Estatísticas da Wikiquote romeno
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here
 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions

 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2018+1%   +1%        () 0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201871   525 17,8 1    ( ) 98
nov 201871   524 17,9 2    ( ) 98
out 201871 1 524 17,9 11    ( ) 98
set 201871   522 17,9 5    ( ) 98
ago 20187111 521 17,9 26    ( ) 98
jul 201870   515 18,1      ( ) 98
jun 201870 1 515 18,1 10    ( ) 98
mai 201870 1 511 18,2 10    ( ) 98
abr 201870   511 18,2 2    ( ) 98
mar 201870   511 18,2 8    ( ) 98
fev 201870   511 18,2 2    ( ) 98
jan 201870   511 18,2 4    ( ) 98
dez 201770   510 18,2 2    ( ) 98
nov 201770 2 510 18,2 18    ( ) 98
out 201770   509 18,2 3    ( ) 98
set 201770   509 18,2 3    ( ) 98
ago 201770   509 18,2 1    ( ) 98
jul 201770   509 18,2 1    ( ) 98
jun 20177011 508 18,2 33    ( ) 98
mai 201769   507 18,2 4    ( ) 98
abr 201769 1 507 18,2 7    ( ) 98
mar 2017691  507 18,2 12    ( ) 98
fev 201768 1 507 18,1 31    ( ) 98
jan 201768 3 504 18,2 24    ( ) 98
dez 201668 1 502 18,2 37    ( ) 98
nov 201668 1 497 18,3 25    ( ) 98
out 201668 1 496 18,3 57    ( ) 98
set 201668 1 487 18,5 25    ( ) 98
ago 20166812 484 18,6 41    ( ) 98
jul 201667 1 480 18,7 39    ( ) 97
jun 201667 2 478 18,7 26    ( ) 96
mai 201667 1 473 18,8 9    ( ) 95
abr 201667 3 470 18,9 33    ( ) 95
mar 201667 1 464 19,1 8    ( ) 94
fev 201667 1 464 19,1 14    ( ) 94
jan 201667 1 464 19 57    ( ) 94
dez 201567131456119,2 439    ( ) 94
nov 201566 41418 19,9 257    ( ) 94
out 20156623 405 19,9 44    ( ) 91
set 201564   402 20 12    ( ) 90
ago 20156412 402 20 54    ( ) 90
jul 201563 1 400 19,9 12    ( ) 90
jun 201563   400 19,9 4    ( ) 90
mai 201563   399 19,9 5    ( ) 90
abr 201563 1 399 19,9 6    ( ) 90
mar 201563   399 19,9 10    ( ) 90
fev 201563 1 399 19,9 11    ( ) 90
jan 2015631  399 19,8 10    ( ) 90
dez 201462   397 19,9 9    ( ) 89
nov 201462   396 19,9 6    ( ) 89
out 201462 1 396 19,9 31    ( ) 89
set 201462   396 19,9 7    ( ) 89
ago 201462 1 396 19,8 23    ( ) 89
jul 20146213 394 19,9 49    ( ) 89
jun 201461 2 391 19,9 22    ( ) 89
mai 20146111 391 19,8 30    ( ) 89
abr 20146021 391 19,8 203    ( ) 89
mar 201458   390 19,3 5    ( ) 89
fev 201458   390 19,3 13    ( ) 89
jan 201458   389 19,3 5    ( ) 89
dez 201358   389 19,3 5    ( ) 89
nov 201358   389 19,3 2    ( ) 89
out 201358   389 19,3 9    ( ) 89
set 20135812 389 19,3 40    ( ) 89
ago 20135711 388 19,2 24    ( ) 89
jul 201356 1 388 19,1 13    ( ) 89
jun 201356 1 386 19,2 51    ( ) 89
mai 201356   386 19,1 6    ( ) 89
abr 201356 3 386 19,1 31    ( ) 88
mar 201356   385 19 9    ( ) 87
fev 201356 1 384 19 36    ( ) 87
jan 20135634 384 19 134    ( ) 87
dez 20125311 379 18,9 17    ( ) 86
nov 201252   377 18,9 8    ( ) 86
out 201252   376 18,9 33    ( ) 86
set 201252   374 18,9 26    ( ) 85
ago 201252   374 18,9 24    ( ) 85
jul 20125211 374 18,8 62    ( ) 85
jun 201251   373 18,7 26    ( ) 82
mai 201251   372 18,7 28    ( ) 82
abr 201251 1 371 18,7 43    ( ) 82
mar 20125111 369 18,6 12    ( ) 82
fev 20125022 369 18,6 43    ( ) 82
jan 20124813 369 18,5 29    ( ) 82
dez 201147 4 368 18,5 55    ( ) 82
nov 201147 2 364 18,5 48    ( ) 82
out 201147 2 362 18,5 98    ( ) 82
set 20114712 361 18,3 37    ( ) 82
ago 201146 1 360 18,2 33    ( ) 81
jul 20114612 359 18,2 62    ( ) 81
jun 2011452  355 18,2 18    ( ) 81
mai 201143   353 18,3 36    ( ) 80
abr 201143 2 349 18,4 60    ( ) 80
mar 20114322 345 18,4 76    ( ) 80
fev 201141 1 343 18,3 63    ( ) 80
jan 201141251339118,3 569    ( ) 80
dez 20103913 322 17,5 96    ( ) 53
nov 20103811 307 18,1 55    ( ) 52
out 201037   303 18,1 23    ( ) 52
set 201037   303 18 17    ( ) 52
ago 20103711 303 18 39    ( ) 52
jul 201036   299 18,1 30    ( ) 52
jun 20103623 298 18,1 76    ( ) 52
mai 201034 3 284 18,7 46    ( ) 49
abr 201034   280 18,8 34    ( ) 48
mar 201034   278 18,8 42    ( ) 48
fev 201034 1 278 18,6 54    ( ) 48
jan 20103412 277 18,5 72    ( ) 47
dez 200933   275 18,4 29    ( ) 46
nov 200933   275 18,3 39    ( ) 46
out 20093325 275 18,1 202    ( ) 46
set 20093111 266 18 77    ( ) 46
ago 200930 3 265 17,8 53    ( ) 46
jul 20093012 264 17,6 44    ( ) 46
jun 20092914 263 17,5 78    ( ) 46
mai 20092811 261 17,4 96    ( ) 46
abr 20092713 260 17,1 103    ( ) 46
mar 20092613 252 17,2 86    ( ) 44
fev 200925 1 250 17 39    ( ) 44
jan 20092514 249 16,9 136    ( ) 44
dez 200824 1 247 16,5 66    ( ) 44
nov 200824 1 247 16,2 41    ( ) 44
out 200824 1 247 16,1 41    ( ) 44
