Estatísticas da Wikiquote inglês simplificado

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201865   599 20,8      ( ) 987
nov 201865   599 20,8      ( ) 987
out 201865   599 20,8      ( ) 987
set 201865   599 20,8      ( ) 987
ago 201865   599 20,8      ( ) 987
jul 201865   599 20,8      ( ) 987
jun 201865   599 20,8      ( ) 987
mai 201865   599 20,8      ( ) 987
abr 201865   599 20,8      ( ) 987
mar 201865   599 20,8      ( ) 987
fev 201865   599 20,8      ( ) 987
jan 201865   599 20,8      ( ) 987
dez 201765   599 20,8      ( ) 987
nov 201765   599 20,8      ( ) 987
out 201765   599 20,8      ( ) 987
set 201765   599 20,8      ( ) 987
ago 201765   599 20,8      ( ) 987
jul 201765   599 20,8      ( ) 987
jun 201765   599 20,8      ( ) 987
mai 201765   599 20,8      ( ) 987
abr 201765   599 20,8      ( ) 987
mar 201765   599 20,8      ( ) 987
fev 201765   599 20,8      ( ) 987
jan 201765   599 20,8      ( ) 987
dez 201665   599 20,8      ( ) 987
nov 201665   599 20,8      ( ) 987
out 201665   599 20,8      ( ) 987
set 201665   599 20,8      ( ) 987
ago 201665   599 20,8      ( ) 987
jul 201665   599 20,8      ( ) 987
jun 201665   599 20,8      ( ) 987
mai 201665   599 20,8      ( ) 987
abr 201665   599 20,8      ( ) 987
mar 201665   599 20,8      ( ) 987
fev 201665   599 20,8      ( ) 987
jan 201665   599 20,8      ( ) 987
dez 201565   599 20,8      ( ) 987
nov 201565   599 20,8      ( ) 987
out 201565   599 20,8      ( ) 987
set 201565   599 20,8      ( ) 987
ago 201565   599 20,8      ( ) 987
jul 201565   599 20,8      ( ) 987
jun 201565   599 20,8      ( ) 987
mai 201565   599 20,8      ( ) 987
abr 201565   599 20,8      ( ) 987
mar 201565   599 20,8      ( ) 987
fev 201565   599 20,8      ( ) 987
jan 201565   599 20,8      ( ) 987
dez 201465   599 20,8      ( ) 987
nov 201465   599 20,8      ( ) 987
out 201465   599 20,8      ( ) 987
set 201465   599 20,8      ( ) 987
ago 201465   599 20,8      ( ) 987
jul 201465   599 20,8      ( ) 987
jun 201465   599 20,8      ( ) 987
mai 201465   599 20,8      ( ) 987
abr 201465   599 20,8      ( ) 987
mar 201465   599 20,8      ( ) 987
fev 201465   599 20,8      ( ) 987
jan 201465   599 20,8      ( ) 987
dez 201365   599 20,8      ( ) 987
nov 201365   599 20,8      ( ) 987
out 201365   599 20,8      ( ) 987
set 201365   599 20,8      ( ) 987
ago 201365   599 20,8      ( ) 987
jul 201365   599 20,8      ( ) 987
jun 201365   599 20,8      ( ) 987
mai 201365   599 20,8      ( ) 987
abr 201365   599 20,8      ( ) 987
mar 201365   599 20,8      ( ) 987
fev 201365   599 20,8      ( ) 987
jan 201365   599 20,8 11    ( ) 987
dez 201265   599 20,8      ( ) 987
nov 201265   599 20,8      ( ) 987
out 201265   599 20,8      ( ) 987
set 201265   599 20,8      ( ) 987
ago 201265   599 20,8      ( ) 987
jul 201265   599 20,8      ( ) 987
jun 201265   599 20,8      ( ) 987
mai 201265   599 20,8      ( ) 987
abr 201265   599 20,8      ( ) 987
mar 201265   599 20,8      ( ) 987
fev 201265   599 20,8      ( ) 987
jan 201265   599 20,8      ( ) 987
dez 201165   599 20,8      ( ) 987
nov 201165   599 20,8      ( ) 987
out 201165   599 20,8      ( ) 987
set 201165   599 20,8      ( ) 987
ago 201165   599 20,8      ( ) 987
jul 201165   599 20,8      ( ) 987
jun 201165   599 20,8      ( ) 987
mai 201165   599 20,8      ( ) 987
abr 201165   599 20,8      ( ) 987
mar 201165   599 20,8      ( ) 987
fev 201165   599 20,8      ( ) 987
jan 201165   599 20,8 1    ( ) 987
dez 201065   599 20,8      ( ) 987
nov 201065   599 20,8      ( ) 987
out 201065   599 20,8      ( ) 987
set 201065   599 20,8      ( ) 987
ago 201065   599 20,8      ( ) 987
jul 201065   599 20,8      ( ) 987
jun 201065   599 20,8      ( ) 987
mai 201065   599 20,8      ( ) 987
abr 201065   599 20,8      ( ) 987
mar 201065   599 20,8      ( ) 987
fev 20106523 599 20,8 180    ( ) 987
jan 20106312 598 20,6 77    ( ) 987
dez 200962 1 598 20,4 56    ( ) 987
nov 2009621  596 20,4 60    ( ) 987
out 200961 31596220,3 510    ( ) 986
set 200961382538121,5 734    ( ) 985
ago 200958363506421,5 2,3 k    ( ) 862
jul 200955 31391 21,8 179    ( ) 333
jun 200955261390 21,4 280    ( ) 279
mai 200953391388 20,8 493    ( ) 258
abr 2009506102378120 1,0 k    ( ) 253
mar 200944361361118,2 356    ( ) 247
fev 200941261327119 409    ( ) 221
jan 200939371312 18,6 572    ( ) 219
dez 200836481305117,1 450    ( ) 204
nov 200832183277217,2 1,1 k    ( ) 167
out 200831391227116 875    ( ) 135
set 20082816 207113,3 191    ( ) 124
ago 2008277115182214,1 1,1 k    ( ) 120
jul 200820221127 11,2 177    ( ) 98
jun 200818 1 121 10,3 27    ( ) 94
mai 200818   114 10,7 30    ( ) 93
