Estatísticas da Wikiquote galego

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
nov 2018+2%   +1%   -24%    () +1%
out 2018+2%   +1%        () +3%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201853   590 12,5 1    ( ) 101
nov 20185313 590 12,5 29    ( ) 101
out 20185212 584 12,6 38    ( ) 100
set 201851   580 12,6      ( ) 97
ago 201851   580 12,6 1    ( ) 97
jul 201851 1 580 12,6 8    ( ) 97
jun 201851 1 580 12,6 15    ( ) 97
mai 201851 1 578 12,6 20    ( ) 96
abr 201851 1 577 12,6 14    ( ) 94
mar 201851 2 576 12,6 70    ( ) 94
fev 201851 1 572 12,6 6    ( ) 89
jan 201851 1 572 12,6 12    ( ) 86
dez 201751 1 570 12,6 28    ( ) 85
nov 201751   569 12,6 9    ( ) 82
out 201751   569 12,6 1    ( ) 82
set 201751 2 569 12,6 14    ( ) 82
ago 201751 1 569 12,5 5    ( ) 81
jul 201751   568 12,5 3    ( ) 81
jun 201751 1 568 12,5 9    ( ) 81
mai 201751 1 566 12,6 29    ( ) 81
abr 201751 1 562 12,6 17    ( ) 79
mar 201751   561 12,6 5    ( ) 79
fev 201751   561 12,6 4    ( ) 79
jan 201751   560 12,6 3    ( ) 79
dez 201651 1 559 12,6 32    ( ) 79
nov 201651   558 12,6 3    ( ) 76
out 201651   558 12,6 3    ( ) 75
set 201651   558 12,6 4    ( ) 75
ago 201651   558 12,6 3    ( ) 75
jul 201651 1 558 12,6 14    ( ) 75
jun 201651 1 557 12,6 19    ( ) 74
mai 201651   556 12,5 6    ( ) 74
abr 201651 1 556 12,5 10    ( ) 73
mar 201651 1 556 12,5 10    ( ) 73
fev 201651121555 12,5 1,2 k    ( ) 73
jan 20165013 552 10,5 28    ( ) 70
dez 201549   551 10,4 2    ( ) 70
nov 20154911 551 10,4 20    ( ) 70
out 201548   548 10,5      ( ) 69
set 201548 2 548 10,5 26    ( ) 69
ago 2015481  546 10,5 97    ( ) 68
jul 201547 1 546 10,3 9    ( ) 68
jun 201547   545 10,3 1    ( ) 65
mai 201547   544 10,3 2    ( ) 65
abr 201547 1 544 10,3 14    ( ) 65
mar 201547 1 543 10,3 12    ( ) 64
fev 201547   541 10,3 10    ( ) 64
jan 201547   541 10,3 4    ( ) 64
dez 201447 1 540 10,3 10    ( ) 64
nov 201447 1 540 10,3 10    ( ) 64
out 20144713 540 10,3 77    ( ) 64
set 201446   534 10,2 1    ( ) 62
ago 201446 1 534 10,2 31    ( ) 62
jul 201446 1 532 10,2 17    ( ) 62
jun 201446 1 531 10,2 19    ( ) 62
mai 201446   529 10,2 3    ( ) 62
abr 201446111529 10,2 246    ( ) 62
mar 201445 1 529 9,7 13    ( ) 62
fev 201445 2 529 9,7 26    ( ) 62
jan 201445   525 9,7 13    ( ) 61
dez 201345   523 9,7 11    ( ) 61
nov 201345 1 52119,8 72    ( ) 61
out 201345 1 484210,4 91    ( ) 56
set 201345 1 436 11,3 61    ( ) 52
ago 20134511 428 11,4 33    ( ) 51
jul 201344   427 11,3 3    ( ) 51
jun 201344 2 427 11,3 104    ( ) 51
mai 201344 2 425 11,1 26    ( ) 51
abr 201344 2 421 11,1 41    ( ) 47
mar 20134411 410 11,3 21    ( ) 46
fev 20134311 409 11,3 26    ( ) 46
jan 201342 2 407 11,3 105    ( ) 46
dez 201242   402 11,2 7    ( ) 46
nov 20124211 400 11,2 21    ( ) 46
out 20124112 398 11,2 86    ( ) 45
set 201240   396 11,1 30    ( ) 44
ago 201240   396 11 27    ( ) 44
jul 20124011 395 11 69    ( ) 44
jun 201239 1 393 10,8 37    ( ) 44
mai 201239   389 10,9 31    ( ) 44
abr 20123911 388 10,8 53    ( ) 44
mar 201238 1 388 10,7 9    ( ) 44
fev 201238 3 388 10,6 56    ( ) 44
jan 20123833 385 10,6 55    ( ) 44
dez 201135 2 379 10,6 20    ( ) 44
