Estatísticas da Wikiquote persa

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 

  May 2016: Wikistats' days will be over soon. A successor is in the works. 


  Read more at this announcement. Please tell us which reports you want to see preserved, in this survey.

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2016
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 20160%   0%   +39%      0%
mai 20160%   0%   +1%      0%
abr 20160%   0%   +13%      0%
mar 2016+1%   0%   +7%      0%
fev 20160%   0%   -18%      0%
jan 20160%   0%   -33%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 2016170 9 4,2 k112,2 222      2,5 k
mai 2016170 6 4,1 k 12,2 160      2,5 k
abr 2016170 8 4,1 k 12,1 159      2,5 k
mar 201617028 4,1 k 12,1 141      2,5 k
fev 2016168 4 4,1 k 12,1 132      2,5 k
jan 2016168 8 4,1 k112,1 161      2,5 k
dez 2015168 5 4,1 k112,1 239      2,5 k
nov 2015168110 4,1 k 12,1 164      2,5 k
out 201516727 4,1 k 12,1 211      2,5 k
set 201516531424,1 k312,1 866      2,5 k
ago 201516241434,0 k2412,2 6,2 k      2,4 k
jul 20151582823,2 k713,1 1,5 k      1,6 k
jun 201515615 3,0 k113,5 180      1,5 k
mai 201515538 3,0 k 13,6 251      1,5 k
abr 201515228 3,0 k 13,5 160      1,5 k
mar 20151502713,0 k413,5205651012 Mb1,2 M21 k2,3 k1,5 k3,7 k1,5 k
fev 20151481512,8 k 13,9209027512 Mb1,2 M20 k2,3 k1,4 k3,3 k1,4 k
jan 201514724 2,8 k 13,8208414311 Mb1,2 M20 k2,3 k1,4 k3,3 k1,4 k
dez 2014145 4 2,8 k 13,821087312 Mb1,2 M20 k2,3 k1,4 k3,4 k1,4 k
nov 2014145 7 2,8 k 13,8210712612 Mb1,2 M20 k2,3 k1,4 k3,4 k1,4 k
out 20141453612,8 k313,7210638812 Mb1,2 M20 k2,3 k1,4 k3,4 k1,4 k
set 20141421612,7 k714,1214976111 Mb1,2 M20 k2,3 k1,4 k3,2 k1,4 k
ago 201414148 2,5 k115227039311 Mb1,1 M20 k2,3 k1,3 k2,9 k1,3 k
jul 20141371612,5 k615,1233875611 Mb1,1 M20 k2,2 k1,3 k2,8 k1,3 k
jun 201413624 2,3 k 16237349710 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
mai 20141343922,3 k815,8237296710 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
abr 20141312922,0 k417,425992,5 k10 Mb1,0 M18 k2,1 k1,0 k2,0 k1,1 k
mar 2014129 621,9 k417,325911,0 k9,6 Mb967 k18 k13 k9121,7 k1,0 k
fev 20141292431,8 k117,826796809,3 Mb938 k17 k12 k8461,6 k911
jan 20141271611,7 k117,827028499,2 Mb929 k17 k12 k8231,5 k891
dez 20131261521,7 k117,726867508,9 Mb902 k16 k12 k8001,3 k812
nov 2013125 211,6 k217,726665868,6 Mb873 k15 k11 k7491,2 k741
out 2013125 4 1,6 k 1828132778,8 Mb890 k15 k10 k6971,2 k613
set 20131251311,6 k117,928145298,7 Mb886 k15 k9,9 k6351,1 k605
ago 20131242831,6 k117,928209928,6 Mb876 k14 k9,2 k5951,1 k601
jul 201312215 1,5 k117,729221808,5 Mb854 k14 k9,1 k528963588
jun 201312146 1,5 k 17,929532098,4 Mb849 k14 k9,1 k521953581
mai 201311738 1,5 k 17,829461238,4 Mb844 k14 k9,0 k521943581
abr 201311424 1,5 k 17,829441698,4 Mb842 k14 k9,0 k522944580
mar 201311232 1,5 k 17,829321358,3 Mb830 k14 k8,9 k520924574
fev 2013109 3 1,5 k 17,82905958,1 Mb818 k14 k8,9 k521912565
jan 201310936 1,5 k 17,929182508,1 Mb816 k14 k8,9 k522915565
dez 201210623 1,4 k 17,728311067,9 Mb788 k14 k8,8 k522909559
nov 2012104 1 1,4 k 17,72827747,9 Mb784 k14 k8,7 k520884558
out 201210412 1,4 k 17,728371167,9 Mb785 k14 k8,7 k522879558
set 201210311 1,4 k117,828281787,8 Mb778 k14 k8,7 k522879557
ago 201210214 1,4 k117,928551797,8 Mb773 k14 k8,7 k521873557
jul 201210116 1,4 k 1828792837,7 Mb770 k14 k8,6 k522846554
jun 201210013 1,4 k 1828831617,7 Mb766 k14 k8,5 k522841552
mai 20129915 1,4 k 1829032167,6 Mb763 k13 k8,4 k522836551
abr 20129826 1,4 k118,129072667,5 Mb756 k13 k8,3 k517811551
mar 20129623 1,3 k 18,129352947,5 Mb753 k13 k8,2 k515793548
fev 20129412 1,3 k 17,929521597,5 Mb756 k13 k8,2 k520794546
jan 20129334 1,3 k 17,829431487,5 Mb753 k13 k8,1 k518794545
dez 20119016 1,3 k 17,829451497,4 Mb751 k13 k8,1 k517784543
nov 20118936 1,3 k 17,828371667,2 Mb719 k13 k8,1 k515776540
out 201186 2 1,3 k 17,828012217,0 Mb706 k13 k8,0 k515767540
set 20118614 1,3 k 17,627981257,0 Mb705 k13 k7,8 k514768539
ago 20118512 1,3 k 17,628021307,0 Mb704 k13 k7,8 k511757538
jul 201184 1 1,3 k 17,527871527,0 Mb700 k13 k7,8 k511758537
jun 20118423 1,3 k 17,527911316,9 Mb696 k13 k7,7 k508744534
mai 20118214 1,3 k 17,527831146,9 Mb691 k13 k7,6 k513737531
abr 201181 5 1,3 k 17,427702046,8 Mb686 k13 k7,6 k512733529
mar 20118126 1,3 k117,427645776,8 Mb680 k13 k7,5 k513725526
fev 2011793711,3 k317,227096716,6 Mb658 k13 k7,4 k469685496
jan 2011764931,2 k317,827408676,3 Mb619 k13 k7,3 k346640430
dez 201072 2 1,1 k 18,327914556,0 Mb581 k12 k7,1 k304602383
nov 20107225 1,1 k 1827752246,0 Mb576 k12 k7,0 k302574383
out 20107036 1,1 k 17,927701745,9 Mb572 k12 k6,9 k300566375
set 20106757 1,1 k 17,827602785,9 Mb568 k12 k6,9 k298548373
ago 20106216 1,1 k117,827427185,7 Mb559 k12 k6,8 k279521366
jul 20106145 1,0 k 17,426961785,6 Mb539 k12 k6,8 k273493361
jun 20105715 1,0 k 17,327001215,5 Mb536 k12 k6,7 k272488359
mai 20105616 1,0 k 17,426671575,4 Mb524 k12 k6,7 k272479358
abr 20105514 1,0 k 17,526692235,4 Mb519 k12 k6,7 k272425358
mar 201054 5 1,0 k 17,427162195,3 Mb523 k12 k6,6 k269412356
fev 20105446 989 17,527382205,3 Mb520 k12 k6,5 k268400356
jan 201050 5 978 17,427183445,2 Mb510 k12 k6,3 k263393349
dez 20095024 963 17,326381935,0 Mb487 k12 k6,3 k261377347
nov 20094813 953 17,326352354,9 Mb483 k12 k6,2 k260377346
out 200947 3 948117,225665124,8 Mb467 k12 k6,2 k258343336
set 20094727 92811725092694,6 Mb449 k12 k6,0 k255316325
ago 20094517 900 17,225241,0 k4,5 Mb440 k12 k5,8 k254299316
jul 20094416 894116,224441994,4 Mb423 k12 k5,8 k251277314
jun 20094313 851116,825891544,3 Mb416 k11 k5,8 k253261305
mai 20094225 811 17,426362624,2 Mb415 k11 k5,7 k250260299
abr 200940 6 808 17,126343004,2 Mb413 k11 k5,6 k252256294
mar 200940151801 16,926264924,2 Mb407 k11 k5,6 k252254289
fev 200939371791116,526134394,1 Mb398 k11 k5,5 k222238270
jan 20093615 770116,425942314,0 Mb388 k11 k5,4 k215214234
dez 200835141747 16,626423063,9 Mb383 k11 k5,3 k215212232
nov 200834 4 735 16,426551473,9 Mb379 k11 k5,2 k212200225
out 200834 6 727 16,426461733,8 Mb374 k11 k5,1 k209193220
set 20083416 722116,326562483,8 Mb374 k11 k5,1 k208192212
ago 200833172694316,626784223,7 Mb364 k10 k4,9 k207171209
jul 200832 7 614118,129461793,6 Mb355 k9,9 k4,7 k191168191
jun 20083215 594 18,429851393,5 Mb347 k9,8 k4,6 k188162190
mai 200831271583218,529935663,5 Mb342 k9,7 k4,5 k185149185
abr 200829272533119,130606463,2 Mb318 k8,7 k4,4 k169107180
mar 200827 5 509 18,830082233,0 Mb299 k7,7 k4,2 k16090171
fev 200827141504118,530036033,0 Mb296 k7,7 k4,1 k15887169
jan 200826372481118,228898272,8 Mb273 k6,6 k4,1 k14285163
dez 200723381445 17,828224972,5 Mb246 k5,5 k3,9 k12668142
nov 200720 4 432 17,127921192,4 Mb238 k4,9 k3,8 k12167140
out 200720131426 17,128479282,4 Mb239 k4,9 k3,7 k12365139
set 200719151414 15,427819312,3 Mb228 k4,2 k3,5 k10755134
ago 200718 51401 13,526356592,1 Mb210 k3,4 k2,7 k6354123
jul 200718261393112,125019112,0 Mb196 k3,1 k2,5 k5042117
jun 200716 21374 10,322761851,7 Mb171 k1,6 k2,4 k3739112
mai 200716 3 363 10,122471951,6 Mb164 k1,5 k2,3 k2838106
abr 20071614 358 9,722102761,6 Mb158 k1,4 k2,3 k2738102
mar 200715 21343 9,322052601,5 Mb150 k1,3 k2,2 k263199
fev 200715 1 338 8,722141191,5 Mb143 k1,2 k2,1 k273193
jan 200715 2 335 8,421751591,4 Mb139 k1,2 k2,1 k263192
dez 20061513 326 8,221231791,3 Mb131 k1,1 k2,0 k263089
nov 20061424 323 7,720881391,3 Mb127 k1,1 k1,9 k252986
out 200612 3 309 7,620901991,2 Mb123 k1,1 k1,9 k242784
set 200612 5 29417,320252961,2 Mb115 k9781,8 k232280
ago 20061213 27816,71729205985 kb96 k8551,6 k231972
jul 20061136226016,31555510847 kb83 k7951,5 k221672
jun 20068 2 227151285191642 kb59 k46887618445
mai 2006812 19714,81198163544 kb43 k20883415339
abr 2006712 17014,61114129402 kb37 k18672212233
mar 2006613 15014,41051182324 kb32 k16558111 29
fev 20065 1 11114,3131081304 kb29 k1664443 23
jan 20065 1 95 4,1152349290 kb28 k1654132 15
dez 20055 1 8314,1176141284 kb28 k1653672 12
nov 2005523 67 4,5200887265 kb27 k1602682 11
out 20053 1 55 3,9223721248 kb25 k1572232 9
set 2005312 54 3,6221744243 kb25 k1281971 8
ago 20052   43 3,527665236 kb24 k1251521 5
jul 20052 1 4213,5288687236 kb24 k1251521 4
jun 20052 2 16 3,6737526225 kb23 k86134  2
mai 20052   6 5,3176334221 kb23 k86133  2
abr 2005211 6 4,71762817220 kb23 k86133  1
mar 20051 1 3 3,71981410134 kb15 k8474  1
fev 20051      445 1,9 kb77 106 91
jan 20051      445 1,9 kb77 106 91
dez 20041      445 1,9 kb77 106 91
nov 20041      445 1,9 kb77 106 91
out 20041      445 1,9 kb77 106 91
set 20041      445 1,9 kb77 106 91
ago 200411     44511,9 kb77 106 91
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201613 12 15 22 20      45
jan 201613 10 141219 23      45
out 2015131113 14 20 16      45
jul 20151379714419 5      45
abr 201513119 15 18 19      45
jan 20151310151515151811211111141461045
out 20141351071551811121111141561045
jul 20141312101016314961111141661045
abr 2014131310719412881111141861345
jan 201413141210221112891112141871545
out 2013131912102214971511121421101745
jul 201313121292291161511121525121945
abr 201313911122212961711121525121845
jan 201313913172115962311121525121745
out 2012131525162018862911121423121745
jul 2012131612142014861911131423121745
abr 20121491414208851811131423121545
jan 201214812112011751711121223121545
out 2011142023122011762511131223111545
jul 201114212813201586261113122091545
abr 201114201411201386211112122091445
jan 20111568520586712121219111444
out 20101671282012661712131220111444
jul 201017713132014762112131220111544
abr 2010181513142012761512131019111644
jan 201018201212201520201312131019111644
out 20091720181620819192013151019111644
jul 20091814101119918181513151019111744
abr 200918191114201718181712151018111744
jan 200918161412201118181712151018101644
out 200818191311201318181912151018101744
jul 200818241314221218181912151019101744
abr 20081911126221117171013151019102144
jan 200820811622141515111415111992444
out 20072019181022181414814151319102344
jul 20072012131322121414713151320132544
abr 200720141315221613131615161618152444
jan 200720232412201912122015141715142244
out 200621191614201712121714141615121944
jul 200620101110201511111216161716122444
abr 200625122110241511111818192424153744
jan 2006262526162418992720202022204344
out 2005252116102213772416171818154144
jul 2005231516101910551412131716153843
abr 20052112157261144181312151493643
jan 20052314134361033293531241491141
out 20042219205319223028262386636
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  5  10  100 
jun 20162211933      6321      5211      
mai 2016248641      522       932       
abr 2016209841      41     11 62     11 
mar 2016178831      63        7         
fev 2016154421      221       52        
jan 20161812841      541       832       
dez 2015166542      31     11 443    11 
nov 201518141041      10321      6111   1  
out 20152310762      9421      1031    1  
set 20153518149421  11 1610731     171183   11 
ago 20153418141311332111126161511722   31191411322221
jul 20152411863211    73211  11 921111 221
jun 2015139531      3         822    211
mai 20151711843      6      11 32111  221
abr 20152111842      11521   3321132    331
mar 2015191274311     128731  2211075421 221
fev 201517105211      17843   111199511  11 
jan 2015219442      85        931       
dez 201418742       733111 11 2         
nov 2014248721      62     111131     11 
out 201416116431      94321  11 11322211   
set 201419764211     134111  11 1122221    
ago 20142412876      72111  111104111     
jul 201417865211     811       94322     
jun 2014135421   11196521  11 102211  11 
mai 2014201194221     532       63211     
abr 2014251295222  2226411      124411  111
mar 201421965421     84431     145511     
fev 201411444431     5332      7322      
jan 201422764311     821       10432      
abr 2016209841      41     11 62     11 
jan 20161812841      541       832       
out 20152310762      9421      1031    1  
jul 20152411863211    73211  11 921111 221
abr 20152111842      11521   3321132    331
jan 2015219442      85        931       
out 201416116431      94321  11 11322211   
jul 201417865211     811       94322     
abr 2014251295222  2226411      124411  111
jan 201422764311     821       10432      
out 2013156432      421       921       
jul 2013147532      43        10211      
abr 2013187421   11 42        10311   1  
jan 2013187631   22 3      11 6      11 
out 201214322    22 5      11 52     11 
jul 201218764    32 7321   11 842    11 
abr 2012179652   21 41     111411    2  
jan 20122484     22 41     1115      11 
out 20111652     22171     111911    11 
jul 20111641     11 31        621    11 
abr 2011198521   11 41        611       
jan 2011241296431  33 103332     105332  1  
out 201027863    11 5111      12111      
jul 2010176541   11 4         1         
abr 2010199431   32 311       73111     
jan 2010217522   11 21        72221  1  
out 2009135322   2225221      82221     
jul 2009208643   1  322       104211     
abr 2009198642   11 532       126433  111
jan 2009116532   22 3111      93321     
out 20081610611   11 411       85411     
jul 20081711742      511       62211  11 
abr 200813975421  22 104311     84442     
jan 2008141175321  11 95521     74221     
out 200712532111  22211222      102221     
jul 200711863111     533       432111    
abr 200797442      3111      53321     
jan 200752211      3111      43221     
out 200685321      2221      32211     
jul 20061286642      93221     933221 11 
abr 2006106222      7331      6321      
jan 200652111      3111      21111     
out 20051111                 11        
jul 200521111                11111     
abr 20051111       1         21111     
jan 2005                              
out 2004                              