abr 200818   114 10,4 11    ( ) 93
mar 20081811 113 10,4 59    ( ) 93
fev 200817 1 109 10,3 19    ( ) 93
jan 20081723 107 10,3 44    ( ) 93
dez 20071546 106 10 187    ( ) 93
nov 20071115 105 8,3 120    ( ) 93
out 20071024 100 7,5 174    ( ) 92
set 20078 1 97 5,9 58    ( ) 92
ago 20078 1 95 5,5 22    ( ) 92
jul 20078   91 5,5 8    ( ) 92
jun 20078 1 87 5,6 22    ( ) 92
mai 20078 1 87 5,4 38    ( ) 92
abr 2007811 80 5,3 22    ( ) 90
mar 20077 1 79 5,1 33    ( ) 88
fev 2007712 79 4,7 37    ( ) 88
jan 20076 1 76 4,4 18    ( ) 87
dez 2006623 7624,2 158    ( ) 87
nov 20064   11 14,5 7    ( ) 86
out 20064   11 13,9 4    ( ) 86
set 200641  11 13,5 4    ( ) 86
ago 20063   11 13,2 6    ( ) 86
jul 20063   11 12,6 1    ( ) 86
jun 2006311 11 12,5 16    ( ) 86
mai 20062 2 4 30,5 22    ( ) 84
abr 20062   2 50 1    ( ) 83
mar 20062   2 49,5      ( ) 83
fev 20062   2 49,5      ( ) 83
jan 20062   2 49,5      ( ) 83
dez 20052   2 49,5 3    ( ) 83
nov 20052   2 48      ( ) 83
out 20052   2 48      ( ) 83
set 20052   2 48      ( ) 83
ago 20052   2 48      ( ) 83
jul 20052   2 48      ( ) 83
jun 20052   2 48      ( ) 83
mai 20052   2 48 1    ( ) 83
abr 20052   2 47,5      ( ) 83
mar 20052   2 47,5      ( ) 83
fev 20052   2 47,5 1    ( ) 83
jan 20052   2 47      ( ) 83
dez 20042   2 47 3    ( ) 83
nov 20042   1 91 3    ( ) 83
out 20042   1 88      ( ) 83
set 20042   1 88      ( ) 83
ago 2004221 1 88 88    ( ) 83
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  5  10  100 
dez 2018                             
nov 2018                             
out 2018                   1         
set 2018                             
ago 2018                             
jul 2018                             
jun 2018                             
mai 2018                             
abr 2018                             
mar 2018                             
fev 2018                             
jan 2018                             
dez 2017                             
nov 2017                             
out 2017                             
set 2017                             
ago 2017                             
jul 2017         1         1         
jun 2017                             
mai 2017                             
abr 2017                   1         
mar 2017                   1         
fev 2017                   1111      
jan 2017                             
out 2018                   1         
jul 2018                             
abr 2018                             
jan 2018                             
out 2017                             
jul 2017         1         1         
abr 2017                   1         
jan 2017                             
out 2016                             
jul 2016                             
abr 2016                             
jan 2016                   1         
out 2015                          1  
jul 2015         11        22        
abr 2015                221       11 
jan 2015         1         1         
out 2014                             
jul 2014                             
abr 2014                             
jan 2014                             
out 2013                             
jul 2013                   1         
abr 2013                             
jan 20132                  2         
out 2012                             
jul 2012                             
abr 2012                             
jan 2012                             
out 2011                             
jul 2011                             
abr 2011                             
jan 20111        1         1         
out 2010                             
jul 2010                   1         
abr 2010                             
jan 201012322   11 9431      24631   11 
out 20091643221  22122158542    321814721    
jul 20091453211     13441      2211852     
abr 20092214109621 21 208552     401613661 111
jan 20091777751  42 138741     2514131061    
out 200814999411 2  21119641    31191510721   
jul 2008632211  1  31        156211     
abr 2008      1  31        911       
jan 20083332   11 6321      2542       
out 200764421  11 6221      145211     
jul 200721       3         851       
abr 20072211      211       721       
jan 20071111      31        6411      
out 20062        1         3         
jul 20061        1         3         
abr 2006         1         211       
jan 2006         1         221       
out 2005         2         211       
jul 2005                             
abr 2005                             
jan 2005                             
out 2004                             

