Estatísticas da Wikiquote curdo

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jul 2018+4%   0%        () 0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201826   336 11,5 2    ( ) 76
nov 201826   335 11,6 1    ( ) 76
out 201826   335 11,6 1    ( ) 76
set 201826   335 11,6      ( ) 76
ago 201826   335 11,6      ( ) 76
jul 20182611 335 11,6 11    ( ) 76
jun 201825   335 11,5      ( ) 76
mai 201825   335 11,5      ( ) 76
abr 201825   335 11,5      ( ) 76
mar 201825 1 335 11,5 14    ( ) 76
fev 201825   335 11,5      ( ) 76
jan 201825   335 11,5 1    ( ) 76
dez 201725   335 11,5      ( ) 76
nov 201725   335 11,5 5    ( ) 76
out 201725 1 335 11,5 14    ( ) 76
set 201725   335 11,4 2    ( ) 76
ago 201725   335 11,4      ( ) 76
jul 201725   335 11,4      ( ) 76
jun 201725   335 11,4      ( ) 76
mai 201725   335 11,4      ( ) 76
abr 201725   335 11,4      ( ) 76
mar 201725   335 11,4      ( ) 76
fev 201725   335 11,4 2    ( ) 76
jan 201725   334 11,5 8    ( ) 76
dez 201625   332 11,5      ( ) 76
nov 201625   332 11,5      ( ) 76
out 201625   332 11,5      ( ) 76
set 201625   332 11,5      ( ) 76
ago 201625   332 11,5      ( ) 76
jul 201625   332 11,5 2    ( ) 76
jun 201625 1 332 11,5 7    ( ) 76
mai 201625   331 11,5 1    ( ) 76
abr 201625   331 11,5      ( ) 76
mar 201625   331 11,5 1    ( ) 76
fev 201625   330 11,5      ( ) 76
jan 201625   330 11,5      ( ) 76
dez 201525   330 11,5      ( ) 76
nov 201525   330 11,5 3    ( ) 76
out 201525   329 11,6      ( ) 76
set 201525   329 11,6 2    ( ) 76
ago 2015251  329 11,6 52    ( ) 76
jul 201524   327 11,5 4    ( ) 76
jun 201524 1 327 11,5 8    ( ) 76
mai 201524   326 11,5 1    ( ) 76
abr 201524   326 11,5 2    ( ) 76
mar 201524   326 11,5      ( ) 76
fev 201524   326 11,5      ( ) 76
jan 201524   326 11,5 2    ( ) 76
dez 201424   326 11,5      ( ) 76
nov 201424   326 11,5 6    ( ) 76
out 201424   326 11,4 1    ( ) 76
set 201424   326 11,4 1    ( ) 76
ago 201424   326 11,4 2    ( ) 76
jul 201424   326 11,4 1    ( ) 76
jun 201424   326 11,4 3    ( ) 76
mai 201424   325 11,4 2    ( ) 76
abr 20142421 325 11,4 166    ( ) 76
mar 201422 1 325 10,9 32    ( ) 76
fev 201422   324 10,9      ( ) 76
jan 201422   324 10,9 1    ( ) 76
dez 201322   324 10,9      ( ) 76
nov 201322   324 10,9 5    ( ) 76
out 201322   324 10,8      ( ) 76
set 201322 1 324 10,8 22    ( ) 76
ago 20132211 324 10,8 23    ( ) 76
jul 201321   324 10,7      ( ) 76
jun 201321 1 324 10,7 59    ( ) 76
mai 201321   324 10,5 4    ( ) 76
abr 201321 2 324 10,5 15    ( ) 76
mar 201321   324 10,5 2    ( ) 76
fev 201321 1 324 10,5 14    ( ) 76
jan 201321 1 323 10,4 71    ( ) 76
dez 201221   323 10,2 5    ( ) 76
nov 2012211  323 10,2 14    ( ) 76
out 201220   323 10,2 33    ( ) 75
set 201220   321 10,1 24    ( ) 75
ago 201220   321 10,1 21    ( ) 75
