Estatísticas da Wikiquote islandês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201821   222 11      ( ) 55
nov 201821   222 11 1    ( ) 55
out 201821   222 11      ( ) 55
set 201821   222 11      ( ) 55
ago 201821   222 11      ( ) 55
jul 201821   222 11 1    ( ) 55
jun 201821   222 11      ( ) 55
mai 201821   222 11 3    ( ) 55
abr 201821   222 11      ( ) 55
mar 201821   222 11 1    ( ) 55
fev 201821   222 11      ( ) 55
jan 201821   222 11      ( ) 55
dez 201721   222 11 9    ( ) 55
nov 201721   222 11 4    ( ) 55
out 201721   222 11 1    ( ) 55
set 201721   222 11 1    ( ) 55
ago 201721   222 11      ( ) 55
jul 201721   222 11      ( ) 55
jun 201721   222 11 1    ( ) 55
mai 201721   221 11      ( ) 55
abr 201721   221 11      ( ) 55
mar 201721   221 11      ( ) 55
fev 201721   221 11 5    ( ) 55
jan 201721   221 11      ( ) 55
dez 201621   221 11      ( ) 55
nov 201621   221 11      ( ) 55
out 201621   221 11 1    ( ) 55
set 201621   221 11      ( ) 55
ago 201621   221 11      ( ) 55
jul 201621   221 11      ( ) 55
jun 201621   221 11 2    ( ) 55
mai 201621   221 11 2    ( ) 55
abr 201621   221 11      ( ) 55
mar 201621   221 11      ( ) 55
fev 201621   221 11      ( ) 55
jan 201621   221 11      ( ) 55
dez 201521   221 11      ( ) 55
nov 201521   221 11      ( ) 55
out 201521   221 11      ( ) 55
set 201521   221 11 3    ( ) 55
ago 2015211  221 10,9 36    ( ) 55
jul 201520   221 10,8      ( ) 55
jun 201520   221 10,8 1    ( ) 55
mai 201520   221 10,8      ( ) 55
abr 201520   221 10,8 1    ( ) 55
mar 201520   221 10,8      ( ) 55
fev 201520   221 10,8      ( ) 55
jan 201520   221 10,8 2    ( ) 55
dez 201420   221 10,8 1    ( ) 55
nov 201420   221 10,8      ( ) 55
out 201420   221 10,8      ( ) 55
set 201420   221 10,8 1    ( ) 55
ago 201420   221 10,8 1    ( ) 55
jul 201420   220 10,8      ( ) 55
jun 201420   220 10,8 2    ( ) 55
mai 201420   219 10,8 4    ( ) 55
abr 20142011 219 10,8 87    ( ) 55
mar 201419   218 10,5 4    ( ) 55
fev 201419   218 10,4 5    ( ) 55
jan 201419   217 10,5 2    ( ) 55
dez 201319   216 10,5 1    ( ) 55
nov 201319   216 10,5 4    ( ) 55
out 201319   215 10,5 1    ( ) 55
set 201319 1 214 10,6 30    ( ) 55
ago 20131911 214 10,4 11    ( ) 55
jul 201318   214 10,4      ( ) 55
jun 201318 1 214 10,4 25    ( ) 55
mai 201318   214 10,3 2    ( ) 55
abr 20131811 214 10,3 12    ( ) 55
mar 201317   214 10,2 3    ( ) 55
fev 201317   214 10,2 1    ( ) 55
jan 201317 1 214 10,2 35    ( ) 55
dez 201217   214 10 2    ( ) 55
nov 201217   214 10 7    ( ) 55
out 201217   214 10 18    ( ) 55
set 201217   214 9,9 8    ( ) 55
ago 201217   214 9,9 13    ( ) 55
jul 20121711 214 9,8 24    ( ) 55
jun 201216   214 9,7 10    ( ) 55
mai 201216   213 9,7 7    ( ) 55
abr 201216   213 9,7 15    ( ) 55
mar 2012161  213 9,6 11    ( ) 55
fev 20121512 213 9,5 24    ( ) 55
jan 201214   213 9,4 8    ( ) 55
dez 201114 2 213 9,4 14    ( ) 55
nov 201114 1 213 9,3 10    ( ) 55
out 201114 1 213 9,3 38    ( ) 55
set 201114   213 9,1 9    ( ) 55
ago 201114 2 211 9,1 21    ( ) 55
jul 20111412 211 9 45    ( ) 55
jun 2011131  203 9,2 6    ( ) 55
mai 201112   201 9,2 8    ( ) 55
abr 201112 1 201 9,2 20    ( ) 55
mar 20111212 201 9,1 40    ( ) 55
fev 201111   201 8,9 9    ( ) 55
jan 201111   200 8,9 26    ( ) 55
dez 201011 1 198 8,9 30    ( ) 55
nov 201011   193 8,9 21    ( ) 55
out 201011   193 8,8 49    ( ) 55
set 201011   185 8,9 26    ( ) 54
ago 201011   184 8,8 12    ( ) 54
jul 201011   184 8,8 13    ( ) 54
jun 201011   184 8,7 12    ( ) 54
mai 201011   184 8,6 7    ( ) 54
abr 201011 1 184 8,6 28    ( ) 54
mar 201011   181 8,6 20    ( ) 54
fev 201011   180 8,5 21    ( ) 54
jan 201011   180 8,4 15    ( ) 54
dez 200911   178 8,4 13    ( ) 54
nov 200911   178 8,3 7    ( ) 54
out 200911   178 8,3 97    ( ) 54
set 2009111  178 7,8 24    ( ) 54
ago 200910   178 7,6 1    ( ) 54
jul 200910   178 7,6 10    ( ) 54
jun 2009101  178 7,6 15    ( ) 54
mai 20099   178 7,5 1    ( ) 54
abr 20099   178 7,5 2    ( ) 54
mar 20099   178 7,5 10    ( ) 54
fev 20099 1 178 7,4 15    ( ) 54
jan 20099   175 7,5 7    ( ) 54
dez 20089   174 7,5 8    ( ) 54
nov 20089   174 7,4 5    ( ) 54
out 20089   174 7,4 9    ( ) 54
set 200891  172 7,4 48    ( ) 54
