Estatísticas da Wikiquote albanês
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here
 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions

 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 20180%   0%   -63%    () 0%
nov 2018+4%   +2%   +70%    () +23%
out 20180%   0%   -93%    () 0%
set 2018+8%   +3%   +313%    () +79%
ago 2018+8%   +5%        () 0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201829 3 202 14 34    ( ) 53
nov 20182912 201 13,9 92    ( ) 53
out 201828 2 198 13,6 54    ( ) 43
set 201828231198 13,4 777    ( ) 43
ago 201826221193 9,7 188    ( ) 24
jul 201824   183 9,2 1    ( ) 24
jun 201824   183 9,2 2    ( ) 24
mai 201824   183 9,2 1    ( ) 24
abr 201824   183 9,2 6    ( ) 24
mar 201824   183 9,1 2    ( ) 24
fev 201824   183 9,1 4    ( ) 24
jan 201824   183 9,1 2    ( ) 24
dez 201724   183 9,1 2    ( ) 24
nov 201724   183 9,1 7    ( ) 24
out 201724   183 9 8    ( ) 24
set 201724   181 9,1 12    ( ) 24
ago 20172411 181 9 25    ( ) 24
jul 201723   178 9 1    ( ) 22
jun 201723   177 9,1 2    ( ) 22
mai 201723   177 9,1 4    ( ) 22
abr 20172312 177 9,1 49    ( ) 22
mar 201722   167 9,3 8    ( ) 22
fev 201722   166 9,3 2    ( ) 21
jan 201722   166 9,3 3    ( ) 21
dez 201622   166 9,3 4    ( ) 21
nov 201622   166 9,3      ( ) 21
out 201622   166 9,3      ( ) 21
set 201622   166 9,3 1    ( ) 21
ago 201622   166 9,2 2    ( ) 21
jul 20162211 165 9,3 13    ( ) 21
jun 201621   161 9,4 25    ( ) 20
mai 201621   159 9,4      ( ) 20
abr 201621   159 9,4 3    ( ) 20
mar 201621   159 9,4 1    ( ) 20
fev 201621   159 9,4      ( ) 20
jan 20162122 159 9,4 42    ( ) 20
dez 201519 1 152 9,5 7    ( ) 20
nov 201519   151 9,5 2    ( ) 20
out 20151911 151 9,5 13    ( ) 20
set 201518   151 9,5      ( ) 15
ago 2015181  151 9,5 10    ( ) 15
jul 201517   151 9,4 2    ( ) 15
jun 201517   151 9,4      ( ) 15
mai 201517   151 9,4 2    ( ) 15
abr 201517   151 9,4 11    ( ) 15
mar 201517 1 148 9,5 7    ( ) 15
fev 201517   146 9,6      ( ) 15
jan 201517   146 9,6 3    ( ) 15
dez 201417   146 9,5 1    ( ) 15
nov 201417 1 146 9,5 8    ( ) 15
out 201417   145 9,5 3    ( ) 15
set 201417   144 9,6 2    ( ) 15
ago 201417   143 9,6 3    ( ) 15
jul 201417   143 9,6      ( ) 15
jun 201417   143 9,6      ( ) 15
mai 201417   143 9,6 1    ( ) 15
abr 20141721 143 9,6 84    ( ) 15
mar 201415   143 9      ( ) 15
fev 201415   143 9 1    ( ) 15
jan 201415   143 9      ( ) 15
dez 201315   143 9 1    ( ) 15
nov 201315   143 9      ( ) 15
out 201315   143 9 12    ( ) 15
set 201315 1 143 8,9 13    ( ) 15
ago 20131511 143 8,8 11    ( ) 15
jul 201314   143 8,8      ( ) 15
jun 201314 1 143 8,8 20    ( ) 15
mai 201314   143 8,6 2    ( ) 15
abr 201314   143 8,6 4    ( ) 15
mar 201314   143 8,6 1    ( ) 15
fev 201314   143 8,6      ( ) 15
jan 201314 1 143 8,6 28    ( ) 15
dez 201214   143 8,4 2    ( ) 15
nov 201214   143 8,4 11    ( ) 15
out 201214   143 8,3 5    ( ) 15
set 201214   143 8,2 7    ( ) 15
ago 201214   143 8,2 8    ( ) 15
jul 2012141  143 8,1 22    ( ) 15
jun 201213   143 8 9    ( ) 15
mai 201213   143 7,9 5    ( ) 15
abr 2012131  143 7,9 15    ( ) 15
mar 201212   143 7,8 6    ( ) 15
fev 201212 1 143 7,7 13    ( ) 15
jan 201212 1 143 7,7 14    ( ) 15
dez 201112 1 143 7,6 6    ( ) 15
nov 201112   143 7,5 6    ( ) 15
out 201112 1 142 7,5 28    ( ) 15
set 201112   142 7,3 13    ( ) 15
ago 201112   142 7,2 6    ( ) 15
jul 201112   142 7,2 26    ( ) 15
jun 201112   142 7 1    ( ) 15
mai 201112   142 7 1    ( ) 15
abr 201112   142 7 4    ( ) 15
mar 20111211 142 7 34    ( ) 14
fev 201111   142 6,7 6    ( ) 14
jan 201111   142 6,7 9    ( ) 14
dez 201011 1 142 6,6 20    ( ) 14
nov 201011   139 6,6 13    ( ) 14
out 2010111  139 6,5 14    ( ) 14
set 201010   139 6,4 10    ( ) 14
ago 201010   139 6,4 13    ( ) 14
jul 201010   139 6,3 18    ( ) 14
jun 201010   137 6,2 10    ( ) 14
mai 201010   137 6,1 9    ( ) 14
abr 201010   136 6,1 6    ( ) 14
mar 201010   136 6,1 20    ( ) 14
fev 20101011 13615,9 67    ( ) 14
jan 20109   107 6,9 3    ( ) 14
dez 200991  107 6,9 10    ( ) 14
nov 20098   107 6,8 6    ( ) 14
out 20098   107 6,7 65    ( ) 14
set 200981  107 6,1 23    ( ) 14