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1945100.0%38,655100.0%
336438.5%37,72097.6%
1017418.4%36,62594.7%
32656.9%34,77990.0%
100323.4%33,07485.6%
316141.5%30,08077.8%
100060.6%25,99367.2%
316220.2%18,21347.1%
1000010.1%11,99931.0%

 

22 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
RAHA68UC3 02,9163547420abr 30, 20121521128---
Erfan-93UC16+424069242mar 18, 2015469262--
CommonsDelinkerUC19-1208535-mai 13, 20073335----
PandgoUC29+711438305nov 03, 2015239125--
BilijacksUC67+1312--mai 18, 20154087---
LeythUC191+59823-abr 02, 201119151---
Milad98boyUC203+4098644mai 29, 2016311---
MeysamhossiniUC204...88--jun 17, 20161222--
RayeshmanUC238+267123-fev 04, 20161461---
Soheil2244UC240+26711-mai 28, 201632----
سیدحبیبUC241...771919jun 24, 2016511--
MohwikipediaUC270...66--jun 25, 2016411--
DarkDawnUC307...55--jun 21, 2016811--
Hamid HassaniUC355+89413-abr 22, 2015434----
MahtabshadiUC362+23842--dez 22, 201519011--
AmshahabiUC364...44--jun 02, 20162711--
Letzte ÜbermenschUC460...33--jun 02, 201627----
Henker der EngelUC620...22--jun 01, 201628----
Davey2010UC621...22--jun 02, 201627----
Elnaz.g.wUC622...22--jun 19, 201610----
MywikimediaaccountUC944...11--jun 05, 201624----
بصیری هریسUC945...1111jun 14, 20161511--