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1182100.0%11,800100.0%
39552.2%11,67999.0%
106435.2%11,49097.4%
323519.2%11,00193.2%
100189.9%9,93984.2%
316126.6%9,01676.4%
100021.1%4,38537.2%

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
American EagleUC12,473jul 20, 20083815jun 07, 20093493
Snake311UC21,912ago 21, 20093418fev 17, 20103238
PmlineditorUC3711jul 18, 20093452fev 04, 20103251
GT5162UC4659abr 07, 20093554mai 02, 20093529
RyanCrossUC5502ago 07, 20083797jun 12, 20093488
PeterSymondsUC6457nov 01, 20083711jan 29, 20093622
EVulaUC7448ago 14, 20074156jun 22, 20093478
RogDelUC8399abr 18, 20093543out 25, 20093353
CoppertwigUC9393dez 05, 20064408ago 15, 20093424
SULUC10375mai 09, 20093522set 28, 20093380
MaximUC11354ago 18, 20083786jun 18, 20093482
AnankeBotUC12333dez 18, 20083664fev 02, 20103253
JuliancoltonUC13185abr 23, 20093538fev 18, 20103237
SwirlBoy39UC14163jul 30, 20083805fev 19, 20093601
ArthurBotUC15163mai 22, 20093509dez 02, 20093315
TBCUC16158ago 06, 20083798set 01, 20083772
TempodivalseUC17135abr 09, 20093552jan 09, 20103277
ChenzwBotUC18119ago 17, 20083787mar 03, 20093589
Sir James Paul~simplewikiquoteUC1989dez 06, 20064407dez 26, 20064387
MerovingianUC2088ago 04, 20045261dez 06, 20045137

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 411 edições foram feitas por usuários anônimos, de um total de 12484 edições ( 3e %)
  