nov 201135 1 377 10,6 13    ( ) 44
out 201135 21376 10,6 161    ( ) 44
set 201135 2 371 10,3 35    ( ) 41
ago 20113512 370 10,2 58    ( ) 41
jul 20113413 366 10,2 121    ( ) 40
jun 201133 1 359 10,1 47    ( ) 40
mai 201133 1 357 10 14    ( ) 36
abr 201133 1 353 10,1 16    ( ) 34
mar 20113314 350110,1 216    ( ) 33
fev 201132 2 317 10,5 20    ( ) 30
jan 20113211 317 10,4 47    ( ) 30
dez 201031   317 10,3 30    ( ) 30
nov 201031   316 10,2 40    ( ) 30
out 20103111 316 10,1 24    ( ) 30
set 201030   316 10 32    ( ) 30
ago 201030 2 316 9,9 47    ( ) 30
jul 2010301  315 9,8 37    ( ) 30
jun 201029   314 9,7 29    ( ) 30
mai 2010291  314 9,6 21    ( ) 30
abr 201028 1 312 9,6 43    ( ) 30
mar 201028   312 9,4 38    ( ) 30
fev 201028   310 9,4 42    ( ) 30
jan 201028 1 309 9,3 40    ( ) 30
dez 200928 1 304 9,3 36    ( ) 29
nov 20092821 301 9,3 67    ( ) 29
out 200926 2 298 9,1 191    ( ) 28
set 20092611128618,9 197    ( ) 28
ago 200925   256 9,1 10    ( ) 26
jul 20092511 255 9,1 12    ( ) 26
jun 20092421 254 9,1 63    ( ) 26
mai 200922 1 249 9 70    ( ) 26
abr 20092211 248 8,8 47    ( ) 26
mar 20092111 247 8,6 41    ( ) 25
fev 2009201  247 8,5 11    ( ) 25
jan 200919   247 8,4 25    ( ) 25
dez 2008191  247 8,3 43    ( ) 25
nov 20081813 245 8,2 91    ( ) 25
out 200817 1 231 8,3 25    ( ) 23
set 20081712 226 8,4 57    ( ) 22
ago 200816 1 224 8,2 53    ( ) 22
jul 200816 1 222 8,1 12    ( ) 21
jun 200816   219 8,1 5    ( ) 21
mai 200816   219 8,1 39    ( ) 21
abr 200816 1 219 7,9 35    ( ) 21
mar 200816   219 7,8 25    ( ) 21
fev 200816 2 218 7,7 40    ( ) 21
jan 200816 1 216 7,6 58    ( ) 20
dez 20071614121117,5 258    ( ) 20
nov 20071533 183 7,2 90    ( ) 17
out 200712   172 7,1 112    ( ) 15
set 20071211 168 6,6 74    ( ) 15
ago 200711 1 157 6,6 53    ( ) 15
jul 200711   156 6,3 61    ( ) 15
jun 200711   156 5,9 118    ( ) 15
mai 200711   156 5,2 6    ( ) 15
abr 200711   156 5,1 3    ( ) 15
mar 200711   156 5,1 16    ( ) 15
fev 200711   155 5,1 5    ( ) 15
jan 200711 1 154 5,1 17    ( ) 15
dez 20061134 152 5 75    ( ) 15
nov 20068   147 4,7 6    ( ) 15
out 20068 2 146 4,7 75    ( ) 15
set 2006812 14114,3 69    ( ) 14
ago 2006711 125 4,3 23    ( ) 11
jul 20066 1 119 4,3 14    ( ) 11
jun 20066   118 4,2 4    ( ) 11
mai 20066   118 4,2 2    ( ) 11
abr 20066   118 4,2 5    ( ) 11
mar 20066 1 118 4,1 8    ( ) 11
fev 200661  113 4,3 6    ( ) 11
jan 2006523 11314,2 106    ( ) 11
dez 2005311189 4,1 136    ( ) 9
nov 20052   89 2,6 1    ( ) 5
out 20052   89 2,6 1    ( ) 5
set 20052 2 89 2,6 16    ( ) 5
ago 20052 1 8312,6 53    ( ) 4
jul 20052 1 6712,4 53    ( ) 3
jun 20052   43 2,5      ( ) 2
mai 2005212 4312,5 103    ( ) 2
abr 20051   3 2      ( )  
mar 20051   3 2      ( )  
fev 20051   3 2      ( )  
jan 20051   3 2      ( )  
dez 20041   3 2 1    ( )  
nov 20041   2 2,5 1    ( )  
out 20041   1 4      ( )  
set 20041   1 4      ( )  
ago 20041   1 4      ( )  
jul 20041   1 4      ( )  
jun 20041   1 4      ( )  
mai 20041   1 4      ( )  
abr 20041   1 4      ( )  
mar 20041   1 4      ( )  
fev 20041   1 4      ( )  
jan 20041   1 4      ( )  
dez 20031   1 4      ( )  
nov 20031   1 4      ( )  
out 20031   1 4      ( )  