ago 20088   172 7,1 2    ( ) 54
jul 20088   172 7,1      ( ) 54
jun 20088   172 7,1 7    ( ) 54
mai 20088   172 7,1 21    ( ) 54
abr 2008812 172 7 69    ( ) 54
mar 2008713 172 6,6 69    ( ) 53
fev 20086 1 169 6,3 50    ( ) 52
jan 20086 2116016,3 165    ( ) 48
dez 2007612 125 6,8 78    ( ) 41
nov 20075 1 118 6,5 43    ( ) 40
out 20075 2 115 6,3 49    ( ) 40
set 2007511 113 6 123    ( ) 40
ago 20074 2 101 5,5 55    ( ) 38
jul 20074 219925 348    ( ) 38
jun 2007422 32 4,6 66    ( ) 4
mai 20072   19 4,3 4    ( ) 2
abr 20072   18 4,3      ( ) 1
mar 20072   18 4,3 4    ( ) 1
fev 20072   17 4,4 1    ( ) 1
jan 20072   16 4,6      ( ) 1
dez 20062   16 4,6      ( ) 1
nov 20062   16 4,6 3    ( ) 1
out 20062   15 4,7      ( ) 1
set 20062   15 4,7      ( ) 1
ago 20062   15 4,7 2    ( ) 1
jul 20062   14 4,9      ( ) 1
jun 20062   14 4,9      ( ) 1
mai 20062   14 4,9 1    ( ) 1
abr 20062   13 5,2 2    ( ) 1
mar 20062   13 5 1    ( ) 1
fev 20062   13 4,9 2    ( ) 1
jan 20062   13 4,8 7    ( ) 1
dez 2005211 11 5 36    ( ) 1
nov 20051   7 2,7      ( ) 1
out 20051   7 2,7 7    ( ) 1
set 20051   5 2,4      ( ) 1
ago 20051   5 2,4      ( ) 1
jul 20051   5 2,4      ( ) 1
jun 20051   5 2,4 2    ( ) 1
mai 20051   4 2,5      ( ) 1
abr 20051   4 2,5 1    ( ) 1
mar 20051   4 2,2 4    ( ) 1
fev 20051   2 2,5 3    ( ) 1
jan 20051   1 2 1    ( ) 1
dez 20041            ( ) 1
nov 20041            ( ) 1
out 20041            ( ) 1
set 20041            ( ) 1
ago 200411      1    ( ) 1
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  1  3  5  10  25  5  10  1  3  5  10  25  100  250  5  10 
dez 2018                       
nov 2018                       
out 2018              2        
set 2018                       
ago 2018                       
jul 2018              1        
jun 2018                       
mai 20181                      
abr 2018              1        
mar 2018                       
fev 2018                       
jan 2018       1      1        
dez 201711     2      22       
nov 201711                     
out 2017              1        
set 2017              2        
ago 2017                       
jul 2017                       
jun 20171      2      2        
mai 2017              11     1 
abr 2017              21       
mar 2017              1        
fev 2017              2        
jan 2017                       
out 2018              2        
jul 2018              1        
abr 2018              1        
jan 2018       1      1        
out 2017              1        
jul 2017                       
abr 2017              21       
jan 2017                       
out 2016                       
jul 2016       1      1        
abr 2016              1        
jan 2016                       
out 2015       1      1      1 
jul 2015       2      1        
abr 2015            221        
jan 20151      11     21       
out 2014              2        
jul 2014              1        
abr 201441111   1      711    11
jan 2014       1      52       
out 2013       1      511      
jul 2013              6        
abr 2013311            721      
jan 20133111  111      531    11
out 201211   1 1      73111    
jul 20123111  1 1      52111    
abr 20121    1111     311    11
jan 201231            10222     
out 201121111          511      
jul 20113221  112      7322     
abr 20112111           411      
jan 201143   111      41       
out 20102    1        31111    
jul 2010     11       11111    
abr 2010111   1 2      33111    
jan 20101    1 21111  2111   1 
out 20091    114      4        
jul 20091    1 1      2        
abr 20091      2      411    11
jan 20091      1      111      
out 200811     1      322    11
jul 2008              11111    
abr 200833222   31     41111    
jan 2008222211   211    433221   
out 2007322   1161     62221    
jul 20072222211  3222   3222211  
abr 2007                       
jan 2007                       
out 2006                       
jul 2006              11       
abr 20061                      
jan 200611            21       
out 20052                      
jul 2005                       
abr 2005                       
jan 20051             1        
out 2004       1      11       