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Sonia SevillaUC111,999set 10, 20102119mai 28, 201632
AmouzandehUC26,214abr 11, 20063732mai 31, 20102221
ع م گUC41,929jul 15, 2015350ago 31, 2015303
SajadUC51,818mar 29, 20054110abr 27, 201663
MardetanhaUC61,117ago 08, 20073248set 16, 2015287
مهدیUC7706fev 05, 20092701jan 27, 20131249
JDiamondUC8655set 05, 20092489fev 01, 20111975
Jamal NazarethUC9645fev 01, 20111975abr 21, 20111896
TaranetUC10578jan 13, 20083090set 04, 2015299
WayiranUC11444abr 24, 20082988mai 30, 20111857
Bilijacks~fawikiquoteUC12396nov 16, 20063513abr 20, 2014801
MahanUC13338fev 16, 2014864set 14, 2015289
SialkgraphUC14325jul 23, 20131072jul 02, 2015363
Ahura21UC15309mai 24, 20111863ago 14, 2014685
AmirAKUC17239mai 28, 2015398mai 15, 201645
احسان آشناUC18231set 24, 2015279fev 17, 2016133
TaddahUC20186set 10, 2014658mar 24, 201697
محسن نامدارزادهUC21161jun 28, 2014732abr 26, 201664
MohandesWikiUC22147mar 25, 2014827jul 18, 2015347
AbsdostanUC23145set 13, 20092481jan 02, 20121640

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 4.704 edições foram feitas por usuários anônimos, de um total de 50.669 edições ( 9e %)
  


29 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AnankeBotUC11,347dez 18, 20082750set 16, 20131017--
TanhabotUC21,183abr 23, 20082989dez 08, 20102030--
ChtitBotUC3966set 08, 20073217fev 06, 20111970--
DexbotUC4672abr 08, 2014813abr 14, 2014807--
EleferenBotUC5464fev 13, 20102328jan 13, 20131263--
SahimrobotUC6411ago 14, 20102146ago 15, 20102145--
MohandesBotUC7366jun 02, 2014758jun 19, 2014741--
FaraBotUC8344out 11, 20073184out 11, 20073184--
KamikazeBotUC9259dez 17, 20102021dez 09, 20111664--
ArthurBotUC10157out 14, 20092450mar 31, 20111917--
YiFeiBotUC11138ago 03, 2015331jun 08, 201621--
MerlIwBotUC12133jul 26, 20121434jun 14, 20131111--
SamoaBotUC13125abr 09, 2014812abr 15, 2014806--
LaaknorBotUC14119out 23, 20082806jan 20, 20131256--
AvicBotUC15105jul 30, 20111796set 07, 20111757--
Idioma-botUC1682mar 02, 20111946jul 16, 20121444--
VolkovBotUC1752jun 30, 20092556abr 16, 20121535--
MjbmrbotUC1846fev 04, 20111972mar 27, 20111921--
JAnDbotUC1943ago 17, 20131047ago 28, 20131036--
CarsracBotUC2042mar 19, 20111929abr 15, 20131171--
DinybotUC2117mar 24, 20073385dez 16, 20073118--
Sir Nicholas de Lenfent BotUC2215abr 09, 20102273abr 19, 20102263--
FiriBotUC2313jan 09, 20111998jan 09, 20111998--
ChobotUC249dez 04, 20121303mar 13, 20131204--
KgsbotUC257dez 13, 20102025jan 18, 20111989--
AmolbotUC263dez 07, 20102031dez 07, 20102031--
RezabotUC271out 18, 20111716out 18, 20111716--
AvocatoBotUC281abr 17, 20121534abr 17, 20121534--
AbotUC291nov 28, 2013944nov 28, 2013944--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
jun 20166,7 k7501,7 k1045086631843       370301
mai 20166,7 k7461,7 k1045086631843       370301
abr 20166,7 k7421,7 k1045086571842       370301
mar 20166,7 k7391,7 k1045086571842       370301
fev 20166,7 k7371,7 k1045086571842       370301
jan 20166,7 k7361,7 k1045086571841       370301
dez 20156,6 k7341,7 k1045086561840       370301
nov 20156,6 k7281,7 k1045086561838       370301
out 20156,6 k7261,7 k1045086521838       370301
set 20156,6 k7201,7 k1045086451838       370301
ago 20156,4 k7161,7 k1045086451829       370301
jul 20154,8 k7061,7 k1045056331710       370301
jun 20154,5 k7011,7 k1045056251683       370301
mai 20154,5 k6961,7 k1045056241683       370301
abr 20154,4 k6951,7 k1045056231683       370301
mar 20154,4 k6901,7 k1045056221683      499370301
fev 20154,3 k6881,7 k1044665981677      239370301
jan 20154,3 k6811,7 k1044655891676      134370301
dez 20144,3 k6771,7 k1044655881676      59370301
nov 20144,3 k6761,7 k1044655881676      111370301
out 20144,3 k6681,7 k1044655881676      366370301
set 20144,1 k6571,7 k1044135241664      737370301
ago 20143,9 k6431,7 k1043484941658      326370301
jul 20143,8 k6361,7 k1043474761657      740370301
jun 20143,5 k6321,7 k1043474751634      107370301
mai 20143,5 k6241,7 k1013464541633      929368291
abr 20143,2 k6221,7 k1013464541620      1677368291
mar 20142,9 k6171,7 k1013464541613      1004368291
fev 20142,7 k6111,7 k1003464541601      664367291
jan 20142,6 k6051,7 k1003464491592      788367291
dez 20132,5 k6011,7 k1003464481583      726367291
nov 20132,4 k5981,7 k1003464481577      545367291
out 20132,2 k5921,7 k1003374401552      254367291
set 20132,2 k5871,7 k1003374401551      415367291
ago 20132,2 k5711,7 k993374391535      925366291
jul 20132,1 k5651,6 k973374261444      164364291
jun 20132,1 k5561,6 k963374261444      76364281
mai 20132,1 k5521,6 k963374251444      107364281
abr 20132,1 k5481,6 k963374251444      87364281
mar 20132,0 k5411,6 k963374231440      77364281
fev 20132,0 k5311,6 k963374231439      79364281
jan 20132,0 k5241,6 k963374231436      98364281
dez 20122,0 k5211,6 k963374231436      73364281
nov 20122,0 k5121,6 k953374231436      25363281
out 20122,0 k5091,6 k953374231435      49363281
set 20122,0 k5051,6 k953374231434      62363281
ago 20122,0 k4951,6 k953374231434      87363281
jul 20121,9 k4891,6 k953374231434      104363281
jun 20121,9 k4851,6 k953374221434      77363281
mai 20121,9 k4631,6 k953374221434      131363281
abr 20121,9 k4571,6 k943374221434      164362281
mar 20121,9 k4491,6 k943374221434      164362281
fev 20121,9 k4441,6 k943374221434      42362281
jan 20121,9 k4341,6 k943374201434      64362281
dez 20111,9 k4301,6 k943374201433      97362281
nov 20111,9 k4271,6 k943374181433      106362281
out 20111,8 k4121,6 k943374171431      39362281
set 20111,8 k4021,6 k943374151431      70362281
ago 20111,8 k3881,6 k943374131430      36362281
jul 20111,8 k3841,6 k943374111430      35362281
jun 20111,8 k3751,6 k943374111426      79362281
mai 20111,8 k3671,6 k943374111426      60362281
abr 20111,8 k3551,6 k943374091426      98362281
mar 20111,8 k3471,6 k943374091426      301362281
fev 20111,8 k3391,6 k843374021424      600253281
jan 20111,6 k3061,6 k563303731408      733129251
dez 20101,5 k3001,6 k483273611374      50121251
nov 20101,5 k2961,6 k483273611374      112121251
out 20101,5 k2921,6 k483273601373      115121251
set 20101,4 k2831,6 k483273551373      202121251
ago 20101,4 k2751,6 k433273511369      202116251
jul 20101,4 k2591,6 k423272701365      105115251
jun 20101,4 k2591,6 k413272701365      58114251
mai 20101,4 k2431,6 k413262701365      110114251
abr 20101,4 k2381,6 k413262701365      106114251
mar 20101,4 k2311,5 k413262701365      62114251
fev 20101,3 k2281,5 k413252671362      113114251
jan 20101,3 k2241,5 k403252671361      11111425 
dez 20091,3 k2081,4 k403252671361      7211425 
nov 20091,3 k2011,4 k393252671361      12011325 
out 20091,3 k1991,4 k393252671361      18811325 
set 20091,3 k1941,4 k383252671359      22011324 
ago 20091,2 k1841,3 k383252651357      12611324 
jul 20091,2 k1841,3 k383252651357      16911324 
jun 20091,2 k1781,3 k383242621357      10611324 
mai 20091,1 k1761,2 k383242601357      10111324 
abr 20091,1 k1741,2 k383242601357      17811324 
mar 20091,1 k1621,2 k373242321344      43811224 
fev 20091,1 k1481,2 k333241821207      3961923 
jan 20091,0 k1391,1 k323241821142      1421823 
dez 20089791361,1 k323241801140      2061823 
nov 20089601321,1 k323241791139      971823 
out 20089471171,0 k323241741133      1121823 
set 20089341031,0 k323211741133      1521823 
ago 200890399973323211741132      3731823 
jul 200880595941303201701131      1551623 
jun 200878492911303201701130      1201623 
mai 200876885911303201701130      4661623 
abr 200871380880303151671126      5031623 
mar 200868076815293141591123      1481622 
fev 200867373785293141591123      5091622 
jan 200864467753273141591123      7111422 
dez 200758764723253141541105      4391222 
nov 200757260690243141491105      621221 
out 200756558690243101481105      3901221 
set 200754851629243101461105      7311221 
ago 200752443596243101411101      6081221 
jul 20075104056424310132196      8791221 
jun 20074863953224310130194      1651221 
mai 2007469395002329186193      1481220 
abr 2007460374472329086193      2091220 
mar 2007442354092328984187      1941220 
fev 2007431343822224974171      83 220 
jan 2007427313572224974171      113 220 
dez 2006415313102223674171      139 220 
nov 2006409302962123640136      90 120 
out 2006393272462122837135      146 120 
set 2006374272102122537135      224 120 
ago 2006350261732122137135      173 120 
jul 2006332221322121933134      496 120 
jun 200627213952118628128      172 120 
mai 200623611652118627127      143 120 
abr 20062039352118527127      103 120 
mar 20061796182118527 24      124 120 
fev 20061345162018116 14      58 119 
jan 20061105152017014 14      40 119 
dez 2005954151916711 14      29 118 
nov 200578315191629 14      73 118 
out 20056421421556 14      17 11 
set 20056221411555 14      39  1 
ago 20054821311525 14      4  1 
jul 20054621311505 14      87  1 
jun 20051821011444 4      24  1 
mai 2005821011163 2      1  1 
abr 2005711011163 2      15  1 
mar 2005419 1163 2      10    
fev 20051   116              
jan 20051   116              
dez 20041   116              
nov 20041                  
out 20041                  
set 20041                  
ago 20041                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