set 20031   1 4      ( )  
ago 20031   1 4      ( )  
jul 20031   1 4      ( )  
jun 20031   1 4      ( )  
mai 20031   1 4      ( )  
abr 20031   1 4      ( )  
mar 200311  1 4 4    ( )  
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  100  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
dez 2018             111       
nov 20183331    1     221       
out 201822211   2     3111      
set 2018             2         
ago 20181            11        
jul 2018111           32        
jun 20182111          2111      
mai 20181111          211       
abr 20183111          211       
mar 201832211         3211      
fev 2018111           1         
jan 2018221           1         
dez 201721111   1     22        
nov 201731           11        
out 2017                       
set 2017422           2         
ago 2017111     1     2         
jul 20173            211       
jun 2017211     1     63311     
mai 20173111          111    1  
abr 20174211    1     22        
mar 20172                      
fev 201721           3         
jan 201711           1         
out 201822211   2     3111      
jul 2018111           32        
abr 20183111          211       
jan 2018221           1         
out 2017                       
jul 20173            211       
abr 20174211    1     22        
jan 201711           1         
out 201611     1     1         
jul 2016411           31        
abr 2016211     1     51111     
jan 20164331    1     6322111   
out 2015       1     21111  1  
jul 2015411     1     53211     
abr 2015411     1   2253111  11 
jan 201521     11    64        
out 201453331   2     54322     
jul 20142111    1     3221      
abr 2014731111   2     6      11 
jan 201441     1     321       
out 201352111   3     83111     
jul 201311     2     82        
abr 20135322          147431     
jan 20135321111 1     1041    2  
out 20126222 22 4     137321  11 
jul 20122111 22 1     82111  11 
abr 20123111 11 21    1043    21 
jan 201273321         1221       
out 20111032211         12543      
jul 20115431 11 1     103        
abr 20114111    1     5331      
jan 20113111 11       10         
out 2010111  11       51        
jul 20101   11       211       
abr 20105111 21       421       
jan 2010431  11 1     3221      
out 20096321 221      3         
jul 2009111           411       
abr 2009921  11 2     6321   11 
jan 200911  1        422       
out 20082211 1  1     6331      
jul 2008311     1     75431     
abr 20081111 11       4111      
jan 2008331  11 1     51        
out 2007    11 4     13411      
jul 2007    11       321       
abr 2007             4431      
jan 20072111          432111    
out 200643221   1     431       
jul 2006211     1     5211   11 
abr 20061            2111      
jan 200687331   3     85311     
out 2005             211       
jul 200511111   11    3111   11 
abr 2005                       
jan 2005             22221     
out 2004                       
jul 2004                       
abr 2004             11        
jan 2004             11        
out 2003                       
jul 2003                       
abr 2003                       

