Estatísticas da Wikiquote sundanês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2018    +1%        () 0%
jul 2018    0%        () +7%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20184   1,3 k 1,4 1    ( ) 31
nov 20184   1,3 k 1,4 2    ( ) 31
out 20184   1,3 k 1,4 2    ( ) 31
set 20184   1,3 k 1,4      ( ) 31
ago 20184 1 1,3 k 1,4 18    ( ) 31
jul 20184 1 1,3 k 1,4 5    ( ) 31
jun 20184   1,3 k 1,4 2    ( ) 29
mai 20184   1,3 k 1,4      ( ) 29
abr 2018412 1,3 k 1,4 39    ( ) 29
mar 20183 1 1,3 k 1,4 6    ( ) 27
fev 20183 1 1,3 k 1,4 7    ( ) 27
jan 20183   1,3 k 1,4      ( ) 27
dez 20173   1,3 k 1,4      ( ) 27
nov 20173 1 1,3 k 1,4 6    ( ) 27
out 20173   1,3 k 1,4      ( ) 26
set 20173   1,3 k 1,4 4    ( ) 26
ago 20173   1,3 k 1,4 1    ( ) 26
jul 20173   1,3 k 1,4 1    ( ) 26
jun 20173   1,3 k 1,4      ( ) 26
mai 20173 111,3 k41,4 151    ( ) 26
abr 20173 111,1 k31,4 103    ( ) 21
mar 20173   1,1 k 1,4 4    ( ) 21
fev 20173   1,0 k 1,4 13    ( ) 21
jan 20173   1,0 k 1,4      ( ) 21
dez 20163   1,0 k 1,4 1    ( ) 21
nov 20163   1,0 k 1,4      ( ) 21
out 20163   1,0 k 1,4      ( ) 21
set 20163   1,0 k 1,4      ( ) 21
ago 20163   1,0 k 1,4      ( ) 21
jul 20163   1,0 k 1,4      ( ) 21
jun 20163   1,0 k 1,4      ( ) 21
mai 20163   1,0 k 1,4 1    ( ) 21
abr 20163   1,0 k 1,4      ( ) 21
mar 20163   1,0 k 1,4      ( ) 21
fev 20163   1,0 k 1,4      ( ) 21
jan 20163   1,0 k 1,4 2    ( ) 21
dez 20153   1,0 k 1,4      ( ) 21
nov 20153   1,0 k 1,4      ( ) 21
out 20153   1,0 k 1,4      ( ) 21
set 20153   1,0 k 1,4      ( ) 21
ago 20153 1 1,0 k 1,4 14    ( ) 21
jul 20153 111,0 k51,4 216    ( ) 21
jun 20153 1189151,4 188    ( ) 15
mai 20153 1 72921,5 67    ( ) 13
abr 20153 1166931,5 135    ( ) 13
mar 20153 1 57111,5 33    ( ) 13
fev 20153111551191,5 779    ( ) 13
jan 20152   15 4,1 2    ( ) 5
dez 20142   15 3,9      ( ) 5
nov 20142   15 3,9 2    ( ) 5
out 20142   15 3,8 2    ( ) 5
set 20142   15 3,7      ( ) 5
ago 20142   15 3,7      ( ) 5
jul 20142   15 3,7      ( ) 5
jun 20142   15 3,7      ( ) 5
mai 20142   15 3,7      ( ) 5
abr 20142   15 3,7 1    ( ) 5
mar 20142   15 3,6      ( ) 5
fev 20142   15 3,6      ( ) 5
jan 20142   15 3,6      ( ) 5
dez 20132   15 3,6      ( ) 5
nov 20132   15 3,6      ( ) 5
out 20132   15 3,6      ( ) 5
set 20132   15 3,6      ( ) 5
ago 20132   15 3,6      ( ) 5
jul 20132   15 3,6      ( ) 5
jun 20132   15 3,6      ( ) 5
mai 20132   15 3,6      ( ) 5
abr 20132   15 3,6      ( ) 5
mar 20132   15 3,6      ( ) 5
fev 20132   15 3,6      ( ) 5
jan 20132   15 3,6      ( ) 5
dez 20122   15 3,6      ( ) 5
nov 20122   15 3,6      ( ) 5
out 20122   15 3,6      ( ) 5
set 20122   15 3,6      ( ) 5
ago 20122   15 3,6      ( ) 5
jul 20122   15 3,6 1    ( ) 5
jun 20122   15 3,5      ( ) 5
mai 20122   15 3,5      ( ) 5
abr 20122   15 3,5      ( ) 5
mar 20122   15 3,5      ( ) 5
fev 20122   15 3,5      ( ) 5
jan 20122   15 3,5      ( ) 5
dez 20112   15 3,5      ( ) 5
nov 20112   15 3,5      ( ) 5
out 20112   15 3,5      ( ) 5
set 20112   15 3,5      ( ) 5
ago 20112   15 3,5      ( ) 5
jul 20112   15 3,5      ( ) 5
jun 20112   15 3,5      ( ) 5
mai 20112   15 3,5      ( ) 5
