موسوی تبریزی , 21 2 عبدالرحمن اوزاعی , 22 2 نادانی , 23 2 آب , 24 2 یوهان گوتفرید هردر , 25 2 لوییزا می الکات

mai 2014: 1 3 رضا داوری اردکانی , 2 3 مریم طاهری مجد , 3 3 کامبیز درم‌بخش , 4 3 لودویگ ویتگنشتاین , 5 2 ارومیه , 6 2 ایوان تورگنیف , 7 2 نیکلای گوگول , 8 2 مصطفی ملکیان , 9 2 احسان نراقی , 10 2 لیلا حاتمی , 11 2 غلامحسین ابراهیمی دینانی , 12 2 ناتاشا امیری , 13 2 مهشید امیرشاهی , 14 2 فرخنده آقایی , 15 2 شیرین نشاط , 16 2 پگاه احمدی , 17 2 بهاره رهنما , 18 2 ابوتراب خسروی , 19 2 مهدی یزدانی‌خرم , 20 2 حمیدرضا صدر , 21 2 محمد بساطی , 22 2 خیری شلبی , 23 2 علاء الاسوانی , 24 2 ابراهیم اصلان , 25 2 ادوار خراط

jun 2014: 1 3 آنتیستینس , 2 3 اخراجی‌ها ۲ , 3 2 رضا نظری , 4 2 تعلیم و تربیت , 5 2 آل کاپون , 6 2 تملق , 7 2 سید محمدجواد غروی , 8 2 آلبرت اشپر , 9 2 دوستان (مجموعه تلویزیونی) , 10 2 بالا در آسمان (فیلم ۲۰۰۹) , 11 2 مالکوم لطیف شباز , 12 2 بابک خرمدین , 13 2 پیامک , 14 2 بوی کافور، عطر یاس , 15 2 قضاوت , 16 2 مبارزه متعالی , 17 2 بوقچی , 18 2 جان‌سخت ۴ , 19 2 جواد خیابانی , 20 2 مؤذن , 21 2 بدبیاری‌ها , 22 2 لویاتان (رمان) , 23 2 بهارستان (کتاب) , 24 2 مارسل بلیوو , 25 2 باربارا دی آنجلیس

jul 2014: 1 3 آروین د. یالوم , 2 3 گراتزیا دلدا , 3 2 جیم موران , 4 2 نوری مالکی , 5 2 جی.کی. رولینگ , 6 2 داعش , 7 2 خسرو شکیبایی , 8 2 حماس , 9 2 پیروز مجتهدزاده , 10 2 سید محمود هاشمی شاهرودی , 11 2 سیما تیرانداز , 12 2 محمدباقر نجفی اصفهانی , 13 2 حسن قزوینی , 14 2 تروریسم , 15 2 ابوبکر کرجی , 16 2 سجاد , 17 2 روز قدس , 18 2 هوشنگ ابتهاج , 19 2 مهدی اخوان ثالث , 20 2 کورش بزرگ , 21 2 حافظ , 22 1 تغار

ago 2014: 1 3 فریدون فرخزاد , 2 3 فضل‌الله نوری , 3 2 رحم , 4 2 یزدگرد سوم , 5 2 وضعیت سفید , 6 2 علی دیواندری , 7 2 ایران , 8 2 گربه , 9 2 صادق هدایت , 10 2 فهرست افراد بر پایه نام , 11 1 مسیحیت

set 2014: 1 2 مسعود جعفری جوزانی , 2 2 غلامرضا اعوانی , 3 2 محمدامین قانعی‌راد , 4 2 سید جواد طباطبایی , 5 2 هوگو چاوز , 6 2 ماکسیم رودینسون , 7 2 برنار کوشنر , 8 2 جان راسکین , 9 2 دایدو , 10 2 بدیع‌الزمان همدانی , 11 2 رضا کیانیان , 12 2 حامد کرزی , 13 2 عادل فردوسی‌پور , 14 2 ایران , 15 2 تهران , 16 2 گربه , 17 1 ابن قتیبه دینوری

out 2014: 1 3 حسین شهابی , 2 2 محمد نوریزاد , 3 2 منجمد (فیلم ۲۰۱۳) , 4 2 رسول یونان , 5 2 محمدکریم پیرنیا , 6 2 فریدون آدمیت , 7 2 عبدالسلام عظیمی , 8 2 بن افلک , 9 2 استاد الهی , 10 2 نعمت‌الله فاضلی