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1149100.0%5,852100.0%
38355.7%5,75098.3%
105234.9%5,57995.3%
322718.1%5,21489.1%
100138.7%4,48176.6%
31632.0%2,66245.5%
100010.7%1,00517.2%

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
BanjoBot 2.0UC11,005jan 25, 20161070fev 14, 20161050
AnankeBotUC2852dez 18, 20083664set 15, 20131932
HombreDHojalataUC3805nov 05, 20093342nov 29, 201831
CalqUC4248set 23, 20112655nov 29, 20151127
XoséUC5243dez 20, 20054758set 10, 20074129
SamoaBotUC6233abr 09, 20141726abr 15, 20141720
BanjoBotUC7195dez 09, 20074039dez 09, 20074039
RocasteloUC8189mai 14, 20054978jan 21, 20064726
GallaecioUC9178set 03, 20074136mar 07, 20112855
BanjoUC10166dez 15, 20064398jan 19, 2018345
Norrin strangeUC11136ago 02, 20064533dez 01, 2017394
Sinde~glwikiquoteUC12131set 12, 20093396out 02, 20093376
YiFeiBotUC13100ago 04, 20151244mai 08, 2018236
Adalbertofrenesi~glwikiquoteUC1490set 28, 20064476dez 25, 20064388
Alma~glwikiquoteUC1588nov 13, 20074065fev 10, 20083976
MerlIwBotUC1670jul 26, 20122348jun 14, 20132025
Johny89UC1759jun 05, 20093495mai 10, 20103156
Miguel.limaUC1849dez 11, 20064402ago 15, 20083789
CarsracBotUC1948mar 19, 20112843mai 10, 20132060
AlmaffiUC2046jul 19, 20112721abr 05, 20122460

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 456 edições foram feitas por usuários anônimos, de um total de 7393 edições ( 6e %)
  