set 200824 2 245 16 302    ( ) 44
ago 200824 1 240 15,1 83    ( ) 39
jul 20082412 239 14,8 55    ( ) 37
jun 20082311 236 14,8 20    ( ) 37
mai 200822 2 236 14,7 86    ( ) 37
abr 200822 2 233 14,5 66    ( ) 37
mar 200822 2 230 14,4 69    ( ) 36
fev 20082212 227 14,3 202    ( ) 36
jan 200821 2 225 13,5 173    ( ) 36
dez 20072123 222 12,9 183    ( ) 35
nov 200719   220 12,2 129    ( ) 34
out 20071912 220111,6 105    ( ) 34
set 200718   190 12,9 16    ( ) 34
ago 200718 1 190 12,8 18    ( ) 34
jul 200718 1 190 12,7 25    ( ) 32
jun 200718 2 187 12,8 36    ( ) 31
mai 20071813 183 12,9 70    ( ) 31
abr 20071724 170 13,5 198    ( ) 31
mar 20071513 166 12,6 239    ( ) 30
fev 200714 2 156 11,9 141    ( ) 23
jan 20071423 145 11,8 145    ( ) 22
dez 200612 1 135 11,6 108    ( ) 16
nov 20061212 134 10,9 355    ( ) 16
out 200611 1 131 8,4 75    ( ) 14
set 200611 2 130 7,9 54    ( ) 14
ago 20061112 127 7,7 93    ( ) 14
jul 20061023 123 7,1 55    ( ) 14
jun 20068   117 7 20    ( ) 14
mai 20068 1 116 6,9 48    ( ) 14
abr 20068 4 109 6,9 66    ( ) 14
mar 20068 4 10316,7 114    ( ) 14
fev 2006825 8217 228    ( ) 12
jan 2006624 57 6,1 95    ( ) 8
dez 2005412 42 6 38    ( ) 6
nov 20053 1 37 5,8 24    ( ) 6
out 20053   35 5,5 33    ( ) 6
set 20053 1 30 5,3 13    ( ) 6
ago 2005311 29 5 22    ( ) 5
jul 20052 1 29 4,2 10    ( ) 4
jun 20052 1 29 3,9 12    ( ) 4
mai 20052 1 29 3,5 15    ( ) 3
abr 20052 1 28 3,1 17    ( ) 3
mar 20052   23 3 3    ( ) 3
fev 20052   23 2,9      ( ) 3
jan 20052   23 2,9 16    ( ) 3
dez 2004211 2212,3 34    ( ) 2
nov 20041   3 5,3 7    ( ) 1
out 20041   2 4,5 4    ( ) 1
set 20041   2 2,5 2    ( ) 1
ago 200411  1 3 3    ( ) 1
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  5  10  100  1  3  5  10  25  100  5  10 
dez 2018        1                
nov 20181                        
out 2018111               2       
set 20182                        
ago 20183111                      
jul 2018                 1       
jun 2018211                       
mai 2018111      1                
abr 20181                        
mar 201821               1       
fev 20181                11      
jan 2018                 1       
dez 20171       1        21      
nov 2017222                       
out 20171                        
set 201711      1        1       
ago 2017                 211     
jul 20171                1111    
jun 201741111             32211   
mai 20171                1     1 
abr 2017111      1        2       
mar 201752      1        1       
fev 2017631      1        3       
jan 20174331     2        21      
out 2018111               2       
jul 2018                 1       
abr 20181                        
jan 2018                 1       
out 20171                        
jul 20171                1111    
abr 2017111      1        2       
jan 20174331     2        21      
out 201631111                     
jul 20167411     3                
abr 20164331              2       
jan 201611111    1        4       
out 20158433     533111   421   1 
jul 2015321      1        2       
abr 2015111      2     2222     11
jan 201543      11       21      
out 20143311              411     
jul 201443321                     
abr 201493111 111         8     11
jan 20141       1        51      
out 20132       1        51      
jul 2013211               5       
abr 20136331              721     
jan 201386442 11 3        42    1 
out 201231   22 1        41    11
jul 2012511   22 1111     52111 11
abr 20121021   21 11       611   2 
jan 20125331              11111    
out 201164211             5111    
jul 20116421  11 3        6211    
abr 201184211    11       511     
jan 20111185421 2212211     73211   
out 201031   11 1        3       
jul 20102    11          111     
abr 201031   21 1        51      
jan 20109221  11 7322     128621   
out 20099654  221311      41      
jul 20094321  2  1        511     
abr 200983331 11 511      832   11
jan 200974421 21 1        311     
out 2008111   1  41       332     
jul 2008532   11 32211    32      
abr 20085321  1  42111    33332 11
jan 200864221 11 2111     411     
out 200732211 1  21       31      
jul 20073211     1        221     
abr 200786432 11 111      2111    
jan 200733331 11 221      4221    
out 20063111     11       4211  11
jul 20065433     8111     2111  1 
abr 20069441     2111     31      
jan 200686422    5311     86441   
out 20052                        
jul 2005111               1       
abr 2005321                       
jan 200541      2        1       
out 2004        1        11      