nov 2014: 1 4 حسین شهابی , 2 3 جک هندی , 3 2 غلامحسین ابراهیمی دینانی , 4 2 ارتداد در اسلام , 5 1 لودویگ وان بتهوون

dez 2014: 1 2 حسین شهابی , 2 2 هوپ‌هوپ‌نامه , 3 2 جلال‌الدین فارسی , 4 2 حسن رحیم‌پور ازغدی , 5 2 بروس لی , 6 1 علی زعیم

jan 2015: 1 2 زندگی در پیش رو , 2 2 ناجی العلی , 3 2 سهراب سپهری , 4 2 فردوسی , 5 1 میرزا سروش لهراسب

fev 2015: 1 3 ویلیام فاکنر , 2 2 بازاریابی شبکه‌ای , 3 2 تئو درات , 4 2 برایان کرنیگان , 5 2 جامیکا کینکید , 6 2 استیون اسپندر , 7 2 مارگارت تاچر , 8 2 دنیس ریچی , 9 2 انجمن حجتیه , 10 2 ایران , 11 2 تهران , 12 2 خواجه عبدالله انصاری , 13 2 اوشو , 14 2 باباطاهر , 15 2 حافظ , 16 2 داگلاس آدامز , 17 2 عشق , 18 2 فرانسیس بیکن

mar 2015: 1 3 پل اردیش , 2 3 ریاضیدان , 3 2 لینوس توروالدز , 4 2 بازاریابی شبکه‌ای , 5 2 برهان غلیون , 6 2 فریدون فرخزاد , 7 2 داعش , 8 2 عبدالسلام , 9 2 آدولف اوکس , 10 2 هانس کریستیان آندرسن , 11 2 کن تامسون , 12 2 ایران , 13 2 ونسان ون گوگ , 14 2 فردریک هگل , 15 2 قرآن , 16 2 ابن سینا , 17 2 سعدی , 18 2 ویرجینیا وولف , 19 1 سحر جعفری جوزانی

abr 2015: 1 2 طبل حلبی , 2 2 یوهان ولفگانگ فون گوته , 3 2 آنری پوانکاره , 4 2 حسن روحانی , 5 2 چارلز داروین

mai 2015: 1 2 ۲۰۰۱: یک اودیسه فضایی , 2 2 حسین شهابی , 3 2 داعش , 4 2 مصطفی چمران , 5 2 حسین بن علی , 6 1 هاگاکوره

jun 2015: 1 2 عباس زریاب خویی , 2 2 چشم‌هایش , 3 2 صادق هدایت , 4 2 علی بن ابی‌طالب , 5 1 خرمگس (رمان)

jul 2015: 1 3 عزت‌الله ضرغامی , 2 3 مرگ , 3 2 رابرت دنیرو , 4 2 فلسفه , 5 2 محمد معین , 6 2 جهودیان ایران , 7 2 جهود ایران , 8 2 تاریخ یهودیان در ایران , 9 2 یهودیان در تاریخ ایران , 10 2 یهودیان در ایران , 11 2 مرتضی پاشایی , 12 2 راس پرو , 13 2 سعید عالم‌زاده , 14 2 مهدی امینی‌خواه , 15 2 جلال مقدم , 16 2 علی حاتمی , 17 2 سپند امیرسلیمانی , 18 2 امین حیایی , 19 2 خانه سینمای ایران , 20 2 اکبر عبدی , 21 2 محمدعلی همایون کاتوزیان , 22 2 سازمان صدا و سیمای جمهوری اسلامی ایران , 23 2 حقوق بشر , 24 2 خوش‌خط‌نویسی , 25 2 خوشخطنویسی

ago 2015: 1 4 گاییدن , 2 4 نگار استخر , 3 4 سکس , 4 4 تمایل جنسی , 5 4 ویلیام گیبسون , 6 4 فهرست افراد بر پایه نام , 7 3 سیلویا فدریچی , 8 3 یوزپلنگ آسیایی , 9 3 غروب , 10 3 احمد محمود , 11 3 مهدی‌قلی هدایت , 12 3 درک والکوت , 13 3 تئاتر شهر تهران , 14 3 احسان طبری , 15 3 شب‌های روشن , 16 3 سنیه صالح , 17 3 توماس هاردی , 18 3 دیاکو , 19 3 راگنار فریش , 20 3 محمدجواد حجتی کرمانی , 21 3 جین آدامز , 22 3 لیما گبوی , 23 3 وانگاری ماآتای , 24 3 داریوش مهرجویی , 25 3 آلبانی