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
172100.0%2,017100.0%
33143.1%1,95797.0%
102027.8%1,89694.0%
321115.3%1,74486.5%
10045.6%1,40769.8%
31622.8%1,06452.8%

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
CessatorUC1701jun 25, 20074206jun 03, 20141671
AnankeBotUC2363set 29, 20093379set 16, 20131931
SteinninnUC3236mar 18, 20074305mar 27, 20083930
RimBotUC4107set 20, 20074119fev 24, 20103231
SamoaBotUC581abr 09, 20141726abr 15, 20141720
KamikazeBotUC655dez 17, 20102935dez 09, 20112578
Sir Nicholas de Lenfent BotUC750set 05, 20083768abr 09, 20103187
StalfurUC845dez 09, 20054769nov 27, 20064416
Dresib~iswikiquoteUC937abr 08, 20083918abr 12, 20083914
YiFeiBotUC1036ago 03, 20151245nov 29, 201831
VolkovBotUC1133jun 30, 20093470jan 18, 20132172
MerlIwBotUC1226jul 27, 20122347jun 14, 20132025
SteinninnAWBUC1325dez 21, 20074027dez 21, 20074027
KjaranUC1425mar 18, 20083939mar 20, 20083937
JóhannesbjarkiUC1519jun 13, 20112757set 11, 20112667
CarsracBotUC1612jun 05, 20103130abr 15, 20132085
AlessiaUC1712dez 26, 20102926fev 17, 20122508
LaaknorBotUC1811mai 21, 20103145jul 19, 20122355
LexusunsUC1911dez 01, 20112586nov 17, 20122234
JAnDbotUC2011ago 17, 20131961ago 28, 20131950