jul 2012201  321 10 63    ( ) 75
jun 201219   321 9,8 23    ( ) 75
mai 201219   321 9,7 18    ( ) 75
abr 201219 1 321 9,7 50    ( ) 75
mar 20121911 321 9,5 6    ( ) 75
fev 201218 1 321 9,5 35    ( ) 75
jan 20121811 321 9,4 28    ( ) 75
dez 20111712 321 9,3 16    ( ) 75
nov 201116 2 321 9,2 28    ( ) 75
out 20111612 320 9,2 88    ( ) 75
set 201115 1 320 8,9 19    ( ) 75
ago 201115 1 320 8,8 23    ( ) 75
jul 201115 1 320 8,8 60    ( ) 75
jun 201115   320 8,6 1    ( ) 75
mai 201115   320 8,6 3    ( ) 75
abr 201115 2 320 8,6 72    ( ) 75
mar 20111522 320 8,4 71    ( ) 75
fev 201113 2 320 8,1 20    ( ) 75
jan 201113   320 8,1 25    ( ) 75
dez 201013 2 320 8 41    ( ) 75
nov 201013   319 7,9 63    ( ) 75
out 20101312 319 7,7 34    ( ) 75
set 2010121  319 7,6 26    ( ) 75
ago 201011   318 7,5 26    ( ) 75
jul 201011   318 7,4 29    ( ) 75
jun 201011   318 7,4 21    ( ) 75
mai 201011   318 7,3 14    ( ) 75
abr 201011   317 7,3 32    ( ) 75
mar 201011   317 7,2 35    ( ) 75
fev 201011 2 317 7,1 51    ( ) 75
jan 201011   316 6,9 10    ( ) 75
dez 200911   315 6,9 14    ( ) 75
nov 20091121 315 6,9 35    ( ) 75
out 20099   314 6,8 125    ( ) 75
set 200991  314 6,4 53    ( ) 75
ago 20098   314 6,2 7    ( ) 75
jul 200981  314 6,2 6    ( ) 75
jun 20097   314 6,2 20    ( ) 75
mai 200971  314 6,1 56    ( ) 75
abr 20096   314 5,9 39    ( ) 75
mar 20096 1 313 5,8 46    ( ) 75
fev 20096   313 5,7 4    ( ) 75
jan 20096   313 5,7 15    ( ) 75
dez 20086   313 5,6 26    ( ) 75
nov 20086   313 5,5 7    ( ) 75
out 20086   313 5,5 17    ( ) 75
set 200861  313 5,4 56    ( ) 75
ago 20085   313 5,3 16    ( ) 75
jul 20085   313 5,2      ( ) 75
jun 20085   313 5,2 2    ( ) 75
mai 20085   313 5,2 51    ( ) 75
abr 20085   313 5 21    ( ) 75
mar 20085   313 5 27    ( ) 75
fev 20085   313 4,9 29    ( ) 75
jan 20085   313 4,8 43    ( ) 75
dez 20075   313 4,7 10    ( ) 75
nov 20075   313 4,6 35    ( ) 75
out 20075   313 4,5 109    ( ) 75
set 20075   313 4,2 125    ( ) 75
ago 20075   313 3,8 6    ( ) 75
jul 20075   313 3,8 5    ( ) 75
jun 20075   313 3,7 3    ( ) 75
mai 20075   313 3,7 1    ( ) 75
abr 2007511 313 3,7 18    ( ) 75
mar 20074   312 3,7 14    ( ) 73
fev 20074 1 312 3,6 9    ( ) 73
jan 20074   312 3,6 5    ( ) 73
dez 20064   311 3,6 3    ( ) 73
nov 20064   311 3,6      ( ) 73
out 20064   311 3,6 9    ( ) 73
set 20064   311 3,6 21    ( ) 73
ago 20064 1131153,5 404    ( ) 73
jul 20064 2 157 4,4 23    ( ) 69
jun 20064 1 150 4,4 8    ( ) 68
mai 20064   150 4,3 1    ( ) 67
abr 20064   150 4,3      ( ) 67
mar 20064   150 4,3 3    ( ) 67
fev 2006422215054,3 571    ( ) 67
jan 20062   12 6,4 4    ( ) 4
dez 20052   12 6,1      ( ) 4
nov 20052   12 6,1      ( ) 4
out 20052   12 6,1      ( ) 4
set 20052   12 6,1      ( ) 4
ago 20052   12 6,1      ( ) 4
jul 20052   12 6,1 9    ( ) 4
jun 20052   12 5,3      ( ) 4