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1289100.0%6,752100.0%
313145.3%6,51796.5%
107024.2%6,15391.1%
323411.8%5,54882.2%
100124.2%4,21162.4%
31651.7%3,00744.5%

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions		posiçãototaldatadias
atrás		datadias
atrás
Don PoetoUC1936out 23, 20151164abr 24, 2017615
SCriBuUC2803jan 22, 20064725dez 24, 20112563
AnankeBotUC3584dez 18, 20083664set 16, 20131931
StrainubotUC4345jan 30, 20112891jan 30, 20112891
SCriBOTUC5339ago 27, 20064508set 08, 20083765
BadeaGreuceanuUC6308dez 12, 20102940fev 29, 20122496
AnaZUC7230jun 04, 20054957jan 23, 20103263
Marius StoicescuUC8205dez 20, 20074028out 15, 20093363
Azdfg~rowikiquoteUC9119mar 12, 20093580out 19, 20093359
DexbotUC10117abr 13, 20141722jan 18, 20161077
Victoria PopaUC11114dez 03, 20122218jun 04, 2016939
ArthurBotUC12111mai 22, 20093509mar 31, 20112831
KamikazeBotUC1398dez 17, 20102935dez 09, 20112578
AradoUC1491nov 20, 20054788mai 15, 20074247
BAICAN XXXUC1588abr 29, 20112802out 17, 20141535
IonutzmovieUC1683jan 15, 20112906mar 13, 2017657
FirilacrocoUC1777abr 13, 20083913fev 21, 2017677
Parvus7UC1875mai 11, 20074251dez 06, 20131850
MerlIwBotUC1971jul 26, 20122348jun 14, 20132025
SamoaBotUC2068abr 09, 20141726abr 15, 20141720

