Estatísticas da Wikiquote guzerate
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here
 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions

 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201819   578 5,9      ( ) 12
nov 201819   578 5,9      ( ) 12
out 201819   578 5,9 4    ( ) 12
set 201819   577 5,9      ( ) 12
ago 201819 1 577 5,9 5    ( ) 12
jul 201819   576 5,9 1    ( ) 12
jun 201819   576 5,9 1    ( ) 12
mai 201819   576 5,9      ( ) 12
abr 201819   576 5,9 1    ( ) 12
mar 201819   576 5,9      ( ) 12
fev 201819   576 5,9 1    ( ) 12
jan 201819   576 5,9 1    ( ) 12
dez 201719   576 5,9      ( ) 12
nov 201719   576 5,9 1    ( ) 12
out 201719   576 5,9      ( ) 12
set 201719   576 5,9 2    ( ) 12
ago 201719   576 5,9      ( ) 12
jul 20171911 576 5,9 12    ( ) 12
jun 201718   576 5,9 1    ( ) 12
mai 201718   576 5,9      ( ) 12
abr 201718   576 5,9 1    ( ) 12
mar 201718   576 5,9      ( ) 12
fev 201718   576 5,9      ( ) 12
jan 201718   576 5,9      ( ) 12
dez 201618   576 5,9      ( ) 12
nov 201618   576 5,9      ( ) 12
out 201618   576 5,9      ( ) 12
set 201618   576 5,9      ( ) 12
ago 201618   576 5,9      ( ) 12
jul 201618   576 5,9      ( ) 12
jun 201618   576 5,9      ( ) 12
mai 201618 1 576 5,9 103    ( ) 12
abr 201618122574 5,7 422    ( ) 12
mar 201617 11574 5 290    ( ) 7
fev 201617121574 4,5 158    ( ) 4
jan 201616 3 566 4,3 89    ( ) 4
dez 20151612 560 4,2 63    ( ) 4
nov 201515   550 4,1 1    ( ) 3
out 201515   550 4,1 1    ( ) 3
set 201515   549 4,1      ( ) 3
ago 201515   549 4,1 7    ( ) 3
jul 201515   549 4,1 1    ( ) 3
jun 201515 1 548 4,1 5    ( ) 3
mai 201515   547 4,1      ( ) 3
abr 201515   547 4,1 1    ( ) 3
mar 201515 1 547 4,1 25    ( ) 3
fev 201515   547 4,1      ( ) 3
jan 201515 1 547 4,1 6    ( ) 3
dez 201415 1 542 4,1 5    ( ) 3
nov 201415   538 4,1 2    ( ) 3
out 201415 1 537 4,1 18    ( ) 3
set 201415   535 4,1 1    ( ) 3
ago 201415   535 4,1 2    ( ) 3
jul 201415   535 4,1      ( ) 3
jun 201415   535 4,1 5    ( ) 3
mai 201415   535 4,1 1    ( ) 3
abr 201415 1 534 4,1 23    ( ) 3
mar 201415   529 4,1 5    ( ) 3
fev 201415   528 4,1      ( ) 3
jan 201415 1 528 4,1 9    ( ) 3
dez 201315   525 4,1      ( ) 3
nov 201315   525 4,1 2    ( ) 3
out 201315 1 525 4,1 12    ( ) 3
set 201315 2 525 4,1 66    ( ) 3
ago 201315 3 52114 51    ( ) 3
jul 201315 4 50234 217    ( ) 3
jun 20131514 40314,5 74    ( ) 3
mai 201314 1 387 4,5 12    ( ) 3
abr 201314 2 38114,5 131    ( ) 3
mar 201314 2 34314,6 71    ( ) 3
fev 201314 1 325 4,6 27    ( ) 2
jan 201314 2 311 4,8 29    ( ) 2
dez 201214   304 4,8 9    ( ) 2
nov 201214 1 300 4,8 15    ( ) 2
out 20121435130034,8 590    ( ) 2
set 201211 2 209 4 66    ( ) 2
ago 201211   199 3,9 2    ( ) 2
jul 201211   199 3,9 1    ( ) 2