mar 2005: 1 1 ضرب‌المثل‌های عربی

abr 2005: 1 1 آدولف هیتلر

mai 2005: 1 1 ضرب‌المثل‌های فارسی

jun 2005: 1 2 آقامحمدخان قاجار , 2 2 عزیز نسین , 3 2 صفحهٔ اصلی , 4 1 محمود احمدی‌نژاد

jul 2005: 1 2 ناشناس , 2 1 ویلیام فالکنر

ago 2005: 1 2 صفحهٔ اصلی , 2 1 فهرست بر اساس فيلم‌ها

set 2005: 1 3 صفحهٔ اصلی , 2 2 علی بن ابی‌طالب , 3 2 ناشناس , 4 1 ارنستو چه گوارا

out 2005: 1 1 فهرست افراد براساس نام

nov 2005: 1 2 کورش مدرسی , 2 2 منصور حکمت , 3 2 حمید تقوایی , 4 2 محمود احمدی‌نژاد , 5 1 دوگ لارسون

dez 2005: 1 1 امبرتو اکو

jan 2006: 1 2 اپیکور , 2 2 ارنستو چه گوارا , 3 1 کانت

fev 2006: 1 2 آلبر کامو , 2 2 محمد بن عبدالله , 3 1 محمدتقی مصباح یزدی

mar 2006: 1 2 توماس جفرسون , 2 2 ماتریکس , 3 2 فهرست آثار ادبی , 4 2 فهرست افراد بر پایه نام , 5 2 صفحهٔ اصلی , 6 1 کارلوس کاستاندا

abr 2006: 1 4 صفحهٔ اصلی , 2 3 هرمان هسه , 3 2 مارتین لوتر , 4 2 ضرب‌المثل‌های هلندی , 5 2 استانیسلاو لم , 6 2 ارنست همینگوی , 7 2 مایکل جکسون , 8 2 آلبرت اینشتین

mai 2006: 1 2 رابرت آنسون هاین‌لاین , 2 2 رفیق شامی , 3 2 مولوی , 4 2 داگلاس آدامز , 5 2 فرانسوا لارشفوکو , 6 2 ضرب‌المثل‌های لاتینی , 7 2 واشنگتن ایروینگ , 8 2 توماس جفرسون , 9 1 محمد خیابانی

jun 2006: 1 2 فرانسوا فنلون , 2 2 ژان دو لافونتن , 3 2 وینستون چرچیل , 4 2 فهرست افراد بر پایه نام , 5 2 صفحهٔ اصلی , 6 1 رنه دکارت

jul 2006: 1 3 هلن کلر , 2 3 آیان حرصی علی , 3 3 آرزو , 4 3 آندره ژید , 5 3 آرتور شوپنهاور , 6 2 سید مرتضی آوینی , 7 2 الویس پرسلی , 8 2 مسیر سبز , 9 2 کازابلانکا (فیلم) , 10 2 رستگاری در شائوشنگ , 11 2 ژولیا کریستوا , 12 2 محمود فلکی , 13 2 منوچهر آتشی , 14 2 جنگ عراق , 15 2 باباطاهر , 16 2 ویلیام سارویان , 17 2 کارل سندبرگ , 18 2 اقبال لاهوری , 19 2 فدریکو فلینی , 20 2 فریدریش شیلر , 21 2 رنه دکارت , 22 2 امیرخسرو دهلوی , 23 2 علی‌اکبر دهخدا , 24 2 کندورسه , 25 2 افلاطون

ago 2006: 1 3 ضرب‌المثل‌های آذربایجانی , 2 3 صفحهٔ اصلی , 3 2 صادق هدایت , 4 2 سووشون , 5 2 شازده کوچولو , 6 1 سید محمدحسین شهریار

set 2006: 1 4 صفحهٔ اصلی , 2 3 فهرست افراد بر پایه نام , 3 2 بيل گيتس , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 عمر خیام , 6 2 حافظ , 7 2 میکل‌ آنژ , 8 2 محمود احمدی‌نژاد , 9 1 شهریار

out 2006: 1 2 ژان پل , 2 2 حسن تقی‌زاده , 3 2 ضرب‌المثل‌های آذربایجانی , 4 2 حافظ , 5 2 وودی آلن , 6 2 سعدی , 7 2 فهرست افراد بر پایه نام , 8 1 فرانکا ماگنانی

nov 2006: 1 2 باران کوثری , 2 2 کارل گوستاو یونگ , 3 2 برتولت برشت , 4 2 فهرست افراد بر پایه نام , 5 2 صفحهٔ اصلی , 6 1 محمدرضا شفیعی کدکنی

dez 2006: 1 2 غلامرضا روحانی , 2 2 باران کوثری , 3 2 دنیای سوفی , 4 2 جنگ , 5 2 آلبرت اینشتین , 6 2 فهرست آثار ادبی , 7 1 ریچارد رورتی

jan 2007: 1 3 پدرخوانده (فیلم) , 2 2 ریچارد نیکسون , 3 2 نیکوس کازانتزاکیس , 4 2 ری بردبری , 5 2 زکریای رازی , 6 2 محمود احمدی‌نژاد , 7 2 صفحهٔ اصلی , 8 1 ضرب‌المثل‌های اندونزیایی

fev 2007: 1 2 قیصر (فیلم) , 2 2 صفحهٔ اصلی , 3 1 انجیل متی

mar 2007: 1 3 لودویگ فان بتهوون , 2 3 فریدریش نیچه , 3 2 رمکو کامپرت , 4 2 محمدرضا شفیعی کدکنی , 5 2 کلیم کاشانی , 6 2 بایگانی نقل‌قول روز , 7 2 سعدی , 8 2 صفحهٔ اصلی , 9 1 وگ:وگ

abr 2007: 1 3 فریدریش نیچه , 2 2 داستان یک سیندرلا , 3 2 کما , 4 2 تقاطع , 5 2 مهمان (فیلم) , 6 2 اخراجی‌ها , 7 2 فریدون جنیدی , 8 2 ابوریحان بیرونی , 9 2 وحید قزوینی , 10 2 عمر خیام , 11 2 فردوسی , 12 2 مولوی , 13 2 مارتین لوتر

mai 2007: 1 2 راه بی‌پایان , 2 2 تله , 3 2 میم مثل مادر , 4 2 هنر , 5 2 جورج برنارد شاو , 6 2 فهرست آثار ادبی , 7 2 ناشناس , 8 1 اسدی طوسی

jun 2007: 1 2 جان رید , 2 2 مائو تسه تونگ , 3 2 باران کوثری , 4 2 محمد خیابانی , 5 2 عشق , 6 1 سرمایه‌داری

jul 2007: 1 2 سگ , 2 2 گربه , 3 2 عباس کیارستمی , 4 2 نیکلا سارکوزی , 5 2 روز سوم , 6 2 فریدریش انگلس , 7 2 مائو تسه تونگ , 8 2 فریدون جنیدی , 9 2 کارل مارکس , 10 2 سیسرو , 11 2 ضرب‌المثل‌های آلمانی , 12 2 علی شریعتی , 13 2 عشق , 14 1 کد داوینچی

ago 2007: 1 3 سیاست , 2 3 ضرب‌المثل‌های فارسی , 3 2 کریستین بوبن , 4 2 سید روح‌الله خمینی , 5 2 ازدواج , 6 2 آزادی , 7 2 ولادیمیر لنین , 8 2 کارل مارکس , 9 2 علویه خانم , 10 2 ضرب‌المثل‌های اسپانیایی , 11 2 سید مرتضی آوینی , 12 2 داگلاس آدامز , 13 2 هنر , 14 2 دانش , 15 2 دوستی , 16 2 جنگ , 17 1 سنگسار