ago 20097   107 5,9 4    ( ) 14
jul 20097   107 5,9 2    ( ) 14
jun 20097   107 5,9 9    ( ) 14
mai 20097   106 5,8 18    ( ) 13
abr 20097 1 106 5,7 15    ( ) 13
mar 20097   106 5,5 13    ( ) 13
fev 20097   106 5,4 5    ( ) 13
jan 20097   105 5,4 17    ( ) 13
dez 20087   104 5,3 14    ( ) 13
nov 20087 1 104 5,2 8    ( ) 12
out 20087   101 5,2 5    ( ) 12
set 20087   101 5,2 16    ( ) 12
ago 20087   101 5 9    ( ) 12
jul 200871  101 4,9 12    ( ) 12
jun 20086 1 101 4,8 34    ( ) 12
mai 2008611 95 4,8 107    ( ) 11
abr 20085   85 4,1 23    ( ) 7
mar 20085   84 3,8 3    ( ) 7
fev 20085   83 3,8 1    ( ) 7
jan 20085   83 3,8 8    ( ) 6
dez 20075   80 3,9      ( ) 6
nov 20075 1 80 3,9 8    ( ) 6
out 20075   77 3,9 3    ( ) 5
set 20075   77 3,9 2    ( ) 5
ago 20075   76 3,9 5    ( ) 5
jul 20075 1 7513,9 29    ( ) 5
jun 20075 1 52 5,1 28    ( ) 5
mai 20075   42 5,6 13    ( ) 5
abr 20075   41 5,4 4    ( ) 5
mar 20075 1 39 5,6 9    ( ) 5
fev 20075 1 38 5,5 31    ( ) 5
jan 20075 1 32 5,6 24    ( ) 4
dez 20065 1 26 5,9 27    ( ) 4
nov 20065   25 5,1      ( ) 3
out 2006511 25 5,1 20    ( ) 3
set 20064   17 6,3 20    ( ) 3
ago 20064 1 14 6,2 9    ( ) 2
jul 2006411 12 6,5 5    ( ) 2
jun 20063 1 11 6,6 7    ( ) 2
mai 20063   9 7,3 1    ( ) 2
abr 20063   9 7,2      ( ) 2
mar 20063   9 7,2 1    ( ) 2
fev 20063   9 7,1 2    ( ) 2
jan 2006311 9 6,9 16    ( ) 2
dez 20052   9 5,1 3    ( )  
nov 20052 1 9 4,8 8    ( )  
out 20052   8 4,4 3    ( )  
set 2005221 8 4 32    ( )  
 totalnovosediçõescontagemnovos
por dia		médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  5 
dez 20184332    11       2211    
nov 201863222   2111     822111  
out 201822211   2111     521111  
set 20184333211  3111111  3211111 
ago 2018222211   32111    8322111 
jul 20181               1       
jun 20181                       
mai 20181                       
abr 20181               2       
mar 20181      11               
fev 20182      1        1       
jan 2018                        
dez 2017       1        11      
nov 20172                       
out 201721              1       
set 20171               1       
ago 20171111             2111    
jul 2017                        
jun 2017                1       
mai 2017                       1
abr 20172221             2       
mar 201721     1        1       
fev 2017                2       
jan 20171                       
out 201822211   2111     521111  
jul 20181               1       
abr 20181               2       
jan 2018                        
out 201721              1       
jul 2017                        
abr 20172221             2       
jan 20171                       
out 2016       2                
jul 20161111             211111  
abr 2016                1       
jan 20163322             11      
out 20151111             1      1
jul 20151      1        1       
abr 20151      1      221      1
jan 20152      11       11      
out 20141               2       
jul 2014                        
abr 201461111 11         4       
jan 2014       1        31      
out 2013       1        51      
jul 2013                4       
abr 201311              41      
jan 20131111  111        31      
out 2012                41      
jul 20121    21         4       
abr 201211   2 11       411     
jan 2012311   1          611     
out 201121111            3       
jul 2011     111        51      
abr 20113      1        111     
jan 20112    1          4       
out 20102    11         2       
jul 20103    111        2       
abr 2010     1 1        11      
jan 2010       1        2111    
out 20091    11         1111    
jul 2009                2       
abr 2009411     2        421     
jan 20091    2          111     
out 20082      1        322     
jul 2008     11         2       
abr 20081    111        1       
jan 20082      1        3       
out 20071                       
jul 200711111   2        11      
abr 20072      1        11      
jan 20072111             1111    
out 20063211             1       
jul 2006111     421      4311    
abr 2006                        
jan 20061111             1       
out 200511     2        32      