jun 201211 1 199 3,9 10    ( ) 2
mai 201211   197 3,9 46    ( ) 2
abr 20121113 19013,8 113    ( ) 2
mar 201210231154 3,9 156    ( ) 1
fev 2012824 14323,1 141    ( ) 1
jan 2012611 75 4,1 29    ( ) 1
dez 20115   73 3,8 4    ( ) 1
nov 20115   73 3,7 1    ( ) 1
out 20115 1 73 3,7 5    ( ) 1
set 20115   73 3,7 3    ( ) 1
ago 20115 1 73 3,6 9    ( ) 1
jul 201151  72 3,5 29    ( ) 1
jun 20114   72 3,1 1    ( ) 1
mai 20114   72 3,1      ( ) 1
abr 20114   72 3,1 4    ( ) 1
mar 20114   72 3,1 7    ( ) 1
fev 20114   72 3 2    ( ) 1
jan 20114   72 2,9 4    ( ) 1
dez 20104   72 2,9 3    ( ) 1
nov 20104   72 2,8 2    ( ) 1
out 20104   72 2,8 1    ( ) 1
set 20104   72 2,8 1    ( ) 1
ago 20104   72 2,8 3    ( ) 1
jul 20104   71 2,8 6    ( ) 1
jun 201041  69 2,8 1    ( ) 1
mai 20103   69 2,8      ( ) 1
abr 20103   69 2,8 1    ( ) 1
mar 20103   69 2,8 2    ( ) 1
fev 20103   69 2,7 6    ( ) 1
jan 20103   69 2,6 2    ( ) 1
dez 20093   69 2,6 6    ( ) 1
nov 20093   69 2,5 7    ( ) 1
out 20093   66 2,5 13    ( ) 1
set 20093   66 2,3 3    ( ) 1
ago 20093   65 2,3      ( ) 1
jul 20093 1 65 2,3 7    ( ) 1
jun 20093 1 60 2,4 27    ( ) 1
mai 20093   54 2,2 4    ( ) 1
abr 2009311 52 2,2 7    ( ) 1
mar 20092   52 2 1    ( ) 1
fev 20092   52 2 5    ( ) 1
jan 20092   49 2      ( ) 1
dez 2008211 4912 68    ( ) 1
nov 20081   4 8      ( ) 1
out 20081   4 8      ( ) 1
set 20081   4 8      ( ) 1
ago 20081   4 8      ( ) 1
jul 20081   4 8      ( ) 1
jun 20081   4 8      ( ) 1
mai 20081   4 8 1    ( ) 1
abr 20081   4 7,8      ( ) 1
mar 20081   4 7,8      ( ) 1
fev 20081   4 7,8 2    ( ) 1
jan 20081   3 9,7      ( ) 1
dez 20071   3 9,7      ( ) 1
nov 20071   3 9,7      ( ) 1
out 20071   3 9,7      ( ) 1
set 20071   3 9,7      ( ) 1
ago 20071   3 9,7      ( ) 1
jul 20071   3 9,7      ( ) 1
jun 20071   3 9,7      ( ) 1
mai 20071   3 9,7      ( ) 1
abr 20071   3 9,7 1    ( ) 1
mar 20071   3 9,3      ( ) 1
fev 20071   3 9,3      ( ) 1
jan 20071   3 9,3      ( ) 1
dez 20061   3 9,3      ( ) 1
nov 20061   3 9,3      ( ) 1
out 20061   3 9,3      ( ) 1
set 20061   3 9,3 3    ( ) 1
ago 20061   3 8,3 1    ( ) 1
jul 20061   3 8 2    ( ) 1
jun 20061   3 7,3      ( )  
mai 20061   3 7,3 1    ( )  
abr 20061   3 7      ( )  
mar 20061   3 7 4    ( )  
fev 20061   3 5,7      ( )  
jan 20061   3 5,7      ( )  
dez 20051   3 5,7      ( )  
nov 20051   3 5,7 1    ( )  
out 20051   3 5,3 1    ( )  
set 20051   3 5      ( )  
ago 20051   3 5 7    ( )  
jul 20051   3 2,7      ( )  
jun 20051   3 2,7      ( )  
mai 20051   3 2,7      ( )  
abr 20051   3 2,7      ( )  
mar 20051   3 2,7 7    ( )  
fev 20051   1 1      ( )  
jan 20051   1 1      ( )  
dez 20041   1 1      ( )  
nov 20041   1 1      ( )  
out 200411  1 1 1    ( )  
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  5 