set 2007: 1 3 لئون تروتسکی , 2 3 محمود احمدی‌نژاد , 3 2 شتر , 4 2 قلعه حیوانات , 5 2 ۱۹۸۴ (رمان) , 6 2 ملالی جویا , 7 2 سید روح‌الله خمینی , 8 2 فاطمه زهرا/گفتار هایی از فاطمه زهرا , 9 2 فاطمه زهرا/اشعاری از شعرای کهن پیرامون فاطمه زهرا , 10 2 فاطمه زهرا/فاطمه زهرا در نگاه امامان شیعه , 11 2 ولادیمیر لنین , 12 2 ایرج‌میرزا , 13 2 اهلی شیرازی , 14 2 نقل‌قول روز , 15 2 باران کوثری , 16 2 ضرب‌المثل‌های ارمنی , 17 2 ضرب‌المثل‌های ایتالیایی , 18 2 افلاطون , 19 2 دانش , 20 2 آندره ژید , 21 2 جرج هربرت , 22 2 موریس مترلینک , 23 2 فهرست فیلم‌ها , 24 2 لئو بوسکالیا , 25 2 سورن کی‌یر کگارد

out 2007: 1 3 ژان دلا برویر , 2 2 آندری تارکوفسکی , 3 2 جان لاک , 4 2 شتر , 5 2 کارل مارکس , 6 2 باران کوثری , 7 2 ضرب‌المثل‌های ارمنی , 8 2 صادق هدایت , 9 2 ضرب‌المثل‌های آذربایجانی , 10 2 سنایی , 11 2 رقص , 12 2 فهرست فیلم‌ها , 13 1 مرکز موسیقی بتهوون

nov 2007: 1 3 علی بن ابی‌طالب , 2 2 داوید آلفارو سی‌که‌ایروس , 3 2 جیمز ناکس پولک , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 فیلم , 6 1 انقلاب

dez 2007: 1 5 فهرست افراد بر پایه نام , 2 4 دیوارنوشته , 3 4 ویلیام شکسپیر , 4 3 جلیل ضیاءپور , 5 3 خانه‌ای بر روی آب , 6 3 صلح , 7 3 فریدریش نیچه , 8 3 صفحهٔ اصلی , 9 2 ماهی , 10 2 انقلاب , 11 2 جورج دبلیو بوش , 12 2 سید محمدحسین شهریار , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 ضرب‌المثل‌های اسپانیایی , 15 2 فهرست نمایش‌های تلویزیونی , 16 2 ابن سینا , 17 2 عشق , 18 2 فهرست فیلم‌ها

jan 2008: 1 5 لوئیس بونوئل , 2 4 فهرست افراد بر پایه نام , 3 4 ضرب‌المثل‌های فارسی , 4 3 جنون , 5 3 سید محمدحسین شهریار , 6 3 ژان دارک , 7 3 محمود احمدی‌نژاد , 8 2 طبیعت , 9 2 جورج اورول , 10 2 مجنون , 11 2 زنبور , 12 2 مرگ , 13 2 خنده , 14 2 مکس پین , 15 2 کودک , 16 2 خوب، بد، زشت , 17 2 رومن رولان , 18 2 سیمین دانشور , 19 2 مادر , 20 2 فروغ فرخزاد , 21 2 کتاب , 22 2 عطار نیشابوری , 23 2 نیشابور , 24 2 جورج دبلیو بوش , 25 2 دنیای سوفی

fev 2008: 1 3 روشنفکر , 2 2 گل , 3 2 شراب , 4 2 سیمون دو بووار , 5 2 مرگ , 6 2 منیرو روانی‌پور , 7 2 فروغ فرخزاد , 8 2 کتاب , 9 2 تاریخ , 10 2 نقل‌قول روز , 11 2 نیکوس کازانتزاکیس , 12 2 ضرب‌المثل‌های ترکی , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 هنر , 15 2 عشق , 16 1 عارف قزوینی

mar 2008: 1 3 اورسن ولز , 2 3 فهرست افراد بر پایه نام , 3 2 مائو تسه‌دون , 4 2 سنگسار , 5 2 عشق , 6 2 کارلایل

abr 2008: 1 3 سید علی خامنه‌ای , 2 3 ژیل دلوز , 3 3 فهرست افراد بر پایه نام , 4 3 ناپلئون بناپارت , 5 3 صفحهٔ اصلی , 6 2 سید جمال‌الدین اسدآبادی , 7 2 محمد فضولی , 8 2 چنین گفت زرتشت , 9 2 تقی ارانی , 10 2 شارلوت برونته , 11 2 شیون فومنی , 12 2 فردریک هگل , 13 2 لوچیو کولتی , 14 2 هربرت مارکوزه , 15 2 نیکوس پولانزاس , 16 2 باروخ اسپینوزا , 17 2 گئورگ ویلهلم فریدریش هگل , 18 2 مگس , 19 2 جلیل ضیاءپور , 20 1 سید جمال الدین اسدآبادی

mai 2008: 1 6 فهرست افراد بر پایه نام , 2 3 حسین پناهی , 3 3 عشق , 4 3 صفحهٔ اصلی , 5 2 پروانه , 6 2 لرد بایرون , 7 2 پاپلی یزدی , 8 2 بلبل هزاردستان , 9 2 هانا آرنت , 10 2 دایره زنگی , 11 2 عارف قزوینی , 12 2 امیلی برونته , 13 2 دانش , 14 2 آرزو , 15 2 موریس مترلینک , 16 1 کسایی مروزی

jun 2008: 1 2 هنری دیوید ثورو , 2 2 لنگستون هیوز , 3 2 ستارخان , 4 2 شراب , 5 2 سنگسار , 6 2 بزرگمهر , 7 1 هدی شعراوی

jul 2008: 1 4 طاهره قرةالعین , 2 3 گوساله , 3 3 عباس کیارستمی , 4 3 فهرست افراد بر پایه نام , 5 2 مرد سوم , 6 2 نیمتاج سلماسی , 7 2 هوشنگ گلشیری , 8 2 نقش رستم , 9 2 تخت جمشید , 10 2 سید محمد طباطبائی , 11 2 رشحه , 12 2 حسین پناهی , 13 2 اورسن ولز

ago 2008: 1 3 بوسه , 2 2 داستان دو شهر , 3 2 سکوت , 4 2 ۱۷ فوریه , 5 2 گراهام گرین , 6 2 هانیبال الخاص , 7 2 شیخ فضل‌الله نوری , 8 2 صائب تبریزی , 9 2 آندری تارکوفسکی , 10 2 لودویگ فان بتهوون , 11 2 مارتین لوتر کینگ جونیور , 12 2 عشق , 13 2 آلبرت اینشتین , 14 2 محمود احمدی‌نژاد , 15 1 اریش فروم

set 2008: 1 3 گربه روی شیروانی داغ (نمایشنامه) , 2 2 امیر نادری , 3 2 محمدحسین پاپلی یزدی , 4 2 تنسی ویلیامز , 5 2 دیپاک چوپرا , 6 2 پاپلی یزدی , 7 1 ۲ مه

out 2008: 1 2 حسام‌الدین خویی , 2 2 میرزا علی‌اکبر صابر , 3 2 امام محمد غزالی , 4 2 علی اکبر دهخدا , 5 1 حسام الدین خویی

nov 2008: 1 4 فهرست افراد بر پایه نام , 2 2 باراک اوباما , 3 1 ژان سیبلیوس

dez 2008: 1 2 گروچو مارکس , 2 2 فردوسی

jan 2009: 1 3 محمد بن عبدالله , 2 2 امیلی دیکنسن , 3 2 گلادیاتور , 4 1 ۱۴ ژانویه

fev 2009: 1 3 زن , 2 3 محمد علی کلی , 3 2 ماهواره امید , 4 2 حسن طبری آملی , 5 2 سید محمد‌کاظم شریعتمداری , 6 2 ولایت فقیه , 7 2 خلفای راشدین , 8 2 اردبیل , 9 2 شاهین نجفی , 10 2 دایره زنگی , 11 2 وحشی بافقی , 12 2 خیلی دور، خیلی نزدیک , 13 2 قیصر (فیلم) , 14 2 آلفونس کار , 15 2 پائولو کوئیلو , 16 1 محیط طباطبائی

mar 2009: 1 2 علی اکبر شیرودی , 2 2 بهاریه , 3 2 حسن لاهوتی اشکوری , 4 2 حسن طبری آملی , 5 2 شارلوت برونته , 6 2 حسین بن علی , 7 2 هاینریش هاینه , 8 2 گابریل گارسیا مارکز , 9 2 رنه دکارت , 10 2 ژان دو لافونتن , 11 2 رودکی , 12 2 ابن سینا , 13 2 عمر خیام , 14 2 استانیسلاو لم , 15 2 آلبر کامو , 16 2 تالس , 17 2 آلبرت اینشتین , 18 2 جورج برنارد شاو , 19 2 مارشال مک‌لوهان , 20 1 علی صیاد شیرازی

abr 2009: 1 4 فهرست افراد بر پایه نام , 2 3 حسین منصور حلاج , 3 2 ریچارد براتیگان , 4 2 آنا آخماتووا , 5 2 فروغ فرخزاد , 6 2 عطار نیشابوری , 7 2 سعدی , 8 2 یوهان ولفگانگ گوته , 9 2 آلبرت اینشتین , 10 2 منصور حکمت , 11 1 مهدی رجب بیگی

mai 2009: 1 5 فهرست افراد بر پایه نام , 2 2 عماد مغنیه , 3 2 صلح , 4 2 سید روح‌الله خمینی , 5 2 فردوسی

jun 2009: 1 2 تبریز , 2 2 جرج برناردشاو , 3 2 لئوناردو داوینچی , 4 2 دار و دسته‌های نیویورکی , 5 1 لئونارد داوینچی