4 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
ChtitBotUC1713jun 21, 20074210fev 06, 20112884--
EleferenBotUC2257fev 13, 20103242jan 13, 20132177--
AvicBotUC3110jul 10, 20112730set 06, 20112672--
DinybotUC45mar 24, 20074299mar 25, 20074298--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 2018691378317 6553143350       
nov 2018691378317 6553143350       
out 2018684378314 6553143350       
set 2018677377313 6553103347       
ago 2018677377313 6553103347       
jul 2018677377313 6553103347       
jun 2018677377312 6553103347       
mai 2018674377310 6553083346       
abr 2018671377307 6553083346       
mar 2018670377307 6553073346       
fev 2018661377306 6553023346       
jan 2018658376306 6553023346       
dez 2017655376306 6553023346       
nov 2017651374305 6553023346       
out 2017651374305 6553023346       
set 2017651374305 6553023346       
ago 2017650373305 6553013346       
jul 2017649373305 6553013346       
jun 2017649373305 6553013346       
mai 2017647372304 6552983293       
abr 2017641372304 6552983293       
mar 2017640372304 6552983293       
fev 2017640372303 6552983293       
jan 2017639369303 6552983293       
dez 2016638369303 6552983292       
nov 2016634369303 6552973291       
out 2016633369303 6552973291       
set 2016633369303 6552973291       
ago 2016633368303 6552973291       
jul 2016633367303 6552973291       
jun 2016631367303 6552973291       
mai 2016630367303 6552973291       
abr 2016629367303 6552973288       
mar 2016629366303 6552903287       
fev 2016628366303 6552903265       
jan 2016622366303 6552883233       
dez 2015621365287 6402823205       
nov 2015621362287 6402823205       
out 2015617361287 6402802203       
set 2015617361287 6382672203       
ago 2015614361287 6382592203       
jul 2015614361287 6372582203       
jun 2015610360287 6352462203       
mai 2015609360287 6352272203       
abr 2015609360287 6332082203       
mar 2015607358287 6282072203       
fev 2015605357287 6272072203       
jan 2015605352287 6272072203       
dez 2014604349287 6272072202       
nov 2014604349287 6272062201       
out 2014604348287 6272052201       
set 2014596348286 6271972198       
ago 2014596345286 6271972198       
jul 2014594342280 6271892197       
jun 2014593342280 6251892196       
mai 2014591342280 6251892196       
abr 2014591342280 6251892196       
mar 2014591338280 6251892196       
fev 2014591333280 6251892196       
jan 2014586330279 6251862196       
dez 2013584326279 6251862196       
nov 2013582326279 6251832196       
out 2013540322258 6251832186       
set 2013488319191 6251812178       
ago 201347930594 6251812174       
jul 201347830294 6251812174       
jun 201347829994 6251812174       
mai 201347629794 6241812174       
abr 201346829694 6211792172       
mar 201345629294 6211772168       
fev 201345528794 6191752168       
jan 201345328094 6191722168       
dez 201244827994 6191692166       
nov 201244627594 6191692166       
out 201244327594 6191672166       
set 201244027188 6151612162       
ago 201244026888 6131602162       
jul 201243926488 6131602161       
jun 201243726288 6131602161       
mai 201243325488 6121592161       
abr 201243225188 6121592160       
mar 201243224588 6121572160       
fev 201243224488 6121572160       
jan 201242923588 6121572160       
dez 201142323088 6111572159       
nov 201142122788 6111572159       
out 201142021588 6081552156       
set 201141221284 6081492155       
ago 201141120984 6071492155       
jul 201140620683 5991472154       
jun 201139919783 5991472154       
mai 201139319380 5981402154       
abr 201138718878 5981382154       
mar 201138318372 5981382154       
fev 201134718167 5971362140       
jan 201134717767 5971362140       
dez 201034717467 5971362140       
nov 201034617367 5971362140       
out 201034617167 5971362140       
set 201034616967 5971332140       
ago 201034616467 5971312140       
jul 201034515167 5971272140       
jun 201034415167 5971232140       
mai 201034414167 5971202140       
abr 201034214167 5971202140       
mar 201034213667 5971202140       
fev 201034013366 5971192140       
jan 201033913066 5971192140       
dez 200933311966 5971192140       
nov 200933011666 5971192140       
out 200932611366 5971192140       
set 200931411365 5971192138       
ago 200928210855 5971192130       
jul 200928110855 5971192130       
jun 200928010655 5971192130       
mai 200927510555 5951182130       
abr 200927410455 5951102130       
mar 20092729655 5951082130       
fev 20092729355 5941072130       
jan 20092728955 5931062124       
dez 20082728955 5931032124       
nov 20082708655 5931002124       
out 20082547355 593992123       
set 20082486355 592992123       
ago 20082466254 592982123       
jul 20082435954 592982118       
jun 20082405653 592971118       
mai 20082405153 590971118       
abr 20082404753 589971117       
mar 20082404753 587961117       
fev 20082394653 587961117       
jan 20082364653 587951117       
dez 20072314553 587951117       
nov 20072004353 586911116       
out 20071873851 586891115       
set 20071833250 586871115       
ago 20071722950 583871115       
jul 20071712750 582841114       
jun 20071712748 581831114       
mai 20071712548 580831114       
abr 20071712548 578831114       
mar 20071712548 569791114       
fev 20071702348 568791114       
jan 20071692248 554791114       
dez 20061672048 448781113       
nov 20061621845 447781113       
out 20061611845 447781113       
set 20061541845 447781110       
ago 20061351745 44775198       
jul 20061291745 44375196       
jun 20061281645 43275196       
mai 20061281644 43171196       
abr 20061281644 43169196       
mar 20061281644 43169196       
fev 20061231640 42469195       
jan 20061231540 41869195       
dez 2005971227 41767182       
nov 20059387 4072 18       
out 20059344 3972 17       
set 20059344 3962 17       
ago 20058634 3912 17       
jul 20056924 3881 16       
jun 20054311 3801 9       
mai 20054311 2961 9       
abr 20051   296          
mar 20051   296          
fev 20051   296          
jan 20051   296          
dez 20041   296          
nov 20041   4          
out 2004    4          
set 2004    4          
ago 2004    4          
jul 2004    4          
jun 2004    4          
mai 2004    4          
abr 2004    4          
mar 2004    4          
fev 2004    4          
jan 2004    4          
dez 2003    4          
nov 2003 
out 2003 
set 2003 
ago 2003 
jul 2003 
jun 2003 
mai 2003 
abr 2003 
mar 2003 