3 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
ChtitBotUC1267set 08, 20074131fev 15, 20103240--
EleferenBotUC25fev 13, 20103242fev 18, 20103237--
DinybotUC31mar 25, 20074298mar 25, 20074298--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
dez 20181,6 k439697521151826462       5
nov 20181,6 k439697521151826462       5
out 20181,6 k439697521151826462       5
set 20181,6 k438697521151826462       5
ago 20181,6 k438697521151826462       5
jul 20181,6 k438697521151826462       5
jun 20181,6 k438697521151826462       5
mai 20181,6 k438697521151826462       5
abr 20181,6 k438697521151826462       5
mar 20181,6 k438697521151826462       5
fev 20181,6 k438697521151826462       5
jan 20181,6 k438697521151826462       5
dez 20171,6 k438697521151826462       5
nov 20171,6 k438697521151826462       5
out 20171,6 k438697521151826462       5
set 20171,6 k438697521151826462       5
ago 20171,6 k438697521151826462       5
jul 20171,6 k438697521151826462       5
jun 20171,6 k438697521151826462       5
mai 20171,6 k438697521151826462       5
abr 20171,6 k438697521151826462       5
mar 20171,6 k438697521151826462       5
fev 20171,6 k438697521151826462       5
jan 20171,6 k438697521151826462       5
dez 20161,6 k438697521151826462       5
nov 20161,6 k438697521151826462       5
out 20161,6 k438697521151826462       5
set 20161,6 k438697521151826462       5
ago 20161,6 k438697521151826462       5
jul 20161,6 k438697521151826462       5
jun 20161,6 k438697521151826462       5
mai 20161,6 k438697521151826462       5
abr 20161,6 k438697521151826462       5
mar 20161,6 k438697521151826462       5
fev 20161,6 k438697521151826462       5
jan 20161,6 k438697521151826462       5
dez 20151,6 k438697521151826462       5
nov 20151,6 k438697521151826462       5
out 20151,6 k438697521151826462       5
set 20151,6 k438697521151126462       5
ago 20151,6 k438697521151126462       5
jul 20151,6 k438697521151026462       5
jun 20151,6 k437697521151026462       5
mai 20151,6 k437697521151026462       5
abr 20151,6 k437697521151026462       5
mar 20151,6 k437697521151026462       5
fev 20151,6 k437697521151026462       5
jan 20151,6 k435697521151026462       5
dez 20141,6 k434697521151026462       5
nov 20141,6 k434697521151026462       5
out 20141,6 k434697521151026462       5
set 20141,6 k434697521151026462       5
ago 20141,6 k434697521151026462       5
jul 20141,6 k434697521151026462       5
jun 20141,6 k434697521151026462       5
mai 20141,6 k434697521151026462       5
abr 20141,6 k434697521151026462       5
mar 20141,6 k434697521151026462       5
fev 20141,6 k434697521151026462       5
jan 20141,6 k434697521151026462       5
dez 20131,6 k434697521151026462       5
nov 20131,6 k434697521151026462       5
out 20131,6 k434697521151026462       5
set 20131,6 k434697521151026462       5
ago 20131,6 k434697521151026462       5
jul 20131,6 k434697521151026462       5
jun 20131,6 k434697521051026462       5
mai 20131,6 k434697521051026462       5
abr 20131,6 k434697521051026462       5
mar 20131,6 k434697521051026462       5
fev 20131,6 k434697521051026462       5
jan 20131,6 k434697521051026462       5
dez 20121,6 k432697521051026462       5
nov 20121,6 k432697521051026462       5
out 20121,6 k432697521051026462       5
set 20121,6 k432697521051026462       5
ago 20121,6 k432697521051026462       5
jul 20121,6 k432697521051026462       5
jun 20121,6 k432697521051026462       5
mai 20121,6 k432697521051026462       5
abr 20121,6 k432697521051026462       5
mar 20121,6 k432697521051026462       5
fev 20121,6 k432697521051026462       5
jan 20121,6 k432697521051026462       5
dez 20111,6 k432697521051026462       5
nov 20111,6 k432697521051026462       5
out 20111,6 k432697521051026462       5
set 20111,6 k432697521051026462       5
ago 20111,6 k432697521051026462       5
jul 20111,6 k432697521051026462       5
jun 20111,6 k432697521051026462       5
mai 20111,6 k432697521051026462       5
abr 20111,6 k432697521051026462       5
mar 20111,6 k432697521051026462       5
fev 20111,6 k432697521051026462       5
jan 20111,6 k432697521051026462       5
dez 20101,6 k432697521051026462       5
nov 20101,6 k432697521051026462       5
out 20101,6 k432697521051026462       5
set 20101,6 k432697521051026462       5
ago 20101,6 k432697521051026462       5
jul 20101,6 k432697521051026462       5
jun 20101,6 k432697521051026462       5
mai 20101,6 k432697521051026462       5
abr 20101,6 k432697521051026462       5
mar 20101,6 k432697521051026462       5
fev 20101,6 k432697521051026462       5
jan 20101,6 k428697521051026462       5
dez 20091,6 k414697521051026462       5
nov 20091,6 k410697521051026462       5
out 20091,6 k370697521050326456       5
set 20091,5 k345683521049526451       5
ago 20091,4 k318664520948623443       5
jul 2009724290605520446623423       5
jun 2009669280595518846223422       5
mai 2009646276583518645423420       5
abr 2009631271549518644723412       5
mar 2009608240493518340321387       5
fev 2009548228456318339921384       3
jan 2009531200441 18337821381        
dez 2008509191432 18135920366        
nov 2008444181419 8632710356        
out 2008362149293 7729710282        
set 2008331121187 761789192        
ago 2008302117147 731649182        
jul 20082258471 1666944        
jun 20082158046 1459929        
mai 20082077446 1457929        
abr 20082076845 1455929        
mar 20082066545 1455929        
fev 20082026143 1453922        
jan 20082006143 1449922        
dez 20071995843 1440922        
nov 20071985543 1438922        
out 20071925241 1436916        
set 20071894828 1431916        
ago 20071873826 1427916        
jul 20071833726 1023916        
jun 20071793624 1021916        
mai 20071793624 1020916        
abr 20071703524 1020916        
mar 20071673323 1020916        
fev 20071673019 1020816        
jan 20071632818 1020816        
dez 20061632718 1019816        
nov 2006971317 1014814        
out 2006971317 1014814        
set 2006971317 1014814        
ago 2006971217 1014814        
jul 2006971116 1014814        
jun 2006971116 1014814        
mai 2006881115 10988        
abr 200685912 5381        
mar 200685812 5281        
fev 200685712 5 8         
jan 200685712 5 8         
dez 200585412 5 8         
nov 200585212 5 8         
out 200585210 5 3         
set 200585 10 5 2         
ago 200585 10 5 2         
jul 200585 10 5 2         
jun 200585 10 5 2         
mai 200585 9 5 2         
abr 200585 9 5 2         
mar 200585 9 5 2         
fev 200585 9 5 2         
jan 200585 9 5 2         
dez 200485 9 5 2         
nov 200484 9             
out 200484 9             
set 200484 9             
ago 200484 9             