dez 2018        2111     1      
nov 2018        111             
out 20182       4111     2      
set 2018        111             
ago 2018111      6111            
jul 2018        111      1      
jun 2018        311             
mai 2018        111      211    
abr 2018        221      1      
mar 2018        211             
fev 2018        11111    11     
jan 2018        211      1      
dez 2017        3111111  11     
nov 2017        111      1      
out 2017        21       1      
set 20171       111      1      
ago 2017        111      211    
jul 20173111     311      1      
jun 20171       111             
mai 2017        111             
abr 20171       211      1      
mar 2017        111             
fev 2017        111      2      
jan 2017        1111     1      
out 20182       4111     2      
jul 2018        111      1      
abr 2018        221      1      
jan 2018        211      1      
out 2017        21       1      
jul 20173111     311      1      
abr 20171       211      1      
jan 2017        1111     1      
out 2016        211      1      
jul 2016        211      21     
abr 2016222222    1        422221 
jan 201654321 11 2111     63321  
out 20151       1        521   1
jul 20151       1        8311   
abr 2015        1      22611    
jan 2015111      11       641    
out 20142111              12322   
jul 2014                 124111  
abr 20147211     1        145421  
jan 2014111      1        1042111 
out 20131111     1        186321  
jul 201344444             8332   
abr 201332222             104311  
jan 20135321     1        1221    
out 2012665531 1112        1142    
jul 2012        1        1832    
abr 201274321    11       19973   
jan 201232111             1443    
out 2011111               1221    
jul 2011     11 1        134     
abr 201111               83211  
jan 20111                12331   
out 20101                154432  
jul 20102                103331  
abr 20101                91     
jan 20101       2        94221  
out 200921   1           112111  
jul 2009111               1541    
abr 2009111      1        20751   
jan 2009                 15442   
out 2008        1        8551   
jul 2008                 1721    
abr 2008                 165431  
jan 2008        2        142111  
out 2007        2        2610311  
jul 2007                 8      
abr 2007                 3211521  
jan 2007                 26431   
out 2006                 12431   
jul 20061                358611  
abr 2006                 341451   
jan 2006        1        3251    
out 20051                12      
jul 2005                 2993    
abr 2005                 27211   
jan 2005                 51     
out 20041                4211   