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.979 edições foram feitas por usuários anônimos, de um total de 9.363 edições ( 21e %)
  

5 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions		datadias
atrás		datadias
atrás
ChtitBotUC1389out 12, 20074097fev 06, 20112884--
EleferenBotUC2182fev 13, 20103242jan 13, 20132177--
AvicBotUC351jul 10, 20112730dez 18, 20151108--
AvocatoBotUC47abr 17, 20122448abr 17, 20122448--
DinybotUC53mar 24, 20074299mar 25, 20074298--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPng
dez 20186234775216972565272       1114
nov 20186224775216972565272       1114
out 20186224775216972565272       1114
set 20186204765216972565272       1114
ago 20186194765216972565272       1114
jul 20186134765216972565272       1114
jun 20186134765216972565272       1114
mai 20186094765216972565272       1114
abr 20186094765216972565272       1114
mar 20186094765216972565272       1114
fev 20186094765216972565272       1114
jan 20186094745216972565272       1114
dez 20176084735216972565272       1114
nov 20176084715216972565272       1114
out 20176074715216972565272       1114
set 20176074715216972565272       1114
ago 20176074705216972565272       1114
jul 20176074705216972565267       1114
jun 20176064705116972565257       1114
mai 20176054695116972565230       1114
abr 20176054695116972565230       1114
mar 20176054695116972565230       1114
fev 20176054695116972565230       1114
jan 20176024675116972565230       1114
dez 20166004675116972535230       1114
nov 20165954675116972535230       1114
out 20165944665116972535230       1114
set 20165854665116972535230       1114
ago 20165824665116972535230       1114
jul 20165774655116972535229       1114
jun 20165744655116972535229       1114
mai 20165684645116972535228       1114
abr 20165654635116972535228       1114
mar 20165584625116972535227       1114
fev 20165584625116972535227       1114
jan 20165584625116972515227       1114
dez 20155504625116972515225       1114
nov 20155124585016972295220       1114
out 20154964565016972295217       1114
set 20154924555016972225217       1114
ago 20154924544916971935213       1114
jul 20154904544816971915213       1114
jun 20154904534816971915213       1114
mai 20154894534816971915213       1114
abr 20154894534816971915213       1114
mar 20154894524816971915213       1114
fev 20154894524816971915213       1114
jan 20154894464816971915213       1114
dez 20144864434816971915213       1114
nov 20144854424816971915213       1114
out 20144854404816971915213       1114
set 20144854394816971895212       1114
ago 20144854364816971895212       1114
jul 20144834324816971895212       1114
jun 20144804324816971895212       1114
mai 20144804324816961895212       1114
abr 20144804324816961895212       1114
mar 20144794264816961895212       1114
fev 20144794234816961895212       1114
jan 20144784194816961895212       1114
dez 20134784134816961895212       1114
nov 20134784134816961895212       1114
out 20134784084816961895212       1114
set 20134784044816961895212       1114
ago 20134773904816961895211       1114
jul 20134773874816961895211       1114
jun 20134753854816961895211       1114
mai 20134753834816961895211       1114
abr 20134743824816961895211       1114
mar 20134723794816961885211       1114
fev 20134713754816961885211       1114
jan 20134713694816961885211       1114
dez 20124653674816961875211       1114
nov 20124633624816961875211       1114
out 20124623624816961875211       1114
set 20124593584816961875211       1114
ago 20124593554816961875211       1114
jul 20124593504816961875211       1114
jun 20124553474515881755206       1113
mai 20124543383415881695206       1113
abr 20124533333415881695206       1113
mar 20124513253415881695206       1113
fev 20124513243415881695188       1113
jan 20124513173415881675175       1113
dez 20114503113415881675174       1113
nov 20114463093415881675174       1113
out 20114442963415881665174       1113
set 20114432933415881665174       1113
ago 20114412903415881665174       1113
jul 20114402883415881665174       1113
jun 20114362793415881665174       1113
mai 20114332753415881665174       1113
abr 20114292693415881655174       1113
mar 20114252623415881655174       1113
fev 20114232603415881655174       1113
jan 20114192553415881655174       1113
dez 20103752503315861635174       1113
nov 20103592463315861635174       1113
out 20103552423315861635174       1113
set 20103552403315861635174       1113
ago 20103552363315861635174       1113
jul 20103512223315861635174       1113
jun 20103502223312861625174       183
mai 20103332103312861625174       183
abr 20103282093312861625173       183
mar 20103262023312861625173       183
fev 20103261993312861625173       183
jan 20103241953312861625173       183
dez 20093211702712861435167       183
nov 20093211672712861435167       183
out 20093211652712861435167       183
set 20093121642712861415163       183
ago 20093111602712861415161       183
jul 20093101592712861415161       183
jun 20093091552712861415161       183
mai 20093071532712861405161       183
abr 20093061482712861405161       183
mar 20092961372712861375155       183
fev 20092941322712851375154       183
jan 20092931272712851365154       183
dez 20082911262712851365154       183
nov 20082911182712851365154       183
out 20082911072712851365154       183
set 2008289972712851364154       183
ago 2008279932511851254150       173
jul 2008276882511731224150       173
jun 2008273882511731214149       173
mai 2008273652410461084148       163
abr 2008270562410461054148       163
mar 200826654211046844139       163
fev 200826352211046844139       163
jan 200826151201042824139       163
dez 200725749181042804139       163
nov 200725447181042784138       163
out 200725444181042784138       163
set 200722441181042784138       163
ago 200722441181042784138       163
jul 20072224118942784137       153
jun 20072184118942774136       153
mai 20072144018942774135       153
abr 20072013518742774133       133
mar 20071963418741764131       133
fev 20071793118739754127       133
jan 20071672918738744121       133
dez 2006151271873868495       133
nov 2006150251473766492       133
out 2006145211373757383       133
set 2006144211373756380       133
ago 2006141201173756375       133
jul 200613715773453370       133
jun 200613114773151367       133
mai 200613014773151267       133
abr 200612314773051267       133
mar 200611713773050265       133
fev 20069413652848261        32
jan 20066513652640135        32
dez 2005488  262 1          
nov 2005434  252 1          
out 2005414  221            
set 2005364  221            
ago 2005344  221            
jul 2005334  221            
jun 2005333  221            
mai 2005323  191            
abr 2005313  191            
mar 2005263  191            
fev 2005262  191            
jan 2005262  191            
dez 2004241  19             
nov 200441                
out 200431                
set 20043                 
ago 20042                 