abr 20112   15 3,5      ( ) 5
mar 20112   15 3,5      ( ) 5
fev 20112   15 3,5      ( ) 5
jan 20112   15 3,5      ( ) 5
dez 20102   15 3,5      ( ) 5
nov 20102   15 3,5 5    ( ) 5
out 20102   15 3,2      ( ) 5
set 20102   15 3,2      ( ) 5
ago 20102   15 3,2      ( ) 5
jul 20102   15 3,2      ( ) 5
jun 20102   15 3,2      ( ) 5
mai 20102   15 3,2      ( ) 5
abr 20102   15 3,2      ( ) 5
mar 20102   15 3,2      ( ) 5
fev 20102   15 3,2      ( ) 5
jan 20102   15 3,2      ( ) 5
dez 20092   15 3,2      ( ) 5
nov 20092   15 3,2      ( ) 5
out 20092   15 3,2 1    ( ) 5
set 20092   15 3,1      ( ) 5
ago 20092   15 3,1      ( ) 5
jul 20092   15 3,1      ( ) 5
jun 20092   15 3,1      ( ) 5
mai 20092   15 3,1      ( ) 5
abr 20092   15 3,1      ( ) 5
mar 20092   15 3,1      ( ) 5
fev 20092   15 3,1      ( ) 5
jan 20092   15 3,1      ( ) 5
dez 20082   15 3,1      ( ) 5
nov 20082   15 3,1      ( ) 5
out 20082   15 3,1      ( ) 5
set 20082   15 3,1      ( ) 5
ago 20082   15 3,1      ( ) 5
jul 20082   15 3,1      ( ) 5
jun 20082   15 3,1 2    ( ) 5
mai 20082   15 3      ( ) 4
abr 20082   15 3      ( ) 4
mar 20082   15 3      ( ) 4
fev 20082   15 3      ( ) 4
jan 20082   15 3      ( ) 4
dez 20072 1 15 3 7    ( ) 4
nov 20072   8 4,8      ( ) 4
out 20072   8 4,8      ( ) 4
set 20072   8 4,8      ( ) 4
ago 20072   8 4,8      ( ) 4
jul 20072   8 4,8      ( ) 4
jun 2007211 8 4,8 11    ( ) 4
mai 20071   1 27      ( ) 1
abr 20071   1 27      ( ) 1
mar 20071   1 27 4    ( ) 1
fev 20071   1 23      ( ) 1
jan 20071   1 23      ( ) 1
dez 20061   1 23      ( ) 1
nov 20061   1 23      ( ) 1
out 20061   1 23 2    ( ) 1
set 20061   1 21 4    ( ) 1
ago 20061   1 17 3    ( ) 1
jul 20061   1 14 4    ( ) 1
jun 20061   1 10 2    ( ) 1
mai 20061   1 8 2    ( ) 1
abr 20061   1 6      ( ) 1
mar 20061   1 6 2    ( ) 1
fev 20061   1 4      ( )  
jan 20061   1 4      ( )  
dez 20051   1 4      ( )  
nov 20051   1 4      ( )  
out 20051   1 4      ( )  
set 20051   1 4      ( )  
ago 20051   1 4      ( )  
jul 20051   1 4      ( )  
jun 20051   1 4      ( )  
mai 20051   1 4      ( )  
abr 20051   1 4      ( )  
mar 20051   1 4      ( )  
fev 20051   1 4 2    ( )  
jan 20051   1 2      ( )  
dez 20041   1 2      ( )  
nov 20041   1 2 1    ( )  
out 20041   1 1      ( )  
set 200411  1 1 1    ( )  
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 201863   34 37 56      64
jul 201863 36 34 37 47      64
abr 2018631527 34 37 28      64
jan 201864   34 37        64
out 201764   34 37        64
jul 201764   33 37 56      64
abr 201764 391534436 21      64
jan 201764   35 36        64
out 201664   35 35        64
jul 201664   35 35        64
abr 201664   35 35        64
jan 201664   35 35 56      64
out 201564   34 35        64
jul 201564 401833733 19      64
abr 201564 4216385  23      64
jan 201564   64   59      64
out 201464   64   57      64
jul 201464   64          64
abr 201464   64   62      64
jan 201464   64          64
out 201364   64          64
jul 201364   64          64
abr 201364   64          64
jan 201364   64          64
out 201264   64          64
jul 201264   64   62      64
abr 201264   64          64