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 307 edições foram feitas por usuários anônimos, de um total de 2453 edições ( 12e %)
  


2 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
EleferenBotUC199fev 12, 20103243jan 05, 20132185--
AvicBotUC230jul 10, 20112730set 07, 20112671--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
dez 201827736346160814160       1
nov 201827736346160814160       1
out 201827736346160814160       1
set 201827736246160814160       1
ago 201827736246160814160       1
jul 201827736246160814160       1
jun 201827736246160814160       1
mai 201827736246160814160       1
abr 201827736246160814160       1
mar 201827736246160814160       1
fev 201827736246160814160       1
jan 201827736246160814160       1
dez 201727736246160814160       1
nov 201727736046160814160       1
out 201727736046160814160       1
set 201727736046160814160       1
ago 201727735946160814160       1
jul 201727735946160814160       1
jun 201727735946160814160       1
mai 201727635946160814160       1
abr 201727635946160814160       1
mar 201727635946160814160       1
fev 201727635946160814160       1
jan 201727635746160814160       1
dez 201627635746160814160       1
nov 201627635746160814160       1
out 201627635746160814160       1
set 201627635746160814160       1
ago 201627635746160814160       1
jul 201627635646160814160       1
jun 201627635646160814160       1
mai 201627635646160814160       1
abr 201627635546160814160       1
mar 201627635446160814160       1
fev 201627635446160814160       1
jan 201627635446160814160       1
dez 201527635446160814160       1
nov 201527635146160814160       1
out 201527635146160814160       1
set 201527635146160744160       1
ago 201527635146160744160       1
jul 201527634846160734160       1
jun 201527634746160734160       1
mai 201527634746160734160       1
abr 201527634746160734160       1
mar 201527634646160734160       1
fev 201527634646160734160       1
jan 201527634146160734160       1
dez 201427633846160734160       1
nov 201427633846160734160       1
out 201427633646160734160       1
set 201427633546160734160       1
ago 201427633246160734160       1
jul 201427532946160734160       1
jun 201427532946160734160       1
mai 201427432946160734160       1
abr 201427432846160734160       1
mar 201427332446160734160       1
fev 201427332246160734160       1
jan 201427231946160734160       1
dez 201327131546160734160       1
nov 201327131546160734160       1
out 201327031246160734160       1
set 201326930846160734160       1
ago 201326929546160734160       1
jul 201326929246160734160       1
jun 201326928846160734160       1
mai 201326928546160734160       1
abr 201326928446160734160       1
mar 201326928046160734160       1
fev 201326927546160734160       1
jan 201326926946160734160       1
dez 201226926846160734160       1
nov 201226926446160734160       1
out 201226926446160734160       1
set 201226926046160734160       1
ago 201226925746160734160       1
jul 201226925346160734160       1
jun 201226925146160734160       1
mai 201226824346160734160       1
abr 201226824146160734160       1
mar 201226823646160734160       1
fev 201226823346160734160       1
jan 201226822846160734160       1
dez 201126822246160734159       1
nov 201126821946160734159       1
out 201126820646160724159       1
set 201126820346160724159       1
ago 201126619946160724159       1
jul 201126619546160724159       1
jun 201125818646160724144       1
mai 201125618246160724143       1
abr 201125617846160724143       1
mar 201125617246160724143       1
fev 201125617146160724143       1
jan 201125516646160724143       1
dez 201025316346160724143       1
nov 201024816046160714141       1
out 201024815846159714141       1
set 201023915646159714141       1
ago 201023815146159714141       1
jul 201023813746159714141       1
jun 201023813746159714141       1
mai 201023812746159714141       1
abr 201023812746159714141       1
mar 201023512346159714141       1
fev 201023412046159684141       1
jan 201023411746159684141       1
dez 200923210546159684141       1
nov 200923210346159684141       1
out 200923210146159684141       1
set 20092329945159684141       1
ago 20092329545159684141       1
jul 20092329545159684141       1
jun 20092329345159684141       1
mai 20092329245159674141       1
abr 20092329145159674141       1
mar 20092328345159674141       1
fev 20092328145159674141       1
jan 20092297745159674141       1
dez 20082287745159674141       1
nov 20082287645159674141       1
out 20082286345159674141       1
set 20082265345159674141       1
ago 20082264645159674141       1
jul 20082264545159674141       1
jun 20082264545159674141       1
mai 20082264245159674141       1
abr 20082263845159674141       1
mar 20082253845159674141       1
fev 20082213345159664140       1
jan 20082083145159664138       1
dez 20071663144159594107       1
nov 20071582844158564102       1
out 20071552844158564102       1
set 20071532343158524102       1
ago 2007139173314341492       1
jul 20071371631 4339491        
jun 2007361516 616 34        
mai 200721107 55 7        
abr 200719107 55 7        
mar 200719107 55 7        
fev 20071887 54 7        
jan 20071787 54 7        
dez 20061787 54 2        
nov 20061787 54 2        
out 20061687 54 2        
set 20061687 54 2        
ago 20061677 54 2        
jul 20061567 54 2        
jun 20061567 54 2        
mai 20061567 54 2        
abr 20061467 54 2        
mar 20061467 54 2        
fev 20061467 53 2        
jan 20061467 53 2        
dez 20051266 52 2        
nov 2005835 4           
out 2005835 3           
set 2005635 3           
ago 2005635 3           
jul 2005635 3           
jun 2005635 3           
mai 2005535 2           
abr 2005535 2           
mar 2005534 2           
fev 2005334 2           
jan 2005233 2           
dez 2004132 2           
nov 2004132             
out 200411              
set 20041               
ago 20041               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