set 2015: 1 3 اینگمار برگمان , 2 3 ماجرای عجیب سگی در شب , 3 3 دموکریت , 4 3 دیوژن کلبی , 5 3 هراکلیتوس , 6 2 الکساندر گراهام بل , 7 2 فرانتس شوبرت , 8 2 دلکش , 9 2 آلفرد رنیی , 10 2 ماری گل-من , 11 2 آگوستین , 12 2 کیتی پری , 13 2 در کمال خونسردی (فیلم) , 14 2 جودی فاستر , 15 2 کارل لینه , 16 2 قارون , 17 2 کولیندا گرابار کیتاروویچ , 18 2 داریو فو , 19 2 پیمان فتاحی , 20 2 محمد علی فروغی , 21 2 راه‌آهن ایران , 22 2 نائومی واتس , 23 2 مرگ بر آمریکا , 24 2 جمهوری دموکراتیک کنگو , 25 2 آنتونی هاپکینز

out 2015: 1 3 وارن بافت , 2 3 الکساندر فلمینگ , 3 3 فهرست افراد بر پایه نام , 4 2 دوروتی پارکر , 5 2 آناکساگوراس , 6 1 محمدرضا کلهر

nov 2015: 1 3 منظر حسینی , 2 3 سید میثم آقا سید حسینی , 3 3 شهریار , 4 2 مهین اسکویی , 5 2 یانی , 6 2 غبار ستاره (فیلم ۲۰۰۷) , 7 2 مریم فیروز , 8 1 یوجین اونیل

dez 2015: 1 3 ضرب‌المثل‌های کرمانی , 2 2 آلن دو باتن , 3 2 مانس اشپربر , 4 2 تصمیم‌گیری , 5 2 جلیل صفربیگی , 6 2 اکبر اکسیر , 7 2 مارس اشپربر , 8 2 میشل دو مونتنی , 9 2 میگل د سروانتس , 10 2 سنکا , 11 2 لوکرتیوس , 12 2 رولو می , 13 1 حزب‌الله

jan 2016: 1 3 توماس هابز , 2 2 تهوع (رمان) , 3 2 هراکلیتوس , 4 2 داعش , 5 2 سجاد , 6 2 تبریز , 7 1 هیتمن: مأمور ۴۷

fev 2016: 1 2 سخنان ارسطو , 2 2 سخنان افلاطون , 3 2 سخنان دکارت , 4 1 آلکساندر گلییویچ دوگین

mar 2016: 1 1 زویا پیرزاد

abr 2016: 1 2 ایرج مرادی , 2 2 ابراهیم حشمت , 3 2 منظر حسینی , 4 2 سید میثم آقا سید حسینی , 5 2 امیرکبیر , 6 1 سیدمیثم آقاسیدحسینی

mai 2016: 1 3 محمدامین عیسایی , 2 2 هادی پاکزاد , 3 2 فریار اسدیان , 4 2 رابرت فراست , 5 2 روبر دوانو , 6 1 علیرضا صدیق پور

jun 2016: 1 3 هادی پاکزاد , 2 2 ضرب‌المثل‌های سنگسری , 3 2 سرگئی راخمانینف , 4 2 کاترین منسفیلد , 5 2 فهم , 6 2 انجمن قلم ایران (درتبعید) , 7 1 غرب

jul 2016: 1 3 کارل مانهایم , 2 3 آتش بس , 3 3 مهدیه الهی قمشه‌ای , 4 2 گئورگ زیمل , 5 2 مانوئل کاستلز , 6 2 آنتونی گیدنز , 7 2 پاول فایرابند , 8 2 محمود افضل‌الملک کرمانی , 9 2 یحیی مهدوی , 10 2 جرمی بنتام , 11 2 فرناندو پسوآ , 12 2 ادوارد موریکه , 13 2 رزی ملک‌یونان , 14 2 میرزا ملکم خان , 15 2 بمب‌گذاری‌های عربستان سعودی، ۲۰۱۶ , 16 2 فریار اسدیان , 17 2 سید میثم آقا سید حسینی , 18 1 شاهرخ تندرو صالح