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1100100.0%2,333100.0%
34444.0%2,25696.7%
102828.0%2,14591.9%
321111.0%1,87080.2%
10055.0%1,58768.0%
31611.0%96241.2%

 

3 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions		agoraΔtotalúltimos
30 dias		totalúltimos
30 dias		datadias
atrás		totalúltimos
30 dias		totalúltimos
30 dias
Klein MuçiUC1 0962142,07720ago 10, 201814210---
BerishasinanUC4+11131411-set 20, 20181015---
Besara1UC10+136583nov 03, 20185721--

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions		posiçãototaldatadias
atrás		datadias
atrás
AnankeBotUC2273dez 18, 20083664set 14, 20131933
Ko.S.ystem.OV@UC3127set 19, 20054850nov 04, 20083708
CradelUC5112mai 23, 20083873jun 27, 20093473
PuntoriUC675jun 27, 20064569jan 15, 20084002
Kristiani95UC752fev 19, 20103236mai 31, 20103135
SamoaBotUC847abr 09, 20141726abr 15, 20141720
LaaknorBotUC939jul 18, 20083817jan 01, 20122555
DexbotUC1134abr 08, 20141727ago 19, 20141594
PunëtoriaUC1228mar 21, 2017649ago 09, 2017508
Hipi Zhdripi~sqwikiquoteUC1325set 25, 20054844fev 05, 20093615
Vullneti1UC1422abr 05, 2017634abr 11, 2017628
Bet 0UC1521jan 06, 20064741abr 12, 20074280
MerlIwBotUC1621jul 26, 20122348jun 14, 20132025
Thenie ShqipUC1721jan 05, 20161090jan 06, 20161089
MjbmrbotUC1816fev 04, 20112886mar 28, 20112834
LiridonUC1916jul 07, 2016906set 04, 2016847
TheedardanianUC2014jan 26, 20161069jan 29, 20161066
Rubbish computerUC2113out 27, 20151160out 27, 20151160
ArthurBotUC2212nov 12, 20093335mar 12, 20103215
Idioma-botUC2312jan 01, 20122555jul 16, 20122358