jul 2009: 1 4 علی بن ابی‌طالب , 2 2 زن , 3 2 استیون واینبرگ , 4 1 توماس هنری هاکسلی

ago 2009: 1 3 احمد مفتی‌زاده , 2 3 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 3 3 ضرب‌المثل‌های چینی , 4 2 گیتی نوین , 5 2 میرحسین موسوی , 6 2 آبراهام لینکلن , 7 1 یوسف صانعی

set 2009: 1 3 سید محمد خاتمی , 2 3 علی شریعتی , 3 3 فهرست افراد بر پایه نام , 4 2 در بروژ , 5 2 احمد مفتی‌زاده , 6 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 7 2 میرحسین موسوی , 8 2 دزدان دریایی کارائیب: صندوق مرد مرده , 9 2 حسین پناهی , 10 2 سید علی خامنه‌ای , 11 1 پیامک

out 2009: 1 2 خواب , 2 2 بهلول , 3 2 امام محمد باقر , 4 2 جعفر صادق , 5 2 میرحسین موسوی , 6 2 دنیای سوفی , 7 1 عبدالکریم سروش

nov 2009: 1 4 محمود احمدی‌نژاد , 2 2 ژان پل سارتر , 3 1 چه‌گوارا

dez 2009: 1 1 سید احمد علم‌الهدی

jan 2010: 1 2 ریاضی , 2 2 محمدرضا شجریان , 3 2 سید احمد علم‌الهدی , 4 2 اسفندیار رحیم‌مشایی , 5 2 میرحسین موسوی , 6 1 بیماری

fev 2010: 1 3 جنبش سبز , 2 2 علی رضا بدیع , 3 2 لئوناردو داوینچی , 4 2 فهرست فیلم‌ها , 5 1 پل ورلن

mar 2010: 1 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 2 2 فهرست افراد بر پایه نام , 3 1 کورش کوچک

abr 2010: 1 4 بهاءالله , 2 3 محمود احمدی‌نژاد , 3 2 هرات , 4 2 سید حسن فیروزآبادی , 5 2 میرحسین موسوی , 6 2 سید علی خامنه‌ای , 7 2 وینستون چرچیل , 8 1 پیامک

mai 2010: 1 2 بهاءالله , 2 2 محمدرضا شجریان , 3 2 فردوسی , 4 1 سلام

jun 2010: 1 3 سید روح‌الله خمینی , 2 2 کاظم صدیقی , 3 2 سید علی خامنه‌ای , 4 2 فهرست افراد بر پایه نام , 5 1 حاتم طایی

jul 2010: 1 2 خوزستان , 2 2 بدبیاری‌ها , 3 2 آین رند , 4 2 حسین الهی قمشه‌ای , 5 2 ضرب‌المثل‌های فارسی , 6 1 عین القضاة همدانی

ago 2010: 1 3 محمود احمدی‌نژاد , 2 2 آیزاک آسیموف , 3 2 چای , 4 2 دخانیات , 5 2 خلیج فارس , 6 2 خوزستان , 7 2 آمریکا , 8 2 سید علی‌محمد دستغیب , 9 2 نیشابور , 10 2 سید محمدحسین شهریار , 11 2 امیرخسرو دهلوی , 12 1 پیامک

set 2010: 1 4 علی بن ابی‌طالب , 2 4 فهرست افراد بر پایه نام , 3 3 عمرو عاص , 4 3 باراک اوباما , 5 3 حسین بن علی , 6 2 جلال‌الدین فارسی , 7 2 ابوالحسن بنی‌صدر , 8 2 معاویه پسر ابی‌سفیان , 9 2 سهیل پسر عمرو , 10 2 میدان نقش جهان , 11 2 دمشق , 12 1 پیامک

out 2010: 1 2 قهوه تلخ , 2 2 آنتون چخوف , 3 2 علی بن ابی‌طالب , 4 2 جکسون براون , 5 1 قهوه تلخ (سریال)

nov 2010: 1 3 قهوه تلخ , 2 3 جورج برنارد شاو , 3 2 غلامحسین ساعدی , 4 2 غلامعلی بسکی , 5 2 محسن قرائتی , 6 1 هارون‌الرشید

dez 2010: 1 2 سنگسار در اسلام , 2 2 وحشی بافقی , 3 2 فروغ فرخزاد , 4 2 علی بن ابی‌طالب , 5 1 لویی فردینان سلین

jan 2011: 1 3 علی‌رضا افتخاری , 2 3 فهرست فیلم‌ها , 3 3 علی بن ابی‌طالب , 4 3 محمود احمدی‌نژاد , 5 2 پیامک , 6 2 مهدی , 7 2 توبه , 8 2 رضی‌الدین نیشابوری , 9 2 ابرهه بن صباح , 10 2 قاسم بن محمد , 11 2 عبدالله بن شبرمه , 12 2 شطرنج , 13 2 ابی بن کعب , 14 2 عایشه , 15 2 جواد عزتی , 16 2 ابن عباس , 17 2 ابن قیم الجوزیه , 18 2 حسن بصری , 19 2 زین‌العابدین مراغه‌ای , 20 2 مصر , 21 2 خراسان , 22 2 زین‌العابدین بن علی , 23 2 سبزوار , 24 2 ضرب‌المثل‌های خراسانی , 25 2 شب‌های روشن (فیلم)

fev 2011: 1 3 خلیج فارس , 2 3 ایران , 3 2 معمر قذافی , 4 2 مأمون , 5 2 مشورت , 6 2 مدینه , 7 2 نام‌گذاری فرزند , 8 2 عمر بن خطاب , 9 2 ابوبکر , 10 2 عزت‌الله سحابی , 11 2 عبدالکریم سروش , 12 2 میرحسین موسوی , 13 2 محمدحسین پاپلی یزدی , 14 2 آنتون چخوف , 15 2 منوچهر آتشی , 16 2 عمر خیام , 17 1 شعارهای مردم لیبی در اعتراضات سال ۲۰۱۱

mar 2011: 1 4 علی بن ابی‌طالب , 2 3 جواد عزتی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 3 نیشابور , 6 3 آدولف هیتلر , 7 2 کیم وو چونگ , 8 2 طاهر بن حسین , 9 2 فاروق , 10 2 ابوعثمان سعید مغربی , 11 2 سید حسن مدرس , 12 2 نجم‌الدین اربکان , 13 2 روژه گارودی , 14 2 معمر قذافی , 15 2 قدس , 16 2 ادیب نیشابوری , 17 2 زبان عربی , 18 2 زبان فارسی , 19 1 ابو حفص حداد

abr 2011: 1 2 ابوسعید ابوالخیر , 2 2 ضرب‌المثل‌های خراسانی , 3 1 لودویک زامنهوف

mai 2011: 1 2 جفرسون دیویس , 2 2 خواجه عبدالله انصاری , 3 2 علویه خانم , 4 1 ناصر حجازی

jun 2011: 1 2 ابوبکر , 2 2 ایران , 3 1 آشنایی با مادر

jul 2011: 1 1 علی بن ابیطالب

ago 2011: 1 3 عمر بن خطاب , 2 2 کورش بزرگ , 3 1 میرزا حسین‌علی نوری

set 2011: 1 3 فهرست آثار ادبی , 2 2 جرم (فیلم) , 3 2 فرینج , 4 2 نیشابور , 5 2 کازابلانکا (فیلم) , 6 2 فهرست فیلم‌ها , 7 1 هوشنگ ایرانی

out 2011: 1 2 جدایی نادر از سیمین , 2 2 نیشابور , 3 1 اینشتین

nov 2011: 1 4 ازدواج , 2 3 مبارزه متعالی , 3 2 شعور خلاق , 4 2 کلام خلاق , 5 2 قضاوت , 6 1 یوحنای مجنون

dez 2011: 1 3 ایلیا میم , 2 2 پیمان فتاحی , 3 2 هامون , 4 2 محمدرضا پهلوی , 5 2 محمد مصدق , 6 2 مایکل جکسون , 7 2 فهرست آثار ادبی

jan 2012: 1 3 ضرب‌المثل‌های فارسی , 2 2 علاءالدین ملماسی , 3 2 سید روح‌الله خمینی , 4 2 فریدون جنیدی , 5 2 فهرست فیلم‌ها , 6 1 هوپ‌هوپ‌نامه

fev 2012: 1 2 آمل , 2 1 طالب آملی

mar 2012: 1 2 پیمان فتاحی , 2 2 مولوی , 3 2 مریلین منسون , 4 2 فهرست آثار ادبی , 5 2 فهرست افراد بر پایه نام

abr 2012: 1 5 ماهواره امید , 2 3 فهرست افراد بر پایه نام , 3 2 تمایل جنسی , 4 2 بایزید بسطامی , 5 2 جانی دپ , 6 2 مذهب , 7 2 علی شریعتی , 8 1 شادی

mai 2012: 1 3 مارک تواین , 2 2 پرویز شهریاری , 3 2 شاهین نجفی , 4 2 جورج برنارد شاو , 5 2 فهرست افراد بر پایه نام , 6 1 کارل سیگن

jun 2012: 1 2 سیروان خسروی , 2 1 بابک خرمدین

jul 2012: 1 3 رضاشاه , 2 2 ارباب کمان نقره‌ای , 3 2 جورج برنارد شاو , 4 2 مارک تواین , 5 1 اتاقی از آن خود