jan 201264   64          64
out 201164   64          64
jul 201164   64          64
abr 201164   63          64
jan 201163   63          63
out 201063   62          63
jul 201063   62          63
abr 201063   62          63
jan 201063   62          63
out 200963   61   62      63
jul 200963   61          63
abr 200962   61          63
jan 200961   60          63
out 200861   58          63
jul 200861   58          63
abr 200861   58          63
jan 200860   57          63
out 200759   59          62
jul 200755   57          61
abr 200757   60          61
jan 200757   59          61
out 200657   59   50      61
jul 200657   58   43      61
abr 200656   57          60
jan 200656   56          60
out 200555   56          60
jul 200554   55          59
abr 200554   54          59
jan 200553   45          57
out 200443   36          46
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  1  3  5  5  10  1  3  5  10  25  100  5 
dez 2018           2      
nov 2018                  
out 20181          2      
set 2018                  
ago 20181111               
jul 2018111         1      
jun 20181     1           
mai 2018      1           
abr 20182222        1      
mar 2018111                
fev 2018111                
jan 2018                  
dez 2017      1    11     
nov 2017111                
out 2017           111111 
set 20172          2      
ago 2017                  
jul 2017           2      
jun 2017           1      
mai 2017111111       11111  
abr 2017111111       211111 
mar 201711         11     
fev 2017           2      
jan 2017      1           
out 20181          2      
jul 2018111         1      
abr 20182222        1      
jan 2018                  
out 2017           111111 
jul 2017           2      
abr 2017111111       211111 
jan 2017      1           
out 2016                  
jul 2016           1      
abr 2016           1      
jan 20161                 
out 2015                 1
jul 2015211111  1    21111  
abr 2015111111  21 222111   
jan 20151     11   21     
out 20141     1    3      
jul 2014                  
abr 20141          3      
jan 2014      1    41     
out 2013      1    51     
jul 2013           2      
abr 2013           3      
jan 2013      1    1      
out 2012           31     
jul 2012      1    31     
abr 2012      11   311    
jan 2012           911    
out 2011      1    3      
jul 2011      1    31     
abr 2011           111    
jan 2011           3      
out 2010           1      
jul 2010                  
abr 2010      1    321    
jan 2010      1    1111   
out 20091          1      
jul 2009           1      
abr 2009      1    311    
jan 2009           111    
out 2008      1    222    
jul 2008           1      
abr 2008      1    1      
jan 2008           1      
out 2007                  
jul 2007                  
abr 2007                  
jan 2007                  
out 20061          111    
jul 2006                  
abr 2006                  
jan 2006      1    1      
out 2005                  
jul 2005                  
abr 2005                  
jan 2005                  
out 2004                  