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 2 Main Page , 2 1 Accueil

nov 2004: 1 1 Main Page

dez 2004: 1 1 List of people by name

fev 2005: 1 1 Main Page

dez 2005: 1 1 Main Page

mai 2006: 1 3 Main Page , 2 1 List of proverbs

jun 2006: 1 1 Malcolm X

jul 2006: 1 1 Main Page

ago 2006: 1 1 List of TV shows

set 2006: 1 1 List of literary works

out 2006: 1 2 Main Page

nov 2006: 1 1 Main Page

dez 2006: 1 3 Pride and Prejudice , 2 3 Main Page , 3 2 Dune , 4 2 Beth Anderson , 5 2 Terry Francona , 6 2 Barbara Amiel , 7 2 Rolim Amaro , 8 2 Mark Twain , 9 2 Buzz Aldrin , 10 2 Aeschylus , 11 2 James Abourezk , 12 2 Hal Abelson , 13 2 Edward Abbey , 14 2 Emily Brontë , 15 1 Alcuin

jan 2007: 1 1 Beth Anderson

fev 2007: 1 2 Friedrich Kellner , 2 2 Jane Addams

mar 2007: 1 2 Friedrich Kellner , 2 2 Main Page

abr 2007: 1 2 Alphonse Allais , 2 1 Carl Sagan

mai 2007: 1 1 Buckminster Fuller

jun 2007: 1 1 Richard Buckminster Fuller

jul 2007: 1 1 Emily Dickinson

ago 2007: 1 1 Cicero

set 2007: 1 1 Friendship

out 2007: 1 3 Azerbaijani proverbs , 2 2 Friendship , 3 2 Victor Hugo , 4 2 Judy Garland , 5 2 Richard Buckminster Fuller , 6 2 Turkish proverbs , 7 2 Milton Babbitt , 8 2 Sparky Anderson , 9 2 Nii Parkes , 10 1 Larry Page

nov 2007: 1 6 Main Page , 2 2 Franklin D. Roosevelt , 3 2 Pablo Picasso , 4 2 William Blake , 5 2 Judy Garland , 6 2 Ralph Waldo Emerson , 7 2 Barbara Amiel , 8 1 Cicero

dez 2007: 1 6 Main Page , 2 4 Ralph Waldo Emerson , 3 4 Azerbaijani proverbs , 4 3 Alcuin , 5 3 Meher Baba , 6 3 Stone Cold Steve Austin , 7 3 Anne, Princess Royal , 8 3 Nii Parkes , 9 3 Rolim Amaro , 10 3 Hal Abelson , 11 2 Julius Caesar (play)