ago 2012: 1 3 فهرست فیلم‌ها , 2 2 دیوانه‌ای از قفس پرید (فیلم ۱۳۸۱) , 3 2 سفر به انتهای شب , 4 2 عمر بن خطاب , 5 2 هانا آرنت , 6 2 صادق هدایت , 7 2 ایمانوئل کانت , 8 1 زیستن چون پروانه

set 2012: 1 1 بهار ۶۳

out 2012: 1 1 ضرب‌المثل‌های کردی

nov 2012: 1 5 فهرست افراد بر پایه نام , 2 2 عمر بن خطاب , 3 1 محمود کریمی حکاک

dez 2012: 1 2 مصطفی دلشاد تهرانی , 2 2 فهرست افراد بر پایه نام , 3 1 امیر قلعه نویی

jan 2013: 1 3 عمر بن خطاب , 2 2 جورج اورول , 3 2 عشق , 4 2 فهرست افراد بر پایه نام , 5 1 لیلا صادقی

fev 2013: 1 2 ناجی العلی , 2 2 آسیا عبدالله

mar 2013: 1 2 سید علی خامنه‌ای , 2 1 انیو موریکونه

abr 2013: 1 3 ماکسیمیلیان روبسپیر , 2 3 سن ژوست , 3 3 انیو موریکونه , 4 3 مختارنامه (مجموعه تلویزیونی) , 5 2 حرفه‌ای , 6 2 سید محمد‌کاظم شریعتمداری , 7 2 علی شریعتی , 8 1 عماد خراسانی

mai 2013: 1 4 دینو بوتزاتی , 2 4 آزادی , 3 3 عماد خراسانی , 4 3 ضرب‌المثل‌های بختیاری , 5 3 فریدون مشیری , 6 1 ماکسیم گورکی

jun 2013: 1 2 مالکوم لطیف شباز , 2 2 حسن روحانی , 3 1 آبراهام مزلو

jul 2013: 1 2 ایندیرا گاندی , 2 1 100 گفتار

ago 2013: 1 3 حسن روحانی , 2 3 عمر بن خطاب , 3 3 ابوبکر , 4 2 محمد بن موسی خوارزمی , 5 2 داوید هیلبرت , 6 2 محمدعلی جمال‌زاده , 7 2 پینوکیو (فیلم) , 8 2 ناخدا خورشید , 9 2 باغ‌های کندلوس , 10 2 لودویگ ویتگنشتاین , 11 2 والتر اسکات , 12 2 راینر ماریا ریلکه , 13 2 کاشان , 14 2 توماس هاکسلی , 15 2 البرت هوبارد , 16 2 ایندیرا گاندی , 17 2 دوایت آیزنهاور , 18 2 فرانک تایگر , 19 2 آلیس واکر , 20 2 پایتخت (سری) , 21 2 داریوش یکم , 22 2 گشت ارشاد , 23 2 شیخ بهائی , 24 2 دیوانه‌ای از قفس پرید (فیلم ۱۳۸۱) , 25 2 سعادت‌آباد

set 2013: 1 3 فهرست افراد بر پایه نام , 2 2 شمع , 3 2 زیرپوست شهر , 4 2 جیمز جویس , 5 2 گی دو موپاسان , 6 2 جان استاینبک , 7 2 ابوبکر کرجی , 8 2 آنه فرانک , 9 2 پینوکیو (فیلم) , 10 1 پاتریس لومومبا

out 2013: 1 2 نورعلی الهی , 2 2 پینوکیو (فیلم) , 3 2 ایرانی , 4 2 سید محمد خاتمی , 5 2 فهرست فیلم‌ها , 6 2 علی بن ابی‌طالب , 7 1 شمس تبریزی

nov 2013: 1 2 محمدجواد ظریف , 2 2 نورعلی الهی , 3 2 لودویگ ویتگنشتاین , 4 2 شطرنج , 5 2 عشق , 6 2 علی بن ابی‌طالب , 7 1 علی زین العابدین

dez 2013: 1 4 دانش , 2 3 جینا جیمسون , 3 3 ارتداد در اسلام , 4 3 سنگسار در اسلام , 5 3 جرج واشنگتن , 6 3 کورش بزرگ , 7 2 سفارت , 8 2 فریدریش هایک , 9 2 خرما , 10 2 نهنگ , 11 2 جوزف کمبل , 12 2 لوئیزا می آلکوت , 13 2 هشت صبح , 14 2 سید علی‌اصغر دستغیب , 15 2 نلسون ماندلا , 16 2 مبارزه متعالی , 17 2 بخشندگی , 18 2 ابوسعید ابوالخیر , 19 2 زکات , 20 2 شطرنج , 21 2 ناصر مکارم شیرازی , 22 2 میرزا کوچک خان جنگلی , 23 2 نماز (اسلام) , 24 2 زن , 25 2 سکوت

jan 2014: 1 3 اسماعیل دوم , 2 3 آلبرت اشپر , 3 3 علی بن موسی الرضا , 4 2 یاس (خواننده) , 5 2 آل کاپون , 6 2 پول , 7 2 اخلاق , 8 2 اراده , 9 2 جوانی , 10 2 حسادت , 11 2 تجربه , 12 2 طمع , 13 2 استبداد , 14 2 جهان , 15 2 بیابان , 16 2 حسن روحانی , 17 2 اندیشه , 18 2 عمر بن خطاب , 19 2 زیبایی آمریکایی , 20 2 انسان , 21 2 حسن بن علی , 22 2 زن , 23 2 بوسه , 24 2 کودک , 25 2 آزادی

fev 2014: 1 3 ژوزه ساراماگو , 2 3 کورش بزرگ , 3 2 تحقیر , 4 2 کرت وانه‌گت , 5 2 علی کریمی , 6 2 آلکساندر سولژنیتسین , 7 2 شمس تبریزی , 8 2 ملاله یوسف‌زی , 9 2 جان استاینبک , 10 2 صدام حسین , 11 2 گهواره گربه , 12 2 شوالیه تاریکی , 13 2 بغداد , 14 2 معمر قذافی , 15 2 حج , 16 2 ابوبکر , 17 2 حامد کرزی , 18 2 سجاد , 19 2 جعفر صادق , 20 2 ایران , 21 2 تهران , 22 2 محمدرضا پهلوی , 23 2 حسین بن علی , 24 2 مخمصه , 25 2 رستگاری در شائوشنگ

mar 2014: 1 4 زندگی , 2 3 حسن روحانی , 3 3 عمر مختار , 4 3 انسان , 5 2 پریکلس , 6 2 مجید مجیدی , 7 2 بیل برایسون , 8 2 توپاک شکور , 9 2 کریستوفر مارلو , 10 2 ادگار واتسون هاو , 11 2 ساموئل جانسون , 12 2 کلارنس دارو , 13 2 سو تاونسند , 14 2 والتر رالی , 15 2 جان ماری گیبون , 16 2 جان هیت استابز , 17 2 رالف ریچاردسون , 18 2 اشرف ریفی , 19 2 حکومت , 20 2 سال بلو , 21 2 آرت بوخوالد , 22 2 سیلماریلیون , 23 2 دایدو , 24 2 اسلام , 25 2 فؤاد سنیوره

abr 2014: 1 3 فاطمه زهرا , 2 2 محدث نوری , 3 2 هریت بیچر استو , 4 2 مارکی دوساد , 5 2 راشل کارسون , 6 2 پسرعمه زا , 7 2 احمد مسجدجامعی , 8 2 کورمک مک‌کارتی , 9 2 جورج کارلین , 10 2 رضا نظری , 11 2 فضل‌الله زاهدی , 12 2 رجب طیب اردوغان , 13 2 عبدالله بن عبدالعزیز , 14 2 محسن موسوی تبریزی , 15 2 عبدالرحمن اوزاعی , 16 2 نادانی , 17 2 آب , 18 2 لوئیزا می آلکوت , 19 2 غیرت , 20 2 صادق زیباکلام , 21 2 رزا لوکزامبورگ , 22 2 محمدعلی جمال‌زاده , 23 2 کاشان , 24 2 والتر گروپیوس , 25 2 ویل راجرز

mai 2014: 1 3 رضا داوری اردکانی , 2 3 مریم طاهری مجد , 3 3 کامبیز درم‌بخش , 4 3 لودویگ ویتگنشتاین , 5 2 ارومیه , 6 2 ایوان تورگنیف , 7 2 نیکلای گوگول , 8 2 مصطفی ملکیان , 9 2 احسان نراقی , 10 2 لیلا حاتمی , 11 2 غلامحسین ابراهیمی دینانی , 12 2 ناتاشا امیری , 13 2 مهشید امیرشاهی , 14 2 فرخنده آقایی , 15 2 شیرین نشاط , 16 2 پگاه احمدی , 17 2 بهاره رهنما , 18 2 ابوتراب خسروی , 19 2 مهدی یزدانی‌خرم , 20 2 حمیدرضا صدر , 21 2 محمد بساطی , 22 2 خیری شلبی , 23 2 علاء الاسوانی , 24 2 ابراهیم اصلان , 25 2 ادوار خراط

jun 2014: 1 2 آنتیستینس , 2 2 اخراجی‌ها ۲ , 3 2 پیامک , 4 1 ویلیام سامرست موآم

jul 2014: 1 3 آروین د. یالوم , 2 3 گراتزیا دلدا , 3 2 جیم موران , 4 2 نوری مالکی , 5 2 جی.کی. رولینگ , 6 2 داعش , 7 2 خسرو شکیبایی , 8 2 حماس , 9 2 پیروز مجتهدزاده , 10 2 سید محمود هاشمی شاهرودی , 11 2 سیما تیرانداز , 12 2 محمدباقر نجفی اصفهانی , 13 2 حسن قزوینی , 14 2 تروریسم , 15 2 ابوبکر کرجی , 16 2 سجاد , 17 2 روز قدس , 18 2 هوشنگ ابتهاج , 19 2 مهدی اخوان ثالث , 20 2 کورش بزرگ , 21 2 حافظ , 22 1 تغار