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 264 edições foram feitas por usuários anônimos, de um total de 2826 edições ( 9e %)
  

4 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions		datadias
atrás		datadias
atrás
ChtitBotUC1107abr 19, 20083907fev 06, 20112884--
EleferenBotUC271fev 13, 20103242jan 13, 20132177--
AvicBotUC345jul 10, 20112730set 20, 2018101--
AvocatoBotUC46abr 17, 20122448abr 17, 20122448--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
dez 20182553636121315510111       2
nov 20182543636121315410111       2
out 2018241362562101539110       2
set 2018241360512101509107       2
ago 20182173604821098891       2
jul 20182073581821080 45       2
jun 20182073581821080 45       2
mai 20182073581821080 45       2
abr 20182073581821080 45       2
mar 20182073561821080 45       2
fev 20182073561821080 45       2
jan 20182073551821080 45       2
dez 20172073551821080 45       2
nov 20172073531821080 45       2
out 20172073531821080 45       2
set 20172053521821080 45       2
ago 20172053511821080 45       2
jul 20172003501821080 40       2
jun 20171993501821080 40       2
mai 20171993501821080 40       2
abr 20171993501821080 40       2
mar 20171893501821080 39       2
fev 20171873501821080 38       2
jan 20171873481821080 38       2
dez 20161873481821080 38       2
nov 20161873481821080 38       2
out 20161873481821080 38       2
set 20161873481821080 38       2
ago 20161873481821080 38       2
jul 20161863471721080 38       2
jun 2016181345521044 35       2
mai 2016179345521044 35       2
abr 2016179344521044 35       2
mar 2016179343521044 35       2
fev 2016179343521043 35       2
jan 2016179343521043 35       2
dez 2015172342521043 33       2
nov 2015171339521043 33       2
out 2015171339521043 33       2
set 2015166339521036 33       2
ago 2015166339521036 33       2
jul 2015166339521036 33       2
jun 2015166338521036 33       2
mai 2015166338521036 33       2
abr 2015166338521036 33       2
mar 2015163337521036 33       2
fev 2015161337521036 32       2
jan 2015161333521036 32       2
dez 2014161331521036 32       2
nov 2014161331521036 32       2
out 2014160328521036 32       2
set 2014159327521036 32       2
ago 2014158323521036 32       2
jul 2014158320521036 32       2
jun 2014158320521036 32       2
mai 2014158320521036 32       2
abr 2014158320521036 32       2
mar 2014158317521036 32       2
fev 2014158315521036 32       2
jan 2014158312521036 32       2
dez 2013158308521036 32       2
nov 2013158308521036 32       2
out 2013158303521036 32       2
set 2013158299521036 32       2
ago 2013158286521036 32       2
jul 2013158283521036 32       2
jun 2013158281521036 32       2
mai 2013158279521036 32       2
abr 2013158278521036 32       2
mar 2013158275521036 32       2
fev 2013158270521036 32       2
jan 2013158264521036 32       2
dez 2012158263521036 32       2
nov 2012158260521036 32       2
out 2012158260521036 32       2
set 2012158256521036 32       2
ago 2012158253521036 32       2
jul 2012158249521036 32       2
jun 2012158247521036 32       2
mai 2012158243521036 32       2
abr 2012158240521036 32       2
mar 2012158233521036 32       2
fev 2012158232521036 32       2
jan 2012158226421036 32       2
dez 2011158220421036 32       2
nov 2011158217421036 32       2
out 2011157206421036 32       2
set 2011157202421036 32       2
ago 2011157197421036 32       2
jul 2011157195421036 32       2
jun 2011157186421036 32       2
mai 2011157182421036 32       2
abr 2011157178421036 32       2
mar 2011156173421036 32       2
fev 2011156173421036 32       2
jan 2011156168421036 32       2
dez 2010156165421036 32       2
nov 2010153162321034 32       2
out 201015316032934 32       2
set 201015315832934 32       2
ago 201015315432934 32       2
jul 201015314232934 32       2
jun 201015114032934 32       2
mai 201015113232934 32       2
abr 201015013032934 32       2
mar 201015012732934 32       2
fev 201015012432934 32       2
jan 201012112132934 32       2
dez 200912110932934 32       2
nov 200912110832934 32       2
out 200912110632934 32       2
set 200912110532923 32       2
ago 200912110132923 32       2
jul 200912110132923 32       2
jun 20091219932923 32       2
mai 20091199832922 32       2
abr 20091199632922 32       2
mar 20091198732922 32       2
fev 20091198432922 32       2
jan 20091188032922 32       2
dez 20081178032922 32       2
nov 20081167732922 32       2
out 20081136532822 31       2
set 20081135332822 31       2
ago 20081135132822 31       2
jul 20081134932821 30       2
jun 20081134832821 30       2
mai 20081064431511 29       1
abr 2008923821510 29       1
mar 2008913521510 29       1
fev 2008903321510 29       1
jan 2008893321510 29       1
dez 2007863021510 29       1
nov 2007862721510 29       1
out 2007822621510 27       1
set 2007822621510 27       1
ago 2007812621510 27       1
jul 2007802621510 27       1
jun 2007572621510 24       1
mai 200747262154 22       1
abr 200746262154 22       1
mar 200744262154 19       1
fev 200743252153 19       1
jan 200736242153 18       1
dez 200630232132 15       1
nov 200628232131 2       1
out 200628232131 2       1
set 200620232131 1       1
ago 200616232131 1       1
jul 200614222131 1       1
jun 20061351131 1       1
mai 20061141131 1       1
abr 20061141131 1       1
mar 20061141131 1       1
fev 20061141131 1       1
jan 20061141131 1       1
dez 2005931131 1       1
nov 2005931121 1       1
out 2005831121         1
set 2005831 2           