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
165100.0%3,244100.0%
32538.5%3,18498.2%
101827.7%3,14296.9%
321421.5%3,06494.5%
1001015.4%2,82086.9%
31634.6%1,58248.8%

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions		posiçãototaldatadias
atrás		datadias
atrás
Bhatakati aatmaUC1633dez 17, 20151109abr 05, 2016999
Sushant savlaUC2609jan 28, 20122528jan 02, 20161093
Ashok modhvadiaUC3340dez 04, 20083678jul 29, 20151250
आर्यावर्तUC4291abr 10, 2016994jul 29, 2017519
imported>GubotUC5247abr 06, 20122459jan 30, 20161065
સતિષચંદ્રUC6185out 01, 20122281jan 11, 20161084
Vyom25UC7169fev 24, 20122501mar 31, 20151370
MF-WarburgUC8134mar 27, 20122469mar 27, 20122469
GujbotUC9110fev 08, 20161056fev 18, 20161046
imported>AmvaishnavUC10102jun 26, 20132013ago 05, 20131973
NileshbandhiyaUC1182mar 18, 20122478abr 29, 20122436
DsvyasUC1280fev 28, 20083958set 13, 2017473
imported>JaishreeUC1349fev 14, 20122511fev 23, 20122502
Maharshi675UC1433nov 09, 20093338abr 30, 20141705
imported>CandalBotUC1529jul 09, 20112731jul 09, 20112731
AnankeBotUC1628out 27, 20093351set 09, 20131938
DineshjkUC1711ago 05, 20054895abr 25, 20093536
Nikunj3121994UC1810jul 28, 2017520jul 29, 2017519
VibhijainUC199ago 06, 20112703jun 17, 20132022
VolkovBotUC207fev 15, 20103240jun 15, 20112755