ago 2016: 1 3 پینوکیو , 2 3 محمود صفریان , 3 3 گریت ووستمن , 4 3 ابن تیمیه , 5 2 ماکس اشتیرنر , 6 2 محمد ضیمران , 7 2 محسن هشترودی , 8 2 یوهان مارتین کلادینیوس , 9 2 تئودور آدورنو , 10 2 جورج ریتزر , 11 2 عمر گران , 12 2 همه چیز برای یک اتفاق خوب , 13 2 ماهنامه بشریت , 14 2 ولفگانگ پاولی , 15 2 ورنر کارل هایزنبرگ , 16 2 فاوست گوته , 17 2 جرارد دلانتی , 18 2 ژان بودریار , 19 2 حسن چاوشیان , 20 2 یوسف اباذری , 21 2 گذرگاه , 22 2 شاهرخ تندرو صالح , 23 2 عبدالرسول وصال , 24 2 هربرت الکساندر سیمون , 25 2 آنتونی هاپکینز

set 2016: 1 3 اریک اشمیت , 2 3 آدری هپبورن , 3 3 کوکو شانل , 4 3 نعمت‌الله مکری جیحون‌آبادی , 5 3 برهنگی , 6 2 محمدقاسم قاسمی گنابادی , 7 2 نثاری تونی , 8 2 مری و مکس , 9 2 جعفر شریف‌امامی , 10 2 انسل آدامز , 11 2 ستار , 12 2 دانشگاه هاروارد , 13 2 فاطمه حقیقت‌جو , 14 2 ارما بومبک , 15 2 دن براون , 16 2 آن برونته , 17 2 لیام نیسون , 18 2 دانیل استیل , 19 2 جین وبستر , 20 2 لرتا یونگ , 21 2 اندونزی , 22 2 نیل آرمسترانگ , 23 2 جان لنون , 24 2 سون تسی , 25 2 علی‌اصغر سعیدی (جامعه‌شناس)

out 2016: 1 2 راشومون (فیلم) , 2 2 هیس! دخترها فریاد نمی‌زنند , 3 2 دوریس لسینگ , 4 2 مهرداد میرکیانی , 5 2 حسن پورشیرازی , 6 2 وشمگیر , 7 2 دانیل بورستین , 8 2 محمدقاسم قاسمی گنابادی , 9 2 عمادالدین اصفهانی , 10 2 وینس لومباردی , 11 2 دارودسته‌های نیویورکی , 12 2 رفتگان , 13 1 زوتوپیا

nov 2016: 1 2 حمید مصدق , 2 2 از میان مردگان , 3 2 اکنون شگفت‌انگیز , 4 2 مطرودین شیطان , 5 2 محسن امیریوسفی , 6 2 الیاس حضرتی , 7 2 نهنگ عنبر (فیلم) , 8 2 حقه‌بازی آمریکایی , 9 2 سربداران , 10 2 مرد مورچه‌ای (فیلم) , 11 2 راهنمای مسافران مجانی کهکشان (رمان) , 12 2 ابله (فیلم ۱۹۵۱) , 13 2 عمل کشتن , 14 2 شغرو , 15 2 سزار کوچک , 16 2 معما (فیلم ۱۹۶۳) , 17 1 تورنتن وایلدر

dez 2016: 1 3 اکرم مصوری‌منش , 2 3 رجب رحمنی , 3 3 یوناتن بت کلیا , 4 3 صدای پای آب , 5 3 جف بزوس , 6 3 لس براون , 7 3 هاوارد شولتز , 8 3 جلال خالقی مطلق , 9 3 هملت , 10 3 بهروز سبط رسول , 11 3 منیژه آرمین , 12 3 ضرب‌المثل‌های هندیجانی , 13 2 آمنه بهرامی , 14 2 زنبق دشت , 15 2 هزارتوی پن , 16 2 مامان و روسپی , 17 2 حال همه خوب است (فیلم ۲۰۰۹) , 18 2 ویل هانتینگ خوب , 19 2 سر به مهر , 20 2 ایرما خوشگله , 21 2 پیش از غروب , 22 2 مرگ فروشنده , 23 2 شب (فیلم ۱۹۶۱) , 24 2 هیروشیما عشق من , 25 2 اژدها وارد می‌شود!