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

mar 2003: 1 1 Stanislaw Jerzy Lec

nov 2004: 1 1 Portada

dez 2004: 1 1 Winston Churchill

mai 2005: 1 2 Portada , 2 2 Albert Einstein

jul 2005: 1 1 Portada

ago 2005: 1 1 Stanislaw Jerzy Lec

set 2005: 1 1 Antoine de Saint-Exupéry

nov 2005: 1 1 Portada

dez 2005: 1 2 Portada , 2 2 Winston Churchill , 3 2 Henry David Thoreau

jan 2006: 1 3 Maquiavelo , 2 3 Voltaire , 3 3 Mahatma Gandhi , 4 3 Anaxágoras , 5 3 Alfonso Daniel Rodríguez Castelao , 6 2 Portada , 7 2 A arte da guerra

fev 2006: 1 1 George Berkeley

mar 2006: 1 1 Portada

abr 2006: 1 1 Charles Chaplin

mai 2006: 1 1 Kavafis

jun 2006: 1 1 Winston Churchill

jul 2006: 1 1 Warren Buffett

ago 2006: 1 1 Portada

set 2006: 1 3 Alfonso Daniel Rodríguez Castelao , 2 2 Inscricións en monumentos notorios , 3 2 Ronald Reagan , 4 2 P. J. O'Rourke , 5 1 Portada

out 2006: 1 2 Winston Churchill , 2 2 John Maynard Keynes , 3 2 Nelson Mandela , 4 1 Portada

nov 2006: 1 1 Walter Benjamin

dez 2006: 1 3 Proverbios galegos , 2 2 Fidel Castro , 3 1 Ayrton Senna

jan 2007: 1 1 Tertuliano

fev 2007: 1 1 Charles de Montesquieu

mar 2007: 1 2 Richard Feynman , 2 2 Miguel de Cervantes Saavedra

ago 2007: 1 1 Alejandro Pérez Lugín

set 2007: 1 2 Henry David Thoreau , 2 1 Carlos Fuentes

nov 2007: 1 2 Marcel Proust , 2 2 Martin Niemöller , 3 2 Antoine de Saint-Exupéry , 4 2 Proverbios chineses , 5 2 André Gide , 6 1 Proverbios italianos

dez 2007: 1 2 Fernando Pessoa , 2 2 Filosofía , 3 2 Sexualidade , 4 2 Che Guevara , 5 2 Proverbios latinos , 6 2 Bertrand Russell , 7 1 Portada