jan 2008: 1 3 Robin Williams , 2 2 Agatha Christie

fev 2008: 1 2 Turkish proverbs , 2 1 Mary Hirsch

mar 2008: 1 2 Barbara Amiel , 2 1 Native American proverbs

mai 2008: 1 1 Beth Anderson

jun 2008: 1 1 Spider-Man (movie)

jul 2008: 1 2 Charles Spurgeon , 2 2 No name , 3 2 Friendship , 4 2 Judy Garland , 5 2 Henry David Thoreau , 6 2 Winston Churchill , 7 2 Mark Twain , 8 2 Alexander the Great , 9 1 Spider-Man (movie)

ago 2008: 1 8 Judy Garland , 2 7 Margaret Thatcher , 3 7 John Adams , 4 6 Derek Jeter , 5 6 Terry Pratchett , 6 6 Eleanor Roosevelt , 7 6 Candice Bergen , 8 6 Main Page/About , 9 6 Charles Spurgeon , 10 6 Pablo Picasso , 11 6 Bruce Forsyth , 12 6 Mark Twain , 13 6 Citizenship , 14 5 Rickey Henderson , 15 5 Keiko Agena , 16 5 Galileo Galilei , 17 5 Ralph Waldo Emerson , 18 5 Louis Armstrong , 19 5 Sparky Anderson , 20 5 Richard Lovelace , 21 5 Malcolm X , 22 4 Alex Rodriguez , 23 4 Hank Aaron , 24 4 Samuel Adams , 25 4 Manny Ramirez

set 2008: 1 3 Jimmy Wales , 2 3 Jessica Alba , 3 3 Gideon Tucker , 4 3 Martin Amis , 5 3 Kurt Cobain , 6 3 September 11, 2001 attacks , 7 3 George H. W. Bush , 8 2 T. S. Eliot , 9 2 Michael Phelps , 10 2 Charley Lau , 11 2 Gerald Ford , 12 2 Jimmy Carter , 13 2 Fireproof , 14 2 Cy Young

out 2008: 1 4 John McCain , 2 4 Sarah Palin , 3 4 Barack Obama , 4 4 George W. Bush , 5 3 Zack de la Rocha , 6 3 Leonardo DiCaprio , 7 3 Italian proverbs , 8 3 Michael Phelps , 9 3 Kurt Cobain , 10 3 Roberto Clemente , 11 3 The Dark Knight , 12 3 David Ortiz , 13 3 Derek Jeter , 14 3 Paula Abdul , 15 3 Charles Spurgeon , 16 3 Beth Anderson , 17 3 Abigail Adams , 18 3 William Shakespeare , 19 2 Spider-Man (movie) , 20 2 Ron Wilson , 21 2 Joe Biden , 22 2 Fight Club (film) , 23 2 Main Page/OtherLanguages , 24 2 Jimmy Calderwood , 25 2 Mike Shinoda

nov 2008: 1 6 Theodore Roosevelt , 2 6 Joe Biden , 3 5 Elizabeth I of England , 4 4 Charles II of England , 5 4 Jim Starlin , 6 4 Charles I of England , 7 4 Tony Blair , 8 4 Hillary Rodham Clinton , 9 4 Fight Club (film) , 10 4 Barack Obama , 11 4 Jessica Alba , 12 4 Gerald Ford , 13 4 Bill Clinton , 14 4 Derek Jeter , 15 4 Main Page , 16 3 Mary I of Scotland , 17 3 Elizabeth II of the United Kingdom , 18 3 Mary I of England , 19 3 David Ben-Gurion , 20 3 George IV of the United Kingdom , 21 3 George III of the United Kingdom , 22 3 James II of England , 23 3 Pete Rose , 24 3 Herbert Hoover , 25 3 Lyndon B. Johnson

dez 2008: 1 4 Voltaire , 2 3 Denis Diderot , 3 3 Charles Darwin , 4 3 School of Rock , 5 3 Vladimir Nabokov , 6 3 Gregory Balestrero , 7 3 Lech Wałęsa , 8 3 William Gladstone , 9 3 Warren G. Harding , 10 3 Kurt Cobain , 11 2 Chris Shays , 12 2 Ray Comfort , 13 2 Friedrich Nietzsche , 14 2 Ayn Rand , 15 2 Phil Collins , 16 2 A Christmas Carol , 17 2 René Descartes , 18 2 Albert Camus , 19 2 Xenophon , 20 2 William McKinley , 21 2 William Howard Taft , 22 2 Woodrow Wilson , 23 2 Lady Randolph Churchill , 24 2 Lord Randolph Churchill , 25 2 Helen Keller