mai 20052   12 5,3 2    ( ) 4
abr 20052   12 5,2 2    ( ) 4
mar 20052   12 5 1    ( ) 4
fev 20052   12 4,9 1    ( ) 4
jan 20052   12 4,8      ( ) 4
dez 20042   12 4,8 2    ( ) 4
nov 20042   12 4,7 2    ( ) 4
out 20042   12 4,5 6    ( ) 4
set 2004221 12 4 48    ( ) 4
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  5  10  1  3  5  10  25  100  5  10 
dez 20181                    
nov 20181            1       
out 20181            2       
set 2018                     
ago 2018                     
jul 20181111          1       
jun 2018                     
mai 2018                     
abr 2018             1       
mar 20181111          1111    
fev 2018                     
jan 20181                    
dez 2017        1    11      
nov 201721                   
out 20172111          111     
set 20171            1       
ago 2017                     
jul 2017             1111    
jun 2017             21111   
mai 2017                   1 
abr 2017             1       
mar 2017                     
fev 20171            2       
jan 20171            1       
out 20181            2       
jul 20181111          1       
abr 2018             1       
jan 20181                    
out 20172111          111     
jul 2017             1111    
abr 2017             1       
jan 20171            1       
out 2016                     
jul 2016                     
abr 2016             1       
jan 2016                     
out 2015                   1 
jul 201511      1    1       
abr 2015           221       
jan 20151       11   31      
out 20141            2       
jul 20141                    
abr 201441111 11      4     11
jan 20141       1    31      
out 2013        1    411     
jul 2013             4       
abr 2013222           51      
jan 201341111 11 1    31      
out 2012     22      41      
jul 20121    22 1    41    11
abr 2012211   11 11   311     
jan 20125111          821     
out 201154211         6       
jul 20113111  11 1    71      
abr 201132222         42211   
jan 201131   11      3       
out 20102221  11      411     
jul 2010     11              
abr 20101    21      11      
jan 20101       1    2211    
out 20092    1111    1       
jul 20091            2       
abr 20091    11 1    311     
jan 2009     1       111     
out 2008     21 1    222     
jul 2008                     
abr 2008     11 1    2       
jan 20081    11      21      
out 20071    1112    2       
jul 2007                     
abr 20071111     1    11      
jan 200711                   
out 20061                    
jul 20063221     2    1       
abr 2006             1       
jan 20061       1            
out 2005                     
jul 2005                     
abr 2005             1       
jan 2005                     
out 2004                     