ago 2014: 1 3 فریدون فرخزاد , 2 3 شیخ فضل‌الله نوری , 3 2 یزدگرد سوم , 4 2 وضعیت سفید , 5 2 علی دیواندری , 6 2 ایران , 7 2 گربه , 8 2 صادق هدایت , 9 2 فهرست افراد بر پایه نام , 10 1 مسیحیت

set 2014: 1 2 مسعود جعفری جوزانی , 2 2 غلامرضا اعوانی , 3 2 محمدامین قانعی‌راد , 4 2 سید جواد طباطبایی , 5 2 هوگو چاوز , 6 2 ماکسیم رودینسون , 7 2 برنارد کوشنر , 8 2 جان راسکین , 9 2 دایدو , 10 2 بدیع‌الزمان همدانی , 11 2 رضا کیانیان , 12 2 حامد کرزی , 13 2 عادل فردوسی‌پور , 14 2 ایران , 15 2 تهران , 16 2 گربه , 17 1 ابن قتیبه دینوری

out 2014: 1 3 حسین شهابی , 2 2 محمد نوریزاد , 3 2 منجمد (فیلم ۲۰۱۳) , 4 2 رسول یونان , 5 2 محمدکریم پیرنیا , 6 2 فریدون آدمیت , 7 2 عبدالسلام عظیمی , 8 2 بن افلک , 9 2 استاد الهی , 10 2 نعمت‌الله فاضلی

nov 2014: 1 4 حسین شهابی , 2 3 جک هندی , 3 2 غلامحسین ابراهیمی دینانی , 4 2 ارتداد در اسلام , 5 1 لودویگ وان بتهوون

dez 2014: 1 2 حسین شهابی , 2 2 هوپ‌هوپ‌نامه , 3 2 جلال‌الدین فارسی , 4 2 حسن رحیم‌پور ازغدی , 5 2 بروس لی , 6 1 علی زعیم

jan 2015: 1 2 زندگی در پیش رو , 2 2 ناجی العلی , 3 2 سهراب سپهری , 4 2 فردوسی , 5 1 میرزا سروش لهراسب

fev 2015: 1 3 ویلیام فاکنر , 2 2 بازاریابی شبکه‌ای , 3 2 تئو درات , 4 2 برایان کرنیگان , 5 2 جامیکا کینکید , 6 2 استیون اسپندر , 7 2 مارگارت تاچر , 8 2 دنیس ریچی , 9 2 انجمن حجتیه , 10 2 ایران , 11 2 تهران , 12 2 خواجه عبدالله انصاری , 13 2 اوشو , 14 2 باباطاهر , 15 2 حافظ , 16 2 داگلاس آدامز , 17 2 عشق , 18 2 فرانسیس بیکن

mar 2015: 1 3 پل اردیش , 2 3 ریاضیدان , 3 2 لینوس توروالدز , 4 2 بازاریابی شبکه‌ای , 5 2 برهان غلیون , 6 2 فریدون فرخزاد , 7 2 داعش , 8 2 عبدالسلام , 9 2 آدولف اوکس , 10 2 هانس کریستیان آندرسن , 11 2 کن تامسون , 12 2 ایران , 13 2 ونسان ون‌گوک , 14 2 فردریک هگل , 15 2 قرآن , 16 2 ابن سینا , 17 2 سعدی , 18 2 ویرجینیا وولف , 19 1 سحر جعفری جوزانی

abr 2015: 1 2 طبل حلبی , 2 2 یوهان ولفگانگ فون گوته , 3 2 آنری پوانکاره , 4 2 حسن روحانی , 5 2 چارلز داروین

mai 2015: 1 2 حسین شهابی , 2 2 داعش , 3 2 مصطفی چمران , 4 2 حسین بن علی , 5 1 هاگاکوره

jun 2015: 1 2 عباس زریاب خویی , 2 2 چشم‌هایش , 3 2 صادق هدایت , 4 2 علی بن ابی‌طالب , 5 1 خرمگس (رمان)

jul 2015: 1 3 عزت‌الله ضرغامی , 2 3 مرگ , 3 2 رابرت دنیرو , 4 2 فلسفه , 5 2 محمد معین , 6 2 مرتضی پاشایی , 7 2 راس پرو , 8 2 سعید عالم‌زاده , 9 2 مهدی امینی‌خواه , 10 2 جلال مقدم , 11 2 علی حاتمی , 12 2 سپند امیرسلیمانی , 13 2 امین حیایی , 14 2 خانه سینمای ایران , 15 2 اکبر عبدی , 16 2 محمدعلی همایون کاتوزیان , 17 2 سازمان صدا و سیمای جمهوری اسلامی ایران , 18 2 حقوق بشر , 19 2 خوشنویسی , 20 2 صفویان , 21 2 فرح پهلوی , 22 2 عباس زریاب خویی , 23 2 حسین شهابی , 24 2 محمدعلی کشاورز , 25 2 اسرائیل

ago 2015: 1 4 کردن , 2 4 گاییدن , 3 4 نگار استخر , 4 4 سکس , 5 4 تمایل جنسی , 6 4 ویلیام گیبسون , 7 3 سیلویا فدریچی , 8 3 یوزپلنگ آسیایی , 9 3 غروب , 10 3 احمد محمود , 11 3 مهدی‌قلی هدایت , 12 3 درک والکوت , 13 3 تئاتر شهر تهران , 14 3 احسان طبری , 15 3 شب‌های روشن , 16 3 سنیه صالح , 17 3 توماس هاردی , 18 3 دیاکو , 19 3 راگنار فریش , 20 3 محمدجواد حجتی کرمانی , 21 3 جین آدامز , 22 3 لیما گبوی , 23 3 وانگاری ماآتای , 24 3 داریوش مهرجویی , 25 3 آلبانی

set 2015: 1 3 اینگمار برگمان , 2 3 ماجرای عجیب سگی در شب , 3 3 دموکریت , 4 3 دیوژن کلبی , 5 3 هراکلیتوس , 6 2 الکساندر گراهام بل , 7 2 فرانتس شوبرت , 8 2 دلکش , 9 2 آلفرد رنیی , 10 2 ماری گل-من , 11 2 آگوستین , 12 2 کیتی پری , 13 2 در کمال خونسردی (فیلم) , 14 2 جودی فاستر , 15 2 کارل لینه , 16 2 قارون , 17 2 کولیندا گرابار کیتاروویچ , 18 2 داریو فو , 19 2 پیمان فتاحی , 20 2 محمد علی فروغی , 21 2 راه‌آهن ایران , 22 2 نائومی واتس , 23 2 مرگ بر آمریکا , 24 2 جمهوری دموکراتیک کنگو , 25 2 آنتونی هاپکینز

out 2015: 1 3 وارن بافت , 2 3 الکساندر فلمینگ , 3 3 فهرست افراد بر پایه نام , 4 2 شروین کاکوان , 5 2 دوروتی پارکر , 6 1 محمدرضا کلهر

nov 2015: 1 3 منظر حسینی , 2 3 سید میثم آقا سید حسینی , 3 2 مهین اسکویی , 4 2 یانی , 5 2 غبار ستاره , 6 2 مریم فیروز , 7 2 شهریار , 8 1 یوجین اونیل

dez 2015: 1 3 ضرب‌المثل‌های کرمانی , 2 2 آلن دو باتن , 3 2 مانس اشپربر , 4 2 تصمیم‌گیری , 5 2 جلیل صفربیگی , 6 2 اکبر اکسیر , 7 2 مارس اشپربر , 8 2 میشل دو مونتینی , 9 2 میگل د سروانتس , 10 2 سنکا , 11 2 لوکرتیوس , 12 2 رولو می , 13 1 حزب‌الله

jan 2016: 1 3 توماس هابز , 2 2 تهوع (رمان) , 3 2 هراکلیتوس , 4 2 سجاد , 5 2 تبریز , 6 1 مأمور شماره 47

fev 2016: 1 2 سخنان ارسطو , 2 2 سخنان افلاطون , 3 2 سخنان دکارت , 4 1 آلکساندر گلییویچ دوگین

mar 2016: 1 1 زویا پیرزاد

abr 2016: 1 2 ایرج مرادی , 2 2 ابراهیم حشمت , 3 2 منظر حسینی , 4 2 سید میثم آقا سید حسینی , 5 2 امیرکبیر , 6 1 سیدمیثم آقاسیدحسینی

mai 2016: 1 3 محمدامین عیسایی , 2 2 هادی پاکزاد , 3 2 فریار اسدیان , 4 2 رابرت فراست , 5 2 روبر دوانو , 6 1 علیرضا صدیق پور

jun 2016: 1 3 هادی پاکزاد , 2 2 دهستان تیمره , 3 2 ضرب‌المثل‌های سنگسری , 4 2 سرگئی راخمانینف , 5 2 کاترین منسفیلد , 6 2 رادیو فرهنگ (سوئد) , 7 2 فهم , 8 1 غرب

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de julho 2016 21:24

Dump file fawikiquote-20160701-stub-meta-history.xml.gz (edits only), size 4.6 Mb as gz -> 33 Mb
Dump processed till Jun 30, 2016, on server stat1002, ready at Sun-10/07/2016-10:43 after 30 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.