jan 2009: 1 4 Thomas Jefferson , 2 4 Expelled: No Intelligence Allowed , 3 4 Joe Biden , 4 4 The Dark Knight , 5 4 Brian Wilson , 6 4 Jesus , 7 3 William Joyce , 8 3 George III of the United Kingdom , 9 3 Georges Guynemer , 10 3 Elizabeth I of England , 11 3 Al Gore , 12 3 Barack Obama , 13 3 Ben Stein , 14 3 Gerald Ford , 15 3 Richard Nixon , 16 3 Fireproof , 17 3 Flip Wilson , 18 3 Spirited Away , 19 3 Abigail Adams , 20 2 Love , 21 2 Erica Jong , 22 2 The Lion King , 23 2 Henry Brooks Adams , 24 2 Naruto , 25 2 Scott Adams

fev 2009: 1 5 Adventures in Odyssey , 2 3 Shigeru Miyamoto , 3 3 Wallis, Duchess of Windsor , 4 3 Spider-Man (movie) , 5 3 September 11, 2001 attacks , 6 3 Dwight D. Eisenhower , 7 3 Hank Aaron , 8 3 Jackie Robinson , 9 3 David Ortiz , 10 3 Friendship , 11 2 Down Gilead Lane , 12 2 Thomas Edison , 13 2 The Fox and the Hound , 14 2 Nicholas Negroponte , 15 2 Facing the Giants , 16 2 Todd Friel , 17 2 Mary I of England , 18 2 Main Page/Community , 19 2 Roberto Clemente , 20 2 Gerald Ford , 21 2 George H. W. Bush , 22 2 Richard Nixon , 23 1 Tim Huelskamp

mar 2009: 1 3 Robin Hobb , 2 3 The Fox and the Hound , 3 3 Charles Darwin , 4 3 Romeo and Juliet , 5 3 List of themes , 6 2 Discworld , 7 2 Horatio Nelson , 8 2 Julius Caesar , 9 2 Otto von Bismarck , 10 2 Aldous Huxley , 11 2 Matthew Bellamy , 12 2 Milton Friedman , 13 2 Chester A. Arthur , 14 2 Borat: Cultural Learnings of America for Make Benefit Glorious Nation of Kazakhstan , 15 2 Mary I of Scotland , 16 2 Thomas Jefferson , 17 2 Expelled: No Intelligence Allowed , 18 2 Kurt Cobain , 19 1 John Milton

abr 2009: 1 10 Jimmy Wales , 2 5 Julius Caesar , 3 5 George Washington , 4 5 Mohandas Gandhi , 5 4 François Mitterrand , 6 4 Stephen Hawking , 7 4 John Milton , 8 4 Erica Jong , 9 4 Barack Obama , 10 4 Kirk Cameron , 11 4 Harry S. Truman , 12 4 Bill Clinton , 13 4 Sean Hannity , 14 4 Terry Pratchett , 15 4 Paula Abdul , 16 4 Charles Spurgeon , 17 4 Romeo and Juliet , 18 3 Joseph Addison , 19 3 Adolf Hitler , 20 3 Louis Riel , 21 3 Winter , 22 3 Kedar Joshi , 23 3 Ludwig van Beethoven , 24 3 Macbeth , 25 3 Niccolò Machiavelli

mai 2009: 1 5 Joseph Stalin , 2 5 Jimmy Wales , 3 4 Barry George , 4 4 Ted Bundy , 5 4 Hermann Göring , 6 4 Alex Rodriguez , 7 4 Charles Spurgeon , 8 3 Mark Bellinghaus , 9 3 Louis Riel , 10 3 John Milton , 11 3 Erica Jong , 12 3 Albert Camus , 13 3 Theodore Roosevelt , 14 3 Al Gore , 15 3 Terry Pratchett , 16 3 Winston Churchill , 17 3 Jane Ace , 18 3 William Shakespeare , 19 2 The Fellowship of the Ring , 20 2 Arthur Wellesley, 1st Duke of Wellington , 21 2 Joan of Arc , 22 2 Joseph Addison , 23 2 Polly Toynbee , 24 2 François Mitterrand , 25 2 Francis Bacon