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
186100.0%2,692100.0%
34350.0%2,62997.7%
102529.1%2,51793.5%
321214.0%2,26284.0%
10044.7%1,74664.9%
31622.3%1,53457.0%

 

1 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
StellaWpc1511672UC86...11--dez 31, 2018 11--

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
FerhengvanUC1858fev 10, 20064706jan 09, 20074373
AnankeBotUC2676dez 18, 20083664set 15, 20131932
KamikazeBotUC3109dez 17, 20102935dez 09, 20112578
ThomasUC4103fev 10, 20064706out 02, 20064472
ŞêrUC598out 28, 20102985jun 29, 2016914
SamoaBotUC697abr 09, 20141726abr 15, 20141720
DexbotUC764abr 11, 20141724abr 18, 20141717
GhybuUC860out 29, 20112619mar 24, 2018281
MerlIwBotUC957jul 26, 20122348jun 14, 20132025
YiFeiBotUC1054ago 04, 20151244out 02, 2017454
Erdal RonahiUC1144set 13, 20045221nov 11, 20045162
Sir Nicholas de Lenfent BotUC1242set 05, 20083768abr 10, 20103186
ArthurBotUC1330nov 12, 20093335mar 12, 20103215
BanginUC1428fev 10, 20074341jan 29, 20083988
CarsracBotUC1528mar 19, 20112843abr 15, 20132085
LaaknorBotUC1625dez 15, 20093302jan 15, 20132175
JAnDbotUC1723ago 17, 20131961ago 28, 20131950
Idioma-botUC1821jan 01, 20122555jan 22, 20132168
MjbmrbotUC1920fev 09, 20112881mar 28, 20112834
VolkovBotUC2019jun 30, 20093470mar 15, 20103212