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons
 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2005: 1 3 Faqja kryesore , 2 1 Ismet Toto

out 2005: 1 1 John F. Kennedy

nov 2005: 1 1 Fjalë të urta shqiptare

dez 2005: 1 1 Fjalë të urta shqiptare

jan 2006: 1 1 Naim Frasheri

jun 2006: 1 1 Arthur Schopenhauer

jul 2006: 1 1 Ernesto Che Guevara

ago 2006: 1 1 Mahatma Gandhi

set 2006: 1 1 Phil Barker

out 2006: 1 2 Faqja kryesore , 2 1 Napoleon Hill

dez 2006: 1 1 Xhozef Marfi

jan 2007: 1 1 Nikolo Makiaveli

fev 2007: 1 1 Humori

mar 2007: 1 2 The Crow , 2 1 Lufta

abr 2007: 1 2 Stephen Hawking

mai 2007: 1 1 Napoleon Hill

jun 2007: 1 1 Pashko Vasa

jul 2007: 1 1 Gustav Flober

ago 2007: 1 1 Sali Berisha

out 2007: 1 1 Piratët e Karaibeve: Në fund të botës

nov 2007: 1 1 John Abbott

jan 2008: 1 1 Për ca dollarë më shumë

abr 2008: 1 1 Anna-Maria Ravnopolska-Dean

mai 2008: 1 2 George W. Bush , 2 1 Çarli Çaplin

jun 2008: 1 2 Pablo Picasso , 2 2 Fjalë të urta shqiptare , 3 1 Shpresa

ago 2008: 1 1 Friedrich Nietzsche

out 2008: 1 1 Marilyn Ferguson

nov 2008: 1 1 Ciceroni

dez 2008: 1 1 Aleksander Stavre Drenova

jan 2009: 1 1 Shoqëria

fev 2009: 1 1 Fethullah Gylen

mar 2009: 1 1 Albert Einstein

abr 2009: 1 1 George Washington

mai 2009: 1 1 Fjalë të urta shqiptare

jun 2009: 1 1 Jean-Paul Sartre

out 2009: 1 1 Pablo Picasso

nov 2009: 1 1 Jean-Paul Sartre

fev 2010: 1 1 Rexhep Qosja

mar 2010: 1 1 Nikolo Makiaveli

mai 2010: 1 1 Sokrati

jul 2010: 1 1 Erih Maria Remark

ago 2010: 1 1 Faqja kryesore

set 2010: 1 1 Henry David Thoreau

out 2010: 1 1 Jim Morrison

nov 2010: 1 1 Taras Shevchenko

dez 2010: 1 2 Abraham Lincoln , 2 1 Kur'ani

jan 2011: 1 1 Abraham Lincoln

fev 2011: 1 1 Jorgos Seferis

mar 2011: 1 2 Nënë Tereza , 2 2 Guximi

abr 2011: 1 1 Faqja Kryesore

jun 2011: 1 1 Ernest Renan

set 2011: 1 1 Fjalë të urta angleze

out 2011: 1 1 Leo Tolstoy

nov 2011: 1 1 Jani Minga

dez 2011: 1 1 Arti

jan 2012: 1 1 Leo Tolstoy

fev 2012: 1 2 Thomas Paine , 2 1 Sokrati

mar 2012: 1 1 Ayrton Senna

abr 2012: 1 1 Nënë Tereza

jul 2012: 1 1 Kur'ani

set 2012: 1 1 Anchorman: The Legend of Ron Burgundy

nov 2012: 1 1 Zoti

dez 2012: 1 1 Guximi

jan 2013: 1 1 Muhammedi