jan 2005: 1 1 Snorri Sturluson

mar 2005: 1 1 Gunnar á Hlíðarenda

out 2005: 1 1 Bolli Thoroddsen

dez 2005: 1 1 Guðni Ágústsson

jan 2006: 1 1 Ingvi Hrafn Jónsson

fev 2006: 1 1 Stefán Pétursson

mar 2006: 1 1 Vilhjálmur Egilsson

abr 2006: 1 1 Bolli Thoroddsen

mai 2006: 1 1 Björn Bjarnason

ago 2006: 1 1 Páll postuli

nov 2006: 1 1 Árni Johnsen

mar 2007: 1 1 Hostel

mai 2007: 1 1 The Matrix

jun 2007: 1 2 Magnús , 2 2 Alfred Jules Ayer , 3 2 René Descartes , 4 2 Ludwig Wittgenstein , 5 2 Donald Davidson , 6 1 Fíaskó

jul 2007: 1 2 Stríð , 2 2 Sódóma Reykjavík , 3 2 Guð , 4 2 Demókrítos , 5 2 Óðal feðranna , 6 2 Evripídes , 7 2 Árni Johnsen , 8 2 Björn Bjarnason , 9 2 Guðni Ágústsson , 10 2 Ólafur Ragnar Grímsson , 11 2 Steingrímur J. Sigfússon , 12 1 List

ago 2007: 1 2 Nói albinói , 2 2 Friedrich Nietzsche , 3 2 Willard Van Orman Quine , 4 2 Óðal feðranna

set 2007: 1 2 Djöflaeyjan , 2 2 Löggulíf , 3 2 Óðal feðranna , 4 2 Sannleikur , 5 1 Í takt við tímann

out 2007: 1 1 Maður eins og ég

nov 2007: 1 2 Einkalíf , 2 2 Kaldaljós , 3 1 Tár úr steini

dez 2007: 1 2 Veggfóður , 2 2 Tár úr steini , 3 2 Stella í orlofi , 4 2 Íslenskar kvikmyndir , 5 2 Sódóma Reykjavík , 6 1 Konungur ljónanna

jan 2008: 1 2 Hjónaband , 2 2 Heimska , 3 2 Æska , 4 2 Menntun , 5 2 Örlög , 6 2 Biblían , 7 1 Óli Björn Kárason

fev 2008: 1 1 Líf

mar 2008: 1 2 Tiberius , 2 1 Tíberíus

abr 2008: 1 2 Leonid Brezhnev , 2 2 Winston Churchill , 3 2 Biblían , 4 1 Dr. Vilhjálmur Egilsson