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 250 edições foram feitas por usuários anônimos, de um total de 3879 edições ( 6e %)
  


4 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
ChtitBotUC1649set 08, 20074131fev 15, 20103240--
EleferenBotUC2224fev 13, 20103242jan 13, 20132177--
AvicBotUC359jul 10, 20112730set 07, 20112671--
DinybotUC45mar 25, 20074298mar 25, 20074298--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
dez 2018412363811079 118       1
nov 2018411363811079 118       1
out 2018411363811079 118       1
set 2018411362811079 118       1
ago 2018411362811079 118       1
jul 2018411362811079 118       1
jun 2018411362811079 118       1
mai 2018411362811079 118       1
abr 2018411362811079 118       1
mar 2018411362811079 118       1
fev 2018411362711079 116       1
jan 2018411362711079 116       1
dez 2017411362711079 116       1
nov 2017411360711079 116       1
out 2017411360711079 116       1
set 2017411360711078 116       1
ago 2017411359711078 116       1
jul 2017411359711078 116       1
jun 2017411359711078 105       1
mai 2017411359711078 61       1
abr 2017411359711078 61       1
mar 2017411359711078 61       1
fev 2017411359711078 61       1
jan 2017410357711078 61       1
dez 2016408356711078 61       1
nov 2016408354711078 61       1
out 2016408354711078 61       1
set 2016408354711078 61       1
ago 2016408354711078 61       1
jul 2016408353711078 61       1
jun 2016408353711078 61       1
mai 2016407353711078 58       1
abr 2016407352711078 58       1
mar 2016407351711078 58       1
fev 2016406351711078 58       1
jan 2016406351711078 58       1
dez 2015406351711078 58       1
nov 2015406348711078 58       1
out 2015405347711078 58       1
set 2015405347711071 58       1
ago 2015405347711071 58       1
jul 2015403347711070 58       1
jun 2015403346711070 58       1
mai 2015402346711070 58       1
abr 2015402346711070 58       1
mar 2015402345711070 58       1
fev 2015402345711070 58       1
jan 2015402340711070 58       1
dez 2014402336711070 58       1
nov 2014402336711070 58       1
out 2014402333711070 58       1
set 2014402332711070 58       1
ago 2014402329711070 58       1
jul 2014402326711070 58       1
jun 2014402326711070 58       1
mai 2014401326711070 58       1
abr 2014401325711070 58       1
mar 2014401322711070 58       1
fev 2014400319711070 58       1
jan 2014400316711070 58       1
dez 2013400311711070 58       1
nov 2013400311711070 58       1
out 2013400308711070 58       1
set 2013400304711070 58       1
ago 2013400291711070 58       1
jul 2013400287611070 58       1
jun 2013400285611070 58       1
mai 2013400283611069 58       1
abr 2013400281611069 58       1
mar 2013400278611069 58       1
fev 2013400273611069 58       1
jan 201339926441726 41       1
dez 201239926341726 41       1
nov 201239925841726 41       1
out 201239825841726 41       1
set 201239625441726 41       1
ago 201239625141726 41       1
jul 201239624841726 41       1
jun 201239624641726 41       1
mai 201239623841526 41       1
abr 201239623541526 41       1
mar 201239622941526 41       1
fev 201239622641526 41       1
jan 201239622041526 41       1
dez 201139621341426 41       1
nov 201139621041426 41       1
out 201139519941425 41       1
set 201139519541425 40       1
ago 201139519241425 40       1
jul 201139518941425 40       1
jun 201139518041425 39       1
mai 201139517641425 39       1
abr 201139517241425 39       1
mar 201139516541413 10       1
fev 201139516441413 10       1
jan 201139515941413 10       1
dez 201039515641413 10       1
nov 201039415341413 10       1
out 201039415141313 10       1
set 201039414741312 6       1
ago 201039314241312 6       1
jul 201039312841312 6       1
jun 201039312841312 6       1
mai 201039311941312 6       1
abr 201039211941312 6       1
mar 201039211641312 6       1
fev 201039211241312 6       1
jan 201039110841312 6       1
dez 2009390974 312 6        
nov 2009390954 312 6        
out 2009389924 312 6        
set 2009389923 312 6        
ago 2009389883 312 6        
jul 2009389883 312 6        
jun 2009389863 312 6        
mai 2009389853 311 6        
abr 2009389843 311 6        
mar 2009388763 311 6        
fev 2009388743 311 6        
jan 2009388703 311 6        
dez 2008388703 311 6        
nov 2008388673 311 6        
out 2008388553 311 6        
set 2008388463 311 6        
ago 2008388363 311 6        
jul 2008388363 311 6        
jun 2008388363 311 6        
mai 2008388323 311 6        
abr 2008388283 311 6        
mar 2008388263 311 6        
fev 2008388243 311 6        
jan 2008388233 311 6        
dez 2007388233 38 6        
nov 2007388183 38 6        
out 2007388163 38 6        
set 2007388153 38 6        
ago 2007388133 38 6        
jul 2007388133 38 6        
jun 2007388133 38 6        
mai 2007388133 38 6        
abr 2007388133 37 6        
mar 2007385133 36 6        
fev 2007385113 36 6        
jan 200738593 35 6        
dez 200638493 35 6        
nov 200638483 35 6        
out 200638483 35 6        
set 200638482 35 6        
ago 200638472 35 6        
jul 20062267  35 5        
jun 20062186  34 5        
mai 20062176  34 5        
abr 20062176  34 5        
mar 20062175  34 5        
fev 20062174  34 5        
jan 2006163  32 1        
dez 2005163  32 1        
nov 2005161  32 1        
out 2005161  32 1        
set 2005161  32          
ago 2005161  32          
jul 2005161  32          
jun 2005161  32          
mai 2005161  32          
abr 2005161  32          
mar 2005161  31          
fev 2005161  31          
jan 2005161  31          
dez 2004161  31          
nov 2004161  31          
out 2004161  31          
set 2004161  31          