jan 2008: 1 2 Simone de Beauvoir , 2 2 Rabindranath Tagore

fev 2008: 1 1 Portada

mar 2008: 1 1 Juan José Ibarretxe

abr 2008: 1 1 Proverbios galegos

mai 2008: 1 1 Arthur Rimbaud

jun 2008: 1 1 William Shakespeare

jul 2008: 1 1 Cristianismo

ago 2008: 1 1 Heinrich Heine

set 2008: 1 1 Vari Caramés

out 2008: 1 1 Mark Shuttleworth

nov 2008: 1 1 Portada

dez 2008: 1 1 Vida

jan 2009: 1 1 Baltasar Gracián

fev 2009: 1 1 Heráclito de Éfeso

mar 2009: 1 2 Albert Camus , 2 1 François Truffaut

abr 2009: 1 3 Ángeles González-Sinde

mai 2009: 1 2 Richard Stallman , 2 1 Ángeles González-Sinde

jun 2009: 1 2 Luís de Camões , 2 2 Benjamin Disraeli

jul 2009: 1 1 Rafael Correa

set 2009: 1 2 John Myers Myers , 2 2 Emilio Pérez Touriño , 3 1 Thomas Jefferson

out 2009: 1 2 Teresa de Ávila , 2 1 Portada

nov 2009: 1 2 Montserrat Caballé , 2 1 Xulio Verne

dez 2009: 1 2 Fullmetal Alchemist , 2 2 John Updike , 3 1 Portada

jan 2010: 1 1 Xosé A. Cornide Saavedra e Folgueira

fev 2010: 1 1 Mikhail Botvinnik

mar 2010: 1 1 How I Met Your Mother

abr 2010: 1 1 Luís de Camões

mai 2010: 1 1 Níxer

jun 2010: 1 1 Mikhail Botvinnik

jul 2010: 1 1 Léopold Sédar Senghor

ago 2010: 1 2 Joseph Fourier , 2 1 George Best

set 2010: 1 1 Emilia Pardo Bazán

out 2010: 1 1 Mika Waltari

dez 2010: 1 2 Abraham Lincoln , 2 1 Amizade

jan 2011: 1 1 Jules Verne

fev 2011: 1 2 Política , 2 1 Niels Bohr

mar 2011: 1 3 Linus Torvalds , 2 2 Larry Wall , 3 2 Alan Kay , 4 2 Informática , 5 2 Erasmo de Róterdam , 6 2 Duke Ellington , 7 2 Giovanni Boccaccio , 8 2 Familia , 9 2 Guerra , 10 2 Muller , 11 2 Adolf Hitler , 12 2 Noam Chomsky , 13 1 Portada

abr 2011: 1 1 Portada

mai 2011: 1 1 Portada

jun 2011: 1 1 Portada

jul 2011: 1 2 Guillerme Vázquez , 2 2 Henri Poincaré , 3 2 Álvarez Rabo , 4 2 Herta Müller

ago 2011: 1 2 Portada , 2 2 Franz Kafka , 3 2 Proverbios checos , 4 2 Henri Poincaré

set 2011: 1 1 Vladimir Nabokov

out 2011: 1 3 Demóstenes , 2 2 Manuel Rivas , 3 2 Martin Niemöller , 4 2 Camilo José Cela , 5 2 Anaximandro de Mileto , 6 1 Portada