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons
 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2004: 1 1 Micul prinț

dez 2004: 1 1 Iosif Stalin

jan 2005: 1 1 Cicero

abr 2005: 1 1 Thomas Dewar Weldon

mai 2005: 1 1 Războiul Stelelor

jun 2005: 1 1 Petre Ţuţea

jul 2005: 1 1 Isaac Asimov

ago 2005: 1 1 Johnathan Swift

set 2005: 1 1 Immanuel Kant

out 2005: 1 2 Proverbe românești , 2 1 Proverbe englezești

nov 2005: 1 2 Proverbe românești , 2 1 Proverbe latine

dez 2005: 1 2 Denis Diderot , 2 2 Hippocrate

jan 2006: 1 3 GNU FDL , 2 2 Neil Armstrong , 3 2 Proverbe arabe , 4 2 Proverbe franțuzești , 5 2 Antoine de Saint-Exupéry , 6 2 Socrate , 7 1 Mircea Eliade

fev 2006: 1 3 Aristotel , 2 3 Albert Einstein , 3 2 Marin Preda , 4 2 Platon , 5 2 Émile Zola , 6 2 Tennessee Williams , 7 2 Arthur Schopenhauer , 8 2 Ronald Reagan , 9 2 Dante Alighieri , 10 2 Heinrich Heine , 11 2 Toma de Aquino , 12 2 Octavian Paler , 13 2 Bill Gates , 14 2 Skynet , 15 2 Nicolae Iorga

mar 2006: 1 4 Charles Darwin , 2 2 Selma Lagerlöf , 3 2 Ioan Pop de Popa , 4 2 Curaj , 5 2 Fridtjof Nansen , 6 2 François de la Rochefoucauld , 7 2 Jean-Baptiste Camille Corot , 8 1 Contact (film)

abr 2006: 1 4 Proverbe românești , 2 2 Mihai Eminescu , 3 2 Richard Feynman , 4 2 Ayn Rand , 5 1 Marin Preda