jan 2017: 1 4 آتش‌سوزی و ریزش ساختمان پلاسکو , 2 4 چشم در برابر چشم , 3 3 دفتر خاطرات , 4 3 عشق آهسته می‌آید , 5 3 دونالد ترامپ , 6 3 آتوسا پورکاشیان , 7 3 آخرین سامورائی , 8 3 اکبر هاشمی رفسنجانی , 9 3 علی شریعتی , 10 3 ضرب‌المثل‌های فارسی , 11 2 اریک هابسبام , 12 2 عطاءالله زاهد , 13 2 حمید سمندریان , 14 2 هلنا بلاواتسکی , 15 2 ساختمان پلاسکو , 16 2 آقاعلی زنوزی , 17 2 لین مارگولیس , 18 2 شرف‌الدین خراسانی , 19 2 اخوان الصفا , 20 2 برج پلاسکو , 21 2 سلیمان حییم , 22 2 پاپوآ گینه نو , 23 2 گابن , 24 2 کوبا , 25 2 کریستوفر فرانک

fev 2017: 1 4 کتاب‌خوان , 2 3 شیرزاد پیک حرفه , 3 3 نسیم نقولا طالب , 4 3 ستیغ اره‌ای , 5 3 شاه لیر , 6 3 اریش فروم , 7 3 فضل‌الله نوری , 8 3 آنا آخماتووا , 9 3 فروغ فرخزاد , 10 3 صادق هدایت , 11 3 آلبرت اینشتین , 12 2 جردن باروز , 13 2 سوشا مکانی , 14 2 ابوالقاسم حالت , 15 2 مهدی احمدوند , 16 2 علیرضا منصوریان , 17 2 مقصود فراستخواه , 18 2 نگاهی به داعش از درون , 19 2 ابن جبیر , 20 2 یوپ لانگه , 21 2 مرتضی راوندی , 22 2 انگلبرت کمپفر , 23 2 مسافران (فیلم ۲۰۱۶) , 24 2 نانسی کارترایت (فیلسوف) , 25 2 عبدالحسین احمدی بختیاری

mar 2017: 1 3 نویل چمبرلین , 2 3 فرهنگ هلاکویی , 3 3 ماهاتما گاندی , 4 2 میرزا حسین نوری , 5 2 استیون جی گولد , 6 2 عنایت‌الله رضا , 7 2 محمد قائد , 8 2 سید احسان قاضی‌زاده هاشمی , 9 2 آذرشهر , 10 2 سیلوان , 11 2 مراغه , 12 2 والنسیا , 13 2 دامغان , 14 2 بلخ , 15 2 بروجرد , 16 2 رهی معیری , 17 2 لیما , 18 2 زوتوپیا , 19 2 افشین یداللهی , 20 2 کوردوبا , 21 2 مهناز افشار , 22 2 ابوحامد غزالی , 23 2 مسعود کیمیایی , 24 2 برنامه‌نویسی , 25 2 نوشتن

abr 2017: 1 3 سید محمدصادق خرازی , 2 3 اسحاق جهانگیری , 3 3 ابراهیم رضایی بابادی , 4 3 زن , 5 3 فضل‌الله نوری , 6 3 فهرست افراد بر پایه نام , 7 2 عصر روشنگری , 8 2 هزار پیشه , 9 2 بید کور، زن خفته , 10 2 کاووس حسن‌لی , 11 2 گفتاوردها درباره سید محمد خاتمی , 12 2 ماجرای عجیب سگی در شب , 13 2 نادر قاضی‌پور , 14 2 احمد توکلی , 15 2 مهدی فخیم‌زاده , 16 2 محمدجواد لاریجانی , 17 2 عماد افروغ , 18 2 علی حاتمی , 19 2 جواد اطاعت , 20 2 محمد ماغوط , 21 2 مرضیه وحید دستجردی , 22 2 علی ربیعی , 23 2 بوریس پاسترناک , 24 2 ارتداد در اسلام , 25 2 بایزید بسطامی