abr 2013: 1 1 Fjalë të urta angleze

mai 2013: 1 1 Friedrich Nietzsche

jun 2013: 1 1 Sokrati

ago 2013: 1 1 Muhammedi

set 2013: 1 1 Johann Wolfgang von Goethe

dez 2013: 1 1 Albert Einstein

abr 2014: 1 1 Muhammedi

set 2014: 1 1 Margaret Thatcher

out 2014: 1 1 Mark Twain

nov 2014: 1 1 True Detective

jan 2015: 1 1 Jim Morrison

mar 2015: 1 1 Ebubekir Sifil

abr 2015: 1 1 Enver Hoxha

mai 2015: 1 1 Fjalë të urta shqiptare

jul 2015: 1 1 Oscar Wilde

out 2015: 1 1 Skender H Skenderi

dez 2015: 1 1 Alfonso Signorini

jan 2016: 1 2 Charlie Chaplin , 2 1 Ronald Reagan

mar 2016: 1 1 George Bush

jul 2016: 1 1 Cory Doctorow

ago 2016: 1 1 Jean de La Bruyère

set 2016: 1 1 Shkenca

dez 2016: 1 1 Mihal Grameno

jan 2017: 1 1 Fjalë të urta shqiptare

mar 2017: 1 1 Nikolaj Frederik Severin Grundtvig

abr 2017: 1 1 Rabindranath Tagore

ago 2017: 1 1 Gjergj fishta

set 2017: 1 1 Ferdije Zhushi Etemi

out 2017: 1 2 Fjalë të urta shqiptare

nov 2017: 1 1 Horaci

fev 2018: 1 2 Arthur Schopenhauer

mar 2018: 1 1 Fan Noli

abr 2018: 1 1 William Shakespeare

mai 2018: 1 1 Aristoteli

jun 2018: 1 1 Abraham Maslow

jul 2018: 1 1 Abraham Maslow

ago 2018: 1 2 Tigri

set 2018: 1 3 Arthur Schopenhauer , 2 2 Denis Waitley , 3 2 Arben Duka , 4 2 Daut Demaku , 5 2 Ferdije Zhushi Etemi , 6 2 Cory Doctorow , 7 2 Georg Christoph Lichtenberg , 8 2 Donald Trump , 9 2 Edgar Allan Poe , 10 2 Alfonso Signorini , 11 2 Dritëro Agolli , 12 2 Enver Hoxha , 13 2 Erih Maria Remark , 14 2 Euripidi , 15 2 Fan Noli , 16 2 George W. Bush , 17 2 Hasan Tahsini , 18 2 Ayrton Senna , 19 2 George H. W. Bush , 20 2 Henry David Thoreau , 21 2 Agim Çeku , 22 2 Hasan Prishtina

out 2018: 1 2 Ismail Kadare , 2 2 Leonardo da Vinci , 3 1 Shqiptarët

nov 2018: 1 3 Harry Potter dhe Princi Gjakpërzier (libri) , 2 2 Johann Wolfgang von Goethe , 3 1 Harry Potter dhe Guri Filozofal (libri)

dez 2018: 1 2 Harry Potter dhe Dhoma e të Fshehtave (libri) , 2 2 Harry Potter dhe Guri Filozofal (libri)

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file sqwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 400 kb as gz -> 2.9 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:15 after 5 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.