mai 2008: 1 1 Oscar Wilde

set 2008: 1 1 Karl Sigurbjörnsson

out 2008: 1 1 Hildur Helga Sigurðardóttir

nov 2008: 1 1 Fegurð

dez 2008: 1 1 Stella í orlofi

jan 2009: 1 1 Jónas Jónsson frá Hriflu

fev 2009: 1 1 Þorvaldur Gylfason

mar 2009: 1 1 Albert Einstein

abr 2009: 1 1 Hippókrates

jun 2009: 1 1 Jónas Jónsson frá Hriflu

jul 2009: 1 1 Hannibal Barca

ago 2009: 1 1 Sam Harris

set 2009: 1 1 Leonid Brezhnev

out 2009: 1 1 Jósef Stalín

jan 2010: 1 1 Gísli Marteinn Baldursson

fev 2010: 1 1 Oddný Sturludóttir

mar 2010: 1 1 Sóley Tómasdóttir

abr 2010: 1 1 Lárus Welding

ago 2010: 1 1 Richard Dawkins

set 2010: 1 1 Brennu-Njáls saga

out 2010: 1 1 Daniel Dennett

nov 2010: 1 1 John F. Kennedy

dez 2010: 1 2 Virgill , 2 1 Steinn Steinarr

jan 2011: 1 1 Örn Bárður Jónsson

fev 2011: 1 1 Afrísk orðatiltæki

mar 2011: 1 2 Lev Tolstoj , 2 1 Samfélag

abr 2011: 1 2 Fegurð , 2 1 Horatius

mai 2011: 1 1 Mohandas Gandhi

jun 2011: 1 1 Vladimir Kramnik

jul 2011: 1 2 Benjamín H. J. Eiríksson , 2 2 Publius Syrus , 3 2 Siglingar

ago 2011: 1 1 Horatius

set 2011: 1 1 Freyja

out 2011: 1 1 Publius Syrus

nov 2011: 1 1 Dave Barry

dez 2011: 1 2 Vinátta , 2 1 Fegurð

jan 2012: 1 1 Leonid Brezhnev

fev 2012: 1 2 Skoskir málshættir , 2 2 Afrísk orðatiltæki , 3 2 Zenon frá Kítíon

mar 2012: 1 1 Mohandas Gandhi

abr 2012: 1 1 Marteinn Lúther

jul 2012: 1 1 Kúrdískir málshættir

ago 2012: 1 1 Vísindi

set 2012: 1 1 Frelsi

out 2012: 1 1 Jósef Stalín

nov 2012: 1 1 Frank Sinatra

dez 2012: 1 1 Hamingja

jan 2013: 1 2 Virgill , 2 1 Aristófanes

fev 2013: 1 1 Brennu-Njáls saga

mar 2013: 1 1 Albert Einstein

abr 2013: 1 1 Gísla saga Súrssonar

mai 2013: 1 1 Tungubrjótar

jun 2013: 1 1 Publius Syrus

ago 2013: 1 1 Mohandas Gandhi

set 2013: 1 1 John F. Kennedy

nov 2013: 1 1 Friedrich Nietzsche

fev 2014: 1 1 Bjarni Benediktsson (f. 1970)

mar 2014: 1 1 Konungur ljónanna

abr 2014: 1 2 Jósef Stalín , 2 2 Menntun , 3 1 Benedikt Sveinbjarnarson Gröndal

jun 2014: 1 1 Sveinbjörg Birna Sveinbjörnsdóttir

jan 2015: 1 1 Arkímedes

jun 2015: 1 1 Oscar Wilde

set 2015: 1 1 Sextos Empeirikos

mai 2016: 1 1 Aristóteles

jun 2017: 1 1 Mohammad Khatami

nov 2017: 1 1 Horatius

dez 2017: 1 1 Jerry Fodor

mai 2018: 1 1 Þorsteinn Pálsson

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file iswikiquote-20190101-stub-meta-history.xml.gz (edits only), size 419 kb as gz -> 2.8 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:15 after 5 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.