nov 2011: 1 2 Jô Soares , 2 1 Portada

dez 2011: 1 2 Robert Flaherty , 2 1 Portada

jan 2012: 1 2 Bill Gates , 2 1 Nelly Sachs

fev 2012: 1 3 Portada , 2 2 Miguel Maura Gamazo

mar 2012: 1 1 Valentín Paz-Andrade

abr 2012: 1 1 Otto von Bismarck

mai 2012: 1 1 Can

jun 2012: 1 1 Portada

jul 2012: 1 1 Portada

ago 2012: 1 1 Alexis Carrel

set 2012: 1 1 Roberto Vidal Bolaño

out 2012: 1 3 Prestige , 2 2 A esmorga , 3 1 Catástrofe do Prestige

nov 2012: 1 1 Pareidolia

dez 2012: 1 1 Antístenes

jan 2013: 1 2 Virxilio , 2 2 P. J. O'Rourke

fev 2013: 1 1 Tampa

mar 2013: 1 2 Tampa

abr 2013: 1 1 Elbert Hubbard

mai 2013: 1 1 Jeff Buckley

jun 2013: 1 2 Federico García Lorca , 2 1 Xosé María Díaz Castro

jul 2013: 1 1 Lois Pereiro

ago 2013: 1 1 Kin Hubbard

set 2013: 1 1 Jonathan Swift

out 2013: 1 2 João Batista de Andrade , 2 1 Giovanni Verga

nov 2013: 1 1 SIDA

dez 2013: 1 2 SIDA , 2 1 Manuel Quiroga

jan 2014: 1 1 Redondela

fev 2014: 1 1 Teléfono

mar 2014: 1 1 Teléfono

abr 2014: 1 2 William Wordsworth , 2 1 Portada

mai 2014: 1 1 Richard Stallman

jun 2014: 1 1 Czesław Miłosz

jul 2014: 1 1 Xosé Filgueira Valverde

ago 2014: 1 1 Paul Bourget

set 2014: 1 1 Xosé Filgueira Valverde

out 2014: 1 2 Portada , 2 2 Pío Cabanillas Gallas , 3 2 Mark Twain

nov 2014: 1 1 A esmorga

dez 2014: 1 1 A nosa cinza

jan 2015: 1 1 Vicente Risco

fev 2015: 1 1 Jerzy Kosiński

mar 2015: 1 1 Festa dos Fachós

abr 2015: 1 2 Capacidade , 2 1 Santa Teresa de Xesús

mai 2015: 1 1 Star Wars

jun 2015: 1 1 Xela Arias

jul 2015: 1 1 Manuel María Fernández

set 2015: 1 1 Portada

nov 2015: 1 3 Soidade , 2 2 George Bernard Shaw , 3 2 Memorias dun neno labrego , 4 1 Portada

dez 2015: 1 1 Soidade

jan 2016: 1 2 Portada

fev 2016: 1 2 Rosalía de Castro , 2 1 Portada

mar 2016: 1 1 Florentino López Cuevillas

abr 2016: 1 1 Portada

mai 2016: 1 1 A Gaita Gallega

jun 2016: 1 1 Antonio Beiras García

jul 2016: 1 1 Konstantin Tsiolkovsky

ago 2016: 1 1 Xosé Filgueira Valverde

set 2016: 1 1 Can

out 2016: 1 1 José Luis Rodríguez Zapatero

nov 2016: 1 1 Os escuros soños de Clío

dez 2016: 1 1 Deus sentado nun sillón azul

jan 2017: 1 1 Roberto Blanco Torres

fev 2017: 1 1 John Ford

mar 2017: 1 1 Rosalía de Castro

abr 2017: 1 1 María Mariño

mai 2017: 1 1 Rafael Dieste

jun 2017: 1 1 María Victoria Moreno

jul 2017: 1 1 María Victoria Moreno

ago 2017: 1 1 Luís Pimentel

set 2017: 1 2 Luís Pimentel , 2 1 Menotti del Picchia

nov 2017: 1 1 Luís Pimentel

dez 2017: 1 1 International Standard Serial Number

jan 2018: 1 1 Otero Pedrayo

fev 2018: 1 1 Anagnórise

mar 2018: 1 1 Alfonso Guerra

abr 2018: 1 1 Reconquista de Vigo

mai 2018: 1 1 O Principiño

jun 2018: 1 2 Afonso VIII de León e Galicia , 2 1 Antón Fraguas

jul 2018: 1 1 Antón Fraguas

ago 2018: 1 1 Adolf Hitler

out 2018: 1 2 Texto , 2 2 Tempo , 3 1 Gonzalo López Abente

nov 2018: 1 1 José María de Arellano

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file glwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 1.0 Mb as gz -> 7.1 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:16 after 6 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.