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 165 edições foram feitas por usuários anônimos, de um total de 3421 edições ( 4e %)
  

3 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions		datadias
atrás		datadias
atrás
EleferenBotUC110fev 13, 20103242jan 04, 20132186--
DinybotUC21abr 01, 20074291abr 01, 20074291--
AvicBotUC31set 06, 20112672set 06, 20112672--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 201859035369 72262447       
nov 201859035369 72262447       
out 201859035369 72262447       
set 201858935269 72262447       
ago 201858935269 72262447       
jul 201858835269 72262447       
jun 201858835269 72262447       
mai 201858835269 72262447       
abr 201858835269 72262447       
mar 201858835269 72262447       
fev 201858835269 72262447       
jan 201858835069 72262447       
dez 201758835069 72262447       
nov 201758834869 72262447       
out 201758834769 72262447       
set 201758834669 72262447       
ago 201758834569 72262447       
jul 201758834569 72262447       
jun 201758834569 72262447       
mai 201758834569 72262447       
abr 201758834569 72262447       
mar 201758834569 72262447       
fev 201758834569 72262447       
jan 201758834369 72262447       
dez 201658834369 72262447       
nov 201658834369 72262447       
out 201658834369 72262447       
set 201658834369 72262447       
ago 201658834269 72262447       
jul 201658834169 72262447       
jun 201658834169 72261447       
mai 201658834169 72261447       
abr 201658633969 70261445       
mar 201658133667 69254442       
fev 201657833665 69254435       
jan 201657033562 45240432       
dez 201556433461 31236225       
nov 201555332323 7171214       
out 201555332323 7171214       
set 201555232323 7164214       
ago 201555232323 7164214       
jul 201555232223 7163214       
jun 201555132123 7163214       
mai 201555032122 7163214       
abr 201555032122 7162214       
mar 201555032022 7162214       
fev 201555032021 7162214       
jan 201555031521 7162214       
dez 201454531321 7162214       
nov 201454131219 7161214       
out 201454031019 7161214       
set 201453830919 7160214       
ago 201453830619 7160214       
jul 201453830319 7160214       
jun 201453830319 7160214       
mai 201453830319 7160214       
abr 201453730319 7160214       
mar 201453230016 7160214       
fev 201453129616 7160214       
jan 201453129315 7160214       
dez 201352829015 7159214       
nov 201352828913 7155214       
out 201352828411 7153214       
set 201352828111 7152214       
ago 201352426711 7152214       
jul 201350526411 7152214       
jun 201340626011 7152214       
mai 201339025811 7152214       
abr 201338425711 7152214       
mar 201334625311 7152214       
fev 201332724711 7150214       
jan 201331324011 7147213       
dez 201230623910 7146213       
nov 201230223410 7146213       
out 201230223410 7145213       
set 201221122710 7144213       
ago 201220122410 7144213       
jul 201220122010 7144213       
jun 20122012179 6143213       
mai 20121992098 6137213       
abr 20121922076 5130213       
mar 20121552006 5124213       
fev 20121441996 5122213       
jan 2012761926 5121213       
dez 2011741886 5121212       
nov 2011741856 5117212       
out 2011741736 5116212       
set 2011741706 4116212       
ago 2011741676 4116112       
jul 2011731646 4115112       
jun 2011731566 4114112       
mai 2011731526 4113112       
abr 2011731486 4113112       
mar 2011731426 4113112       
fev 2011731415 4113112       
jan 2011731375 4113112       
dez 2010731345 4112112       
nov 2010731315 4111112       
out 2010731295 3111112       
set 2010731275 3111112       
ago 2010731235 3111112       
jul 2010721095 3111112       
jun 2010701095 3109112       
mai 2010701005 3103112       
abr 2010701005 3103112       
mar 201070955 3103112       
fev 201070935 3103112       
jan 201070905 3102112       
dez 200970785 3102112       
nov 200970775 3102112       
out 200967765 3102112       
set 200967755 3102112       
ago 200966715 3102112       
jul 200966715 3101112       
jun 200961704 398112       
mai 200955674 39116       
abr 200953664 38916       
mar 200953574 38516       
fev 200953554 38416       
jan 200950514 38316       
dez 200850514 38316       
nov 20085504 38116       
out 20085374 37716       
set 20085274 37716       
ago 20085274 37716       
jul 20085274 37716       
jun 20085264 37616       
mai 20085234 37616       
abr 20085184 37616       
mar 20085184 27416       
fev 20085174 24316       
jan 20084174 24316       
dez 20074154 24316       
nov 20074134 24316       
out 20074134 24216       
set 20074124 24216       
ago 20074102 24216       
jul 2007482 24216       
jun 2007482 24216       
mai 2007482 24216       
abr 2007482 24216       
mar 2007482 12816       
fev 2007472 110 6       
jan 2007462 19 6       
dez 2006462 19 6       
nov 2006452 19 6       
out 2006452 18 6       
set 2006442 16 5       
ago 2006432 16 5       
jul 2006432 15 5       
jun 2006332 15 4       
mai 2006332 15 4       
abr 2006332 15 4       
mar 2006332 15 2       
fev 2006332 15 2       
jan 2006332 15 2       
dez 2005322 14 2       
nov 20053 2 14 2       
out 20053 2 14 1       
set 20053 2 14 1       
ago 20053 2 14         
jul 20053 2 13         
jun 20053 2 13         
mai 20053 1  3         
abr 20053 1  3         
mar 20053    2         
fev 20051    2         
jan 20051    2         
dez 20041    2         
nov 20041    2         
out 20041    2         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons
 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2004: 1 1 મુખપૃષ્ઠ