mai 2006: 1 1 Charles Dickens

jun 2006: 1 2 Proverbe românești , 2 1 Panait Istrati

jul 2006: 1 2 Marin Preda

ago 2006: 1 2 Mahatma Gandhi , 2 2 Contact , 3 2 Woody Allen , 4 1 Mircea Cărtărescu

set 2006: 1 2 Fridtjof Nansen , 2 2 Proverbe românești , 3 1 Edmund Hillary

out 2006: 1 1 Ion Iliescu

nov 2006: 1 3 Victor Hugo , 2 3 Proverbe românești , 3 2 Manhattan (film) , 4 2 Charles Dickens , 5 2 George Topîrceanu , 6 2 Selma Lagerlöf , 7 2 Hermann Hesse , 8 2 Seneca , 9 2 Tudor Mușatescu , 10 2 André Gide , 11 1 Truman Capote

dez 2006: 1 1 Alexandre Dumas

jan 2007: 1 2 Jules Verne , 2 2 Theodore Roosevelt , 3 2 Friedrich Nietzsche , 4 2 Proverbe românești

fev 2007: 1 3 Proverbe românești , 2 2 Valeriu Anania , 3 1 Bartolomeu Anania

mar 2007: 1 3 Ateism , 2 2 Ion Antonescu , 3 2 Proverbe malaeziene , 4 2 Augustin de Hipona , 5 2 Sfântul Grigorie Palama , 6 2 Lao Zi , 7 2 Toma de Aquino

abr 2007: 1 2 Gabriel García Márquez , 2 2 Corneliu Zelea Codreanu , 3 2 Napoleon Bonaparte , 4 1 Marin Preda

mai 2007: 1 2 Paul Cornea , 2 2 Mircea Iorgulescu , 3 2 Florin Manolescu , 4 2 Ștefan Cazimir , 5 1 Proverbe cehe

jun 2007: 1 2 Miguel de Cervantes , 2 1 Ovid S. Crohmălniceanu

jul 2007: 1 2 Marin Preda , 2 2 Putere

ago 2007: 1 1 Cioran

set 2007: 1 1 Viktor Frankl

out 2007: 1 1 Perpessicius

nov 2007: 1 2 Ovid S. Crohmălniceanu , 2 1 Pompiliu Constantinescu

dez 2007: 1 4 Proverbe românești , 2 1 Marin Preda

jan 2008: 1 3 Proverbe românești , 2 2 Dinu Patriciu , 3 2 Femeie , 4 1 Patriciu

fev 2008: 1 3 Proverbe românești , 2 2 Iubire , 3 1 Constantin Noica

mar 2008: 1 2 Sofocle , 2 2 Alexandru Mocioni , 3 1 Camil Petrescu

abr 2008: 1 3 George Pruteanu , 2 2 Mircea Cărtărescu , 3 2 Proverbe românești , 4 1 Cilibi moise

mai 2008: 1 2 Luis Bunuel , 2 2 Ashley Montagu , 3 1 Casa de pe colină

jun 2008: 1 2 Proverbe românești , 2 1 George Călinescu

jul 2008: 1 2 Proverbe românești , 2 1 Hamlet

ago 2008: 1 2 Paul Valéry , 2 2 Voltaire , 3 1 Libertate

set 2008: 1 2 Orson Welles , 2 2 Proverbe africane , 3 2 Proverbe australiene , 4 2 Proverbe afgane , 5 2 Femeia , 6 2 Doctor Jivago (film) , 7 1 Om

out 2008: 1 1 Maria a României

nov 2008: 1 1 Tudor Vianu

dez 2008: 1 3 Proverbe românești , 2 2 Gabriel García Márquez

jan 2009: 1 3 Aristotel , 2 2 Iuliu Maniu , 3 2 Femeie , 4 2 Marcus Tullius Cicero , 5 1 Randy Pausch

fev 2009: 1 2 Proverbe românești , 2 1 Caragiale despre Eminescu

mar 2009: 1 3 Albert Einstein , 2 2 Ernest Hemingway , 3 1 Babylon 5

abr 2009: 1 2 Paul Lampert , 2 2 Horia-Roman Patapievici , 3 2 Rammstein , 4 2 Ateism , 5 1 Paul Louis Lampert

mai 2009: 1 2 Camil Petrescu , 2 1 Jodie Foster

jun 2009: 1 2 Marin Preda , 2 2 Adam Smith

jul 2009: 1 2 Ion Vartic

ago 2009: 1 2 Louis Lavelle

set 2009: 1 2 Proverbe românești , 2 1 Crusade (serial TV)