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
117100.0%1,786100.0%
3423.5%1,77099.1%
10317.6%1,76598.8%
3215.9%1,72196.4%
10015.9%1,72196.4%
31615.9%1,72196.4%
100015.9%1,72196.4%

 

17 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Uchup19UC11,721nov 27, 20141494ago 23, 2018129
IrwangatotUC222out 01, 20064473jun 01, 20083864
DARIO SEVERIUC322abr 19, 2018255jun 25, 2018188
AnankeBotUC45nov 03, 20102979nov 03, 20102979
GangleriUC52mar 10, 20064678mar 10, 20064678
ThogoUC62mar 22, 20074301mar 22, 20074301
KumincirUC72out 08, 20141544out 08, 20141544
?UC81set 02, 20045232set 02, 20045232
RapDancerUC91set 04, 20064500set 04, 20064500
KusyadiUC101out 29, 20093349out 29, 20093349
MerlIwBotUC111jul 31, 20122343jul 31, 20122343
John F. LewisUC121abr 11, 20141724abr 11, 20141724
Infinite0694UC131jul 12, 20151267jul 12, 20151267
Syum90UC141jan 22, 20161073jan 22, 20161073
MurbautUC151dez 17, 2016743dez 17, 2016743
AdhianugrahaUC161set 23, 2017463set 23, 2017463
Latifa Rahmatun NisaUC171out 09, 201882out 09, 201882

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 76 edições foram feitas por usuários anônimos, de um total de 1862 edições ( 4e %)
 