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2004: 1 2 Destpêk , 2 1 Gotinên pêşiyan (E)

nov 2004: 1 1 Gotinên pêşiyan F-M

jan 2006: 1 1 Destpêk

fev 2006: 1 2 Dukê Windsorê , 2 2 Elbert Hubbard , 3 2 Herbert Spencer , 4 2 John Fowles , 5 2 Malcolm de Chazal , 6 2 Jim Backus , 7 2 Joey Adams , 8 2 Gabriel Maurier , 9 2 George Gibbs , 10 2 Henry Louis Mencken , 11 2 Georg Christoph Lichtenberg , 12 2 Rudyard Kipling , 13 2 George Bernard Shaw , 14 2 Edgar Watson Howe , 15 2 Joseph Joubert , 16 2 Thomas Dewar , 17 2 Leonard Levinson , 18 2 Charlotte Whitton , 19 2 Eva Seaberg , 20 2 Mary Lombard , 21 2 Marcel Achard , 22 2 Golda Meir , 23 2 Juvenalis , 24 2 Clark Gable , 25 2 Dante Alighieri

mar 2006: 1 1 Publilius Syrus

jun 2006: 1 1 Pendên frensî

jul 2006: 1 2 Destpêk , 2 1 Serûpel

ago 2006: 1 1 Keç

set 2006: 1 1 Rudyard Kipling

out 2006: 1 1 Isokrates

dez 2006: 1 1 Voltaire

jan 2007: 1 1 Ruth Ann Schabacker

fev 2007: 1 1 Albert Schweitzer

mar 2007: 1 1 Isokrates

abr 2007: 1 1 Benjamin Franklin

jun 2007: 1 1 Alfred de Vigny

ago 2007: 1 1 Marcus Aurelius

out 2007: 1 1 Dayik

nov 2007: 1 1 Bertîl

dez 2007: 1 1 Ralph Waldo Emerson

jan 2008: 1 1 Pendên farisî

mai 2008: 1 1 Oscar Wilde

mar 2009: 1 1 Jorge Luis Borges

abr 2009: 1 1 Jonathan Swift

mai 2009: 1 1 Aştî

jun 2009: 1 1 Robert Louis Stevenson

jul 2009: 1 1 Elmanya

out 2009: 1 1 Şeytan

nov 2009: 1 1 Cesare Pavese

jan 2010: 1 1 Albert Einstein

fev 2010: 1 2 Peyamber (pirtûk) , 2 2 Kêf û zewq , 3 1 Mahatma Gandhi

mar 2010: 1 1 Niccolò Machiavelli

abr 2010: 1 1 Anton Çexov

mai 2010: 1 1 Kafka

ago 2010: 1 1 Vincent Van Gogh

set 2010: 1 1 Rudyard Kipling

out 2010: 1 1 Mahatma Gandhi

nov 2010: 1 1 Kurdish Proverbs

dez 2010: 1 2 Abraham Lincoln , 2 1 Caesar Augustus

jan 2011: 1 1 Siyaset

fev 2011: 1 2 Thomas A. Edison , 2 1 Bêhişî

mar 2011: 1 2 Erk , 2 2 Pendên çînî , 3 2 Thomas A. Edison , 4 2 Stanislaw Jerzy Lec , 5 1 Aştî

abr 2011: 1 2 Charlie Chaplin , 2 2 Pendên çînî , 3 2 Søren Kierkegaard , 4 2 Jean-Paul Sartre , 5 2 Mixayîl Bakunîn , 6 1 Benjamin Franklin

mai 2011: 1 1 Jules Michelet

jul 2011: 1 1 Fyodor Dostoyevskî

ago 2011: 1 1 Huner

set 2011: 1 1 Benjamin Franklin

out 2011: 1 3 Jean-Jacques Rousseau , 2 2 Şeytan , 3 2 Neil Armstrong , 4 2 Marcel Achard , 5 2 Ernest Hemingway , 6 2 Pendên çînî , 7 1 Caesar Augustus

nov 2011: 1 2 Charlotte Whitton , 2 1 Brian Aldiss

dez 2011: 1 2 Dostanî , 2 1 Huner

jan 2012: 1 2 Antoine de Saint-Exupéry , 2 1 Elmanya

fev 2012: 1 2 Thomas Paine , 2 1 Futbol

mar 2012: 1 1 Mahatma Gandhi

abr 2012: 1 1 Şev

jun 2012: 1 1 Johann Wolfgang von Goethe

jul 2012: 1 1 Quran

nov 2012: 1 2 Groucho Marx , 2 1 Rojhat seid

dez 2012: 1 1 Fyodor Dostoyevskî

jan 2013: 1 2 Vergilius , 2 1 Keç

fev 2013: 1 1 Broken/Rêveber

mar 2013: 1 1 Nezanî

abr 2013: 1 1 Ronahî ji dilekî bo dilan

mai 2013: 1 2 Juvenalis

jun 2013: 1 2 Musa Anter , 2 1 Caesar Augustus

ago 2013: 1 1 Mahatma Gandhi

set 2013: 1 1 Aştî

nov 2013: 1 1 Gulistan

jan 2014: 1 1 Xebat

mar 2014: 1 1 Mao Zedong

abr 2014: 1 1 Mao Zedong

mai 2014: 1 1 Dêbav

jun 2014: 1 1 Bertolt brecht

jul 2014: 1 1 Yaşar Kemal

ago 2014: 1 1 Konfuçe

set 2014: 1 1 Musa Anter

out 2014: 1 1 Mark Twain

jan 2015: 1 1 Charlie Chaplin

mai 2015: 1 1 Plutarkhos

jun 2015: 1 2 Seyyîd Qutub , 2 2 Oscar Wilde

jul 2015: 1 1 Alexander Sutherland Neill

ago 2015: 1 1 Barış Manço

set 2015: 1 1 Celadet Bedîrxan

nov 2015: 1 1 Adolf Hitler

jun 2016: 1 1 Steve Jobs

jan 2017: 1 1 Berthold Auerbach

fev 2017: 1 1 US708

set 2017: 1 1 Mahatma Gandhi

out 2017: 1 2 Fyodor Dostoyevskî , 2 1 Adolf Hitler

nov 2017: 1 1 Seyyîd Qutub

jan 2018: 1 1 Napoleon Bonaparte

mar 2018: 1 1 Jean de La Fontaine

jul 2018: 1 1 Mustafa Kemal Atatürk

out 2018: 1 1 Adolf Hitler

nov 2018: 1 1 Adolf Hitler

dez 2018: 1 1 Emergency Relief From Lockouts By Locksmiths

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file kuwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 356 kb as gz -> 2.4 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:15 after 4 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.