mar 2005: 1 3 અખાના છપ્પા

ago 2005: 1 1 અખાના છપ્પા

out 2005: 1 1 અખાના છપ્પા

nov 2005: 1 1 મુખપૃષ્ઠ

mar 2006: 1 1 અખાના છપ્પા

jul 2006: 1 1 Main Page

ago 2006: 1 1 મુખપૃષ્ઠ

set 2006: 1 2 મુખપૃષ્ઠ

fev 2008: 1 1 પગલાં

mai 2008: 1 1 મુખપૃષ્ઠ

dez 2008: 1 2 નરસિંહ મહેતા , 2 1 કલાપીનો કેકારવ/ભોળાં પ્રેમી

fev 2009: 1 1 નરસિંહ મહેતા

mar 2009: 1 1 નાગદમન

abr 2009: 1 1 અખાના છપ્પા/જ્ઞાની અંગ

mai 2009: 1 1 નરસિંહ મહેતા

jun 2009: 1 1 ગુજરાતી કહેવતો

jul 2009: 1 1 શિક્ષણ

out 2009: 1 1 નરસિંહ મહેતા

nov 2009: 1 2 કેસર ભીના કાનજી , 2 1 જશોદા! તારા કાનુડાને

dez 2009: 1 1 ગુજરાતી કહેવતો

jan 2010: 1 1 ચાઇનિઝ કહેવતો

fev 2010: 1 1 કોમ્પ્યુટર

abr 2010: 1 1 રામકૃષ્ણ પરમહંસ

jun 2010: 1 1 ચાઇનિઝ કહેવતો

jul 2010: 1 1 ધ પ્રોફેટ

ago 2010: 1 1 ચાઇનિઝ કહેવતો

out 2010: 1 1 આઝારબૈઝાની કહેવતો

nov 2010: 1 1 અરેબિક કહેવતો

dez 2010: 1 1 શિક્ષણ

jan 2011: 1 1 ભારત

fev 2011: 1 1 ચાઇનિઝ કહેવતો

mar 2011: 1 2 ભારત , 2 1 કોમ્પ્યુટર

abr 2011: 1 1 આઝારબૈઝાની કહેવતો

jun 2011: 1 1 શિક્ષણ

ago 2011: 1 1 જગદ્ગુરુ રામભદ્રાચાર્ય

set 2011: 1 1 પ્રેમરસ પાને

out 2011: 1 1 કોમ્પ્યુટર

jan 2012: 1 1 સમજણ વિના રે સુખ નહીં જંતને રે

fev 2012: 1 2 વા વાયા ને વાદળ ઉમટ્યા , 2 2 નાગર નંદજીના લાલ , 3 2 કાનજી તારી મા કહેશે પણ અમે , 4 2 અમે મૈયારા રે , 5 1 કલાપીનો કેકારવ/ભોળાં પ્રેમી

mar 2012: 1 3 કલાપીનો કેકારવ/હૃદયક્મલની જૂઠી આશા , 2 3 કલાપી , 3 2 હું તો જાઇશ ગિરિધર જોવા રે , 4 2 સુદામા ચરિત/કડવું ૩ , 5 1 કલાપીનો કેકારવ/ભોળાં પ્રેમી

abr 2012: 1 2 અખો , 2 1 કલાપી

mai 2012: 1 1 અખાના છપ્પા

jun 2012: 1 1 અખાના છપ્પા/આભડછેટનિંદા અંગ

ago 2012: 1 1 પછી શામળિયોજી બોલિયા

set 2012: 1 2 ઓખાહરણ/કડવું-૧૪ , 2 1 સુદામા ચરિત/કડવું ૪

out 2012: 1 3 ઓખાહરણ/કડવું-૪૩ , 2 3 ઓખાહરણ/કડવું-૪૨ , 3 2 કલાપીનો કેકારવ/મધુકરની વિજ્ઞપ્તિ , 4 2 કલાપીનો કેકારવ/ફકીરી હાલ , 5 1 કલાપીનો કેકારવ/પરિતાપ

nov 2012: 1 2 કલાપીનો કેકારવ , 2 1 કલાપીનો કેકારવ/પરિતાપ

dez 2012: 1 1 કલાપીનો કેકારવ

jan 2013: 1 3 કાશ્મીરનું સ્વપ્ન

fev 2013: 1 1 કાશ્મીરનું સ્વપ્ન

mar 2013: 1 1 કલાપીનો કેકારવ

abr 2013: 1 1 નરસિંહ મહેતા

mai 2013: 1 1 ભોજા ભગત

jun 2013: 1 2 કલાપી , 2 2 અખેગીતા/કડવું ૭ મું - માયાથી બ્રહ્માંડની ઉત્પત્તિ , 3 2 પંચીકરણ

jul 2013: 1 2 નળાખ્યાન/કડવું ૬૪ , 2 2 નળાખ્યાન/કડવું ૬૩ , 3 2 નળાખ્યાન/કડવું ૫૮ , 4 2 અખેગીતા/કડવું ૩૬મું - અદ્વૈતપદની દૃઢતા , 5 2 અખેગીતા/કડવું ૨૯ મું - ષટ્શાસ્ત્ર, ષટ્ઉપશાસ્ત્ર અને ષટ્દર્શનનું વર્ણન , 6 2 અખેગીતા/કડવું ૨૨ મું - બ્રહ્મ અને માયાની એકતાથી જીવ અને ઇશ્વરનું સ્વરૂપ-સદૃષ્ટાંત , 7 2 અખેગીતા/કડવું ૧૭ મું - બ્રહ્મવસ્તુ નિરૂપણ - ૧ , 8 2 અખેગીતા/કડવું ૧૬ મું - જીવન્મુકતનો મહિમા - ૨ , 9 2 અખેગીતા/કડવું ૧૫ મું - જીવન્મુકતનો મહિમા - ૧ , 10 2 અખેગીતા/કડવું ૧૩ મું - જીવન્મુક્તની દશા - ૧