mai 2017: 1 4 ای. ای. کامینگز , 2 4 سیلویا پلات , 3 3 بچه‌های نیمه‌شب , 4 3 آلن گینزبرگ , 5 3 حسن روحانی , 6 3 اکبر هاشمی رفسنجانی , 7 3 سید علی خامنه‌ای , 8 3 سید روح‌الله خمینی , 9 2 کارنامه بندار بیدخش , 10 2 علوم سیاسی , 11 2 به خدای ناشناخته , 12 2 والت ویتمن , 13 2 داستان عشق (فیلم) , 14 2 فانوس دریایی (رمان) , 15 2 سرزمین گوجه‌های سبز , 16 2 جنگ آخرالزمان , 17 2 برنار لو بوویه دو فونته‌نل , 18 2 تنهایی پرهیاهو , 19 2 پی‌یر بل , 20 2 هنریک سینکیه‌ویچ , 21 2 افسانه‌های راز و خیال , 22 2 فرخ غفاری , 23 2 عصر روشنگری , 24 2 نسیم نقولا طالب , 25 2 بنژامن کنستان

jun 2017: 1 3 کیومرث پوراحمد , 2 3 اسماعیل کهرم , 3 3 غلامحسین ساعدی , 4 3 ایران , 5 3 سید محمد خاتمی , 6 3 صادق هدایت , 7 2 راز فال ورق , 8 2 میرداماد , 9 2 جایزه اسکار , 10 2 گروور کلیولند , 11 2 شیطان و خدا , 12 2 فیروزه جزایری دوما , 13 2 طیب صالح , 14 2 بریژیت ژیرو , 15 2 لائو شه , 16 2 گی کورنو , 17 2 آندره دوباس , 18 2 گوئو شیائولو , 19 2 جف کینی (نویسنده) , 20 2 آنتونی دوئر , 21 2 برایان وایس , 22 2 دیوید سداریس , 23 2 سیروس غنی , 24 2 خوسه دونوسو , 25 2 یوکیو میشیما

jul 2017: 1 8 آلبرت اینشتین , 2 7 سعدی , 3 6 مارتین لوتر کینگ جونیور , 4 6 عشق , 5 5 مرگ , 6 5 جان اف. کندی , 7 5 حافظ , 8 5 مولوی , 9 5 جنگ , 10 5 ولتر , 11 5 ماهاتما گاندی , 12 5 کنفوسیوس , 13 4 ازیریس , 14 4 اورانوس , 15 4 خوانندگی , 16 4 انجیر , 17 4 آبدارخانه , 18 4 الماس , 19 4 الف (اسطوره‌شناسی) , 20 4 پژواک , 21 4 اکسیر , 22 4 افعی , 23 4 افسنتین , 24 4 میرحسین حسینی هروی , 25 4 خدا

ago 2017: 1 5 ساره بیات , 2 3 مازیار شاهی , 3 3 فضل‌الله نوری , 4 2 جمهوری چک , 5 2 وقتی نیچه گریست (فیلم) , 6 2 سه‌شنبه‌ها با موری , 7 2 بادبادک‌باز , 8 2 کمال پولادی , 9 2 بحار الاسماء , 10 2 مجید قیصری , 11 2 جک کرواک , 12 2 جان برجر , 13 2 عباس بابایی , 14 2 محمدحسین رکن‌زاده , 15 2 باسل خرطبیل , 16 2 باشگاه فوتبال یوونتوس , 17 2 ترومن کاپوتی , 18 2 وقتی نیچه گریست , 19 2 سام شپارد , 20 2 میشل بوتور , 21 2 رهبر معظم ایران , 22 2 ذبیح‌الله منصوری , 23 2 منوچهر ستوده , 24 2 موریتانی , 25 2 امیرحسین آریان‌پور

set 2017: 1 3 فاطمه پریسا , 2 3 صادق هدایت , 3 3 ماهاتما گاندی , 4 2 سوزان بویل , 5 2 ژان-ژاک روسو , 6 2 هشام مطر , 7 2 جولیان بارنز , 8 2 کمال داوود , 9 2 الیستر مک‌لاود , 10 2 توماس هریس , 11 2 چیماماندا نگوزی آدیچی , 12 2 خاطرات روسپیان غمگین من , 13 2 زکریا اخلاقی , 14 2 فهم , 15 2 کلیدر , 16 2 میرحسین موسوی , 17 2 احمد شاملو , 18 1 بازی تاج‌وتخت (رمان)

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 12 de outubro 2017 16:34

Dump file fawikiquote-20171001-stub-meta-history.xml.gz (edits only), size 7.6 Mb as gz -> 57 Mb
Dump processed till Sep 30, 2017, on server stat1005, ready at Sun-01/10/2017-15:16 after 34 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.