out 2009: 1 3 Michael Jordan , 2 2 Frank Lampard , 3 2 John F. Kennedy , 4 2 Proverbe românești , 5 1 Pelé

nov 2009: 1 1 Fotbal

dez 2009: 1 1 Proverbe latine

jan 2010: 1 2 Proverbe românești , 2 1 Proverbe armene

fev 2010: 1 2 M-am hotărât să devin prost , 2 2 Proverbe românești , 3 1 M-am hotarat sa devin prost

mar 2010: 1 1 Jodie Foster

abr 2010: 1 1 Enigma numărului 23

mai 2010: 1 3 David Rockefeller , 2 3 Enigma numărului 23 , 3 2 Carol I , 4 2 Karl Marx , 5 1 Johann Wolfgang von Goethe

jun 2010: 1 3 Heraclit , 2 3 Johann Wolfgang von Goethe , 3 2 Baruch Spinoza , 4 2 Alex Ferguson , 5 2 Negru Vodă , 6 2 Vălenii de Munte , 7 1 Johann Wolfgang Goethe

jul 2010: 1 1 Trei frați de belea (film)

ago 2010: 1 2 Talent , 2 2 Iubire , 3 2 Neil Armstrong , 4 1 Through the Wormhole

set 2010: 1 1 Petre Țuțea

out 2010: 1 2 Iubire , 2 2 Romain Rolland , 3 1 Octavian Goga

nov 2010: 1 1 Proverbe spaniole

dez 2010: 1 2 Yoga , 2 2 Abraham Lincoln , 3 2 Pagina principală , 4 1 Antim Ivireanul

jan 2011: 1 4 Dimitrie Țichindeal , 2 3 Petre Țuțea , 3 2 Proverbe românești despre dărnicie , 4 2 Renume , 5 2 Iordache Golescu , 6 2 Iosif Trifa , 7 2 Lume , 8 2 Speranță , 9 2 Înțelepciune , 10 2 Gavriil Stiharul , 11 1 Ştiinţă

fev 2011: 1 2 Ioan Gură de Aur , 2 2 Entuziasm , 3 2 Rugăciune , 4 2 Homer

mar 2011: 1 2 Vasile Alecsandri , 2 2 Proverbe chinezești , 3 2 Lao Zi , 4 2 Curaj

abr 2011: 1 3 John F. Kennedy , 2 2 Traian Demetrescu , 3 2 Papa Ioan Paul al II-lea , 4 2 Proverbe englezești , 5 1 Jean de la Bruyere

mai 2011: 1 2 George Carlin , 2 2 Vaslui

jun 2011: 1 2 Vasile Pârvan , 2 2 Corneliu Zelea Codreanu , 3 1 Furnicile

jul 2011: 1 2 Moromeții , 2 1 Cel mai iubit dintre pământeni

ago 2011: 1 2 Eternitate , 2 2 Corneliu Zelea Codreanu

set 2011: 1 3 Pagina principală , 2 2 Petre Țuțea , 3 2 Proverbe englezești , 4 1 Feodor Dostoievski

out 2011: 1 2 Jules Renard , 2 2 Proverbe chinezești , 3 2 John Steinbeck , 4 1 Bernard de Clairvaux

nov 2011: 1 2 Proverbe românești , 2 1 Stanisław Jerzy Lec

dez 2011: 1 2 H. G. Wells , 2 2 Prietenie , 3 2 Alfred Nobel , 4 1 Quintus Horatius Flaccus

jan 2012: 1 2 Bill Gates , 2 1 Sherlock Holmes (film din 2009)

fev 2012: 1 2 Homer , 2 1 H. G. Wells

mar 2012: 1 1 Quintus Horatius Flaccus

abr 2012: 1 1 Proverbe tibetane

mai 2012: 1 1 Sun Tzu

jun 2012: 1 1 Prometheus (film)

jul 2012: 1 1 W. Raymond Drake

set 2012: 1 1 Emil Cioran

out 2012: 1 2 Jean Baudrillard , 2 1 Invidie

nov 2012: 1 1 Iulius Cezar

dez 2012: 1 1 Bugs Bunny

jan 2013: 1 3 Proverbe românești , 2 2 Proverbe daneze , 3 2 Proverbe basce , 4 2 Proverbe albaneze , 5 2 Diogene din Sinope , 6 2 Alex Ferguson