ago 2013: 1 1 નળાખ્યાન/કડવું ૬૦

set 2013: 1 1 સુદામા ચરિત/કડવું ૯

out 2013: 1 1 અખેગીતા/કડવું ૧૦ મું - ભક્તિ, જ્ઞાન, વૈરાગ્યનું માહાત્મ્ય

nov 2013: 1 1 અખેગીતા/કડવું ૧૨ મું - સર્વાત્મભાવ જ્ઞાનતુર્ય પદ

jan 2014: 1 1 વહાલાને જોતાંયે મહારી

mar 2014: 1 1 ગોવિંદ ખેલે હોળી

abr 2014: 1 1 સુદામા ચરિત/કડવું ૧૧

mai 2014: 1 1 ગોવિંદ દામોદર માધવેતિ

jun 2014: 1 1 રાત રહે જ્યાહરે, પાછલી ખટ ઘડી

ago 2014: 1 1 ગુજરાતી કહેવતો/હ

set 2014: 1 1 અખેગીતા/કડવું ૧૩ મું - જીવન્મુક્તની દશા - ૧

out 2014: 1 1 મામેરૂં

nov 2014: 1 1 મામેરૂં/કડવું ૧

dez 2014: 1 1 સાંભળો કામની કૃષ્ણ કાયર કહે

jan 2015: 1 1 મોહ્યુંરે લટકે

mar 2015: 1 2 સુદામા ચરિત/કડવું ૧૪ , 2 1 મામેરૂં

jun 2015: 1 1 હરિ આવ્યા છે નારીના વેશે રે

jul 2015: 1 1 અબ્દુલ કલામ

out 2015: 1 1 સત્યના પ્રયોગો

dez 2015: 1 1 ગાંધીજી

jan 2016: 1 3 રવિન્દ્રનાથ ટાગોર , 2 2 અસંખ્ય , 3 2 સ્મિત , 4 2 ચાણક્ય , 5 1 નળાખ્યાન/કડવું ૩૯

fev 2016: 1 2 મૂરખો રળી રળી કમાણો રે , 2 2 ભરમાવી દુનિયાં ભોળીરે , 3 2 જોઇ લો જગતમાં બાવારે , 4 2 ભેખ તો ભાવર થકી ભુંડારે , 5 2 દેસિ સંતતણી લાવી રે , 6 2 ઉન્નતિ , 7 2 આળસ , 8 2 અસંખ્ય , 9 2 સ્મિત , 10 2 યોગેશ્વર , 11 2 ઇસુ , 12 1 દુનિયાં દીવાની કહેવાશેરે

mar 2016: 1 2 ગુજરાતી કહેવતો/ઉ , 2 1 કૈવલ્યગીતા

abr 2016: 1 2 નળાખ્યાન/કડવું ૬૪ , 2 2 નળાખ્યાન/કડવું ૬૩ , 3 2 નળાખ્યાન/કડવું ૬૨ , 4 2 નળાખ્યાન/કડવું ૬૧ , 5 1 કલાપીનો કેકારવ/પરિતાપ

mai 2016: 1 1 હું તો જાઇશ ગિરિધર જોવા રે

abr 2017: 1 1 નરસિંહ મહેતા

jun 2017: 1 1 નરસિંહ મહેતા

jul 2017: 1 1 નરસિંહ મહેતા

set 2017: 1 1 આળસ

ago 2018: 1 1 અર્જુન સિંહ જાડેજા

out 2018: 1 1 અર્જુન સિંહ જાડેજા

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file guwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 804 kb as gz -> 6.1 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:15 after 6 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.