jun 2009: 1 3 Paws & Tales , 2 2 William Carlos Williams , 3 2 John Milton , 4 2 Horatio Nelson , 5 2 Ulysses S. Grant , 6 2 Woodrow Wilson , 7 2 Spiro Agnew , 8 2 Abraham Lincoln , 9 2 Paula Abdul , 10 2 Charles Spurgeon , 11 2 Pablo Picasso , 12 2 Richard Buckminster Fuller , 13 2 Friedrich Kellner , 14 2 Jane Addams , 15 2 Emily Brontë , 16 2 John Keats , 17 2 Albert Einstein

jul 2009: 1 3 The Fellowship of the Ring , 2 3 Barack Obama , 3 3 Pablo Picasso , 4 2 Louis Riel , 5 2 John Milton , 6 2 Gautama Buddha , 7 2 Jimmy Wales , 8 2 Timothy Leary , 9 2 Terry Pratchett , 10 1 Charles John Huffam Dickens FRSA

ago 2009: 1 4 Miley Cyrus , 2 4 Arthur C. Clarke , 3 4 Mary Shelley , 4 4 Woody Allen , 5 4 James Woods , 6 4 Bertie Ahern , 7 4 George W. Bush , 8 3 Bob Dole , 9 3 Harry Potter and the Philosopher's Stone , 10 3 Harry Potter (series) , 11 3 Dan Quayle , 12 3 Harry Potter and the Chamber of Secrets , 13 3 Aaron Burr , 14 3 Steve Ballmer , 15 3 Leo Burnett , 16 3 Edwin Armstrong , 17 3 John Steinbeck , 18 3 Rick Riordan , 19 3 Harry Potter and the Prisoner of Azkaban , 20 3 Harry Potter and the Goblet of Fire , 21 3 Harry Potter and the Order of the Phoenix , 22 3 Harry Potter and the Half-Blood Prince , 23 3 Harry Potter and the Deathly Hallows , 24 3 James Wood , 25 3 Isaac Newton

set 2009: 1 4 Memory , 2 4 Michael Jackson , 3 4 Sonia Sotomayor , 4 4 Miley Cyrus , 5 4 List of themes , 6 3 Norman Ralph Augustine , 7 3 Robert Baden-Powell , 8 3 Nicolas Sarkozy , 9 3 IPod , 10 3 Steve Jobs , 11 3 Michael Catt , 12 3 John F. Kennedy , 13 2 Muhammad Ali Jinnah , 14 2 Connecticut , 15 2 Hans Christian Andersen , 16 2 Chuck Hagel , 17 2 Piers Anthony , 18 2 Trent Lott , 19 2 Peter Akinola , 20 2 Boris Berezovsky , 21 2 Courage , 22 2 Ho Chi Minh , 23 2 Politics , 24 2 The Hours , 25 2 Fred Thompson

out 2009: 1 2 Urdu proverbs , 2 2 Diogenes Laërtius , 3 2 Ansel Adams , 4 2 Gabriel Biel , 5 2 Simone de Beauvoir , 6 2 Roland Barthes , 7 2 Alain Badiou , 8 2 Anthony Trollope , 9 2 Dave Barry , 10 2 Courage , 11 2 Sexuality , 12 2 Miley Cyrus , 13 2 Phil Collins , 14 2 Groucho Marx , 15 2 Alphonse Allais

nov 2009: 1 3 List of themes , 2 1 Martin Luther King Jr

dez 2009: 1 2 Zack de la Rocha , 2 2 John Adams , 3 1 Rick Riordan

jan 2010: 1 4 Jonathan Park , 2 4 Jesus , 3 3 Buzz Aldrin , 4 2 Harry Potter and the Chamber of Secrets

fev 2010: 1 3 Ted Kennedy , 2 2 Samuel Butler (novelist) , 3 2 Robert Frost , 4 2 Russell Baker , 5 2 Ansel Adams , 6 2 David Brin , 7 2 Gholam-Reza Aghazadeh , 8 2 Michael Jackson , 9 2 Vladimir Putin , 10 1 Anarky

jan 2011: 1 1 Thomas Jefferson

jan 2013: 1 1 The Sound of Music

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:28 (final run)

Dump file simplewikiquote-20190101-stub-meta-history.xml.gz (edits only), size 1.7 Mb as gz -> 12 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:18 after 8 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.