fev 2013: 1 1 Panait Istrati

mar 2013: 1 1 Fotbalul în România

abr 2013: 1 1 Andrei colompar

mai 2013: 1 1 Napoleon I

jun 2013: 1 1 Jean Baudrillard

jul 2013: 1 1 Valeriu Pantazi

ago 2013: 1 1 Valeriu Pantazi

set 2013: 1 1 Ioan Gyuri Pascu

out 2013: 1 1 Mircea Eliade

dez 2013: 1 1 Constantin Brâncuși

jan 2014: 1 1 Aristotel

fev 2014: 1 1 Remus Cernea

mar 2014: 1 1 Marin Preda

abr 2014: 1 2 Albert Einstein , 2 2 Proverbe românești , 3 1 Ludwig van Beethoven

mai 2014: 1 2 Proverbe românești , 2 1 Valeriu Pantazi

jun 2014: 1 2 Marin Preda

jul 2014: 1 2 Marin Preda , 2 1 André Chénier

ago 2014: 1 2 Table , 2 2 Proverbe românești

set 2014: 1 1 Marin Preda

out 2014: 1 2 Cel mai iubit dintre pământeni , 2 2 Moromeții

nov 2014: 1 1 Ioan Alexandru

dez 2014: 1 1 Marcus Furius Camillus

jan 2015: 1 1 Krikor h. Zambaccian

fev 2015: 1 1 Nichita Stănescu

mar 2015: 1 1 George Becali

abr 2015: 1 1 Nichita Stănescu

mai 2015: 1 1 Valeriu Pantazi

jun 2015: 1 1 Istorie

jul 2015: 1 1 Vyasa

ago 2015: 1 1 Nicolae Ceaușescu

set 2015: 1 2 Fotbalul în România

out 2015: 1 3 Nicolae Titulescu , 2 2 Nicolae Ceaușescu , 3 2 Bugs Bunny , 4 2 Caragiale despre Eminescu , 5 2 Ion Antonescu , 6 1 Thomas Alva Edison

nov 2015: 1 2 Adevăr , 2 1 Minune

dez 2015: 1 2 Vladimir Ilici Lenin , 2 2 Pitagora , 3 2 Anna Wintour , 4 2 Voință , 5 2 Modă , 6 2 Bucurie , 7 2 Biblie , 8 2 Geniu , 9 2 Gândire pozitivă , 10 2 Adevăr , 11 1 Glorie

jan 2016: 1 1 Beție

fev 2016: 1 2 Valeriu Pantazi , 2 1 Cruce

mar 2016: 1 1 Voltaire

abr 2016: 1 1 Victor Eftimiu

mai 2016: 1 1 Kelly Clarkson

jun 2016: 1 1 Marilyn Monroe

jul 2016: 1 2 Christina Aguilera , 2 2 Madonna , 3 2 Amy Winehouse , 4 1 Andre Maurois

ago 2016: 1 2 Vladimir Ilici Lenin , 2 1 Epitafuri (Poezie epigramatică)

set 2016: 1 1 Democrație

out 2016: 1 1 Singurătate

nov 2016: 1 2 George Becali , 2 1 Operă

dez 2016: 1 1 Bun-simț

jan 2017: 1 1 Victoraș Iacob

fev 2017: 1 2 Thoreau , 2 1 Corupție

mar 2017: 1 1 Vladimir Ilici Lenin

abr 2017: 1 1 Capitalism

mai 2017: 1 1 Isaac Asimov

jun 2017: 1 1 Eddie Murphy Raw

jul 2017: 1 1 Cu penetul ca sideful - Mihai Eminescu

set 2017: 1 1 Emil Cioran

out 2017: 1 1 Proverbe românești

nov 2017: 1 1 Quintus Horatius Flaccus

dez 2017: 1 1 Arthur Schopenhauer

fev 2018: 1 1 Proverbe latine

mar 2018: 1 1 George Becali

abr 2018: 1 1 Louis Brandeis

mai 2018: 1 1 Eleanor Roosevelt

jun 2018: 1 1 Scriitori români

ago 2018: 1 2 Mircea Nicolae Rusu , 2 1 Simion Eugen

set 2018: 1 1 Ruști, Doina

out 2018: 1 1 Octavian Gogita

nov 2018: 1 1 Vasile Alecsandri

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file rowikiquote-20190101-stub-meta-history.xml.gz (edits only), size 982 kb as gz -> 6.7 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:16 after 6 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.