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
dez 20181,3 k3213406994240       51
nov 20181,3 k3203406994240       51
out 20181,3 k3203406994240       51
set 20181,3 k3193406994240       51
ago 20181,3 k3193406994240       51
jul 20181,3 k3193406994240       51
jun 20181,3 k3193406994240       51
mai 20181,3 k3193406994240       51
abr 20181,3 k3193406994240       51
mar 20181,3 k3193406994240       51
fev 20181,3 k3193406994240       51
jan 20181,3 k3193406994240       51
dez 20171,3 k3193406994240       51
nov 20171,3 k3173406994240       51
out 20171,3 k3173406994240       51
set 20171,3 k3171776994240       51
ago 20171,3 k3161776994240       51
jul 20171,3 k3161776994240       51
jun 20171,3 k3161776994240       51
mai 20171,3 k3161776994240       51
abr 20171,2 k3161763994234       21
mar 20171,1 k316211981230        1
fev 20171,1 k316211981230        1
jan 20171,1 k314211981230        1
dez 20161,1 k314211981230        1
nov 20161,1 k314211981230        1
out 20161,1 k314211981230        1
set 20161,1 k314211981230        1
ago 20161,1 k314211981230        1
jul 20161,1 k313211981230        1
jun 20161,1 k313211981230        1
mai 20161,1 k313201981230        1
abr 20161,1 k312201981230        1
mar 20161,1 k311201981230        1
fev 20161,1 k311201981230        1
jan 20161,1 k311201981230        1
dez 20151,1 k311201981230        1
nov 20151,1 k308201981230        1
out 20151,1 k308201981230        1
set 20151,1 k308201974230        1
ago 20151,1 k308201974230        1
jul 20151,1 k308201973230        1
jun 201590630720 944225         
mai 201574230716 444125         
abr 201568230716 444125         
mar 201558430614 444125         
fev 201556430614 344125         
jan 2015203015 215 2         
dez 2014202995 214 2         
nov 2014202995 214 2         
out 2014202975 27 2         
set 2014202945 27 2         
ago 2014202915 27 2         
jul 2014202885 27 2         
jun 2014202885 27 2         
mai 2014202885 27 2         
abr 2014202885 27 2         
mar 2014202865 27 2         
fev 2014202835 27 2         
jan 2014202805 27 2         
dez 2013202765 27 2         
nov 2013202765 27 2         
out 2013202735 27 2         
set 2013202695 27 2         
ago 2013202565 27 2         
jul 2013202535 27 2         
jun 2013202505 27 2         
mai 2013202485 27 2         
abr 2013202475 27 2         
mar 2013202445 27 2         
fev 2013202395 27 2         
jan 2013202335 27 2         
dez 2012202325 27 2         
nov 2012202295 27 2         
out 2012202295 27 2         
set 2012202255 27 2         
ago 2012202225 27 2         
jul 2012202185 27 2         
jun 2012202165 27 2         
mai 2012202105 27 2         
abr 2012202075 27 2         
mar 2012202015 27 2         
fev 2012202005 27 2         
jan 2012201925 27 2         
dez 2011201855 27 1         
nov 2011201825 27 1         
out 2011201725 26 1         
set 2011201695 26 1         
ago 2011201655 25 1         
jul 2011201625 25 1         
jun 2011201545 25 1         
mai 2011201505 25 1         
abr 2011201455 25 1         
mar 2011201405 25 1         
fev 2011201395 25 1         
jan 2011201355 25 1         
dez 2010201325 25 1         
nov 2010201305 25 1         
out 2010201285 25 1         
set 2010201275 25 1         
ago 2010201225 25 1         
jul 2010201105 25 1         
jun 2010201105 25 1         
mai 2010201025 25 1         
abr 2010201015 25 1         
mar 201020964 25 1         
fev 201020944 25 1         
jan 201020924 25 1         
dez 200920814 25 1         
nov 200920784 25 1         
out 200920764 25 1         
set 200920763 25 1         
ago 200920723 25 1         
jul 200920723 25 1         
jun 200920713 25 1         
mai 200920703 24 1         
abr 200920693 24 1         
mar 200920613 24 1         
fev 200920593 24 1         
jan 200920553 24 1         
dez 200820553 24 1         
nov 200820523 24 1         
out 200820403 24 1         
set 200820303 24 1         
ago 200820213 24 1         
jul 200820203 24 1         
jun 200820203 24 1         
mai 200819183 24 1         
abr 200819143 24 1         
mar 200819113 24 1         
fev 20081993 24 1         
jan 20081993 24 1         
dez 20071983 24 1         
nov 20071253 24 1         
out 20071243 24 1         
set 20071243 24 1         
ago 20071243 24 1         
jul 20071243 24 1         
jun 20071243 24 1         
mai 2007231 24           
abr 2007231 24           
mar 2007231 24           
fev 2007211 24           
jan 2007211 24           
dez 2006211 24           
nov 2006211 24           
out 2006211 24           
set 2006211 2            
ago 2006211 2            
jul 200621  2            
jun 200621  1            
mai 200621  1            
abr 200621  1            
mar 200621  1            
fev 200611  1            
jan 200611  1            
dez 20051   1            
nov 20051   1            
out 20051   1            
set 20051   1            
ago 20051   1            
jul 20051   1            
jun 20051   1            
mai 20051   1            
abr 20051   1            
mar 20051   1            
fev 20051   1            
jan 20051   1            
dez 20041   1            
nov 20041                
out 20041                
set 20041                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2004: 1 1 Tepas

mar 2006: 1 1 Main Page

set 2006: 1 1 Tepas

out 2006: 1 1 Tepas

mar 2007: 1 1 Tepas

jun 2007: 1 1 Bodo alewoh

dez 2007: 1 1 Ngagulkeun payung butut

jun 2008: 1 1 Uyah mah tara tees ka luhur

out 2009: 1 1 Siga careuh bulan

abr 2014: 1 1 Tepas

out 2014: 1 1 Tepas

nov 2014: 1 1 Tepas

jan 2015: 1 1 Tepas

fev 2015: 1 1 Dibabuklalaykeun

mar 2015: 1 1 Steve Jobs

abr 2015: 1 1 Iwak nangtang sujén

mai 2015: 1 1 Lauk buruk milu mijah

jun 2015: 1 1 Paribasa Sunda R

jul 2015: 1 2 Tamiang meulit ka bitis , 2 1 Adat periuk berkerat, adat lesung berdedak

ago 2015: 1 1 Air yang dingin juga yang memadami api

jan 2016: 1 1 Ini Talk Show

dez 2016: 1 1 Paribasa Jawa P

mar 2017: 1 1 Ayam hitam terbang malam

abr 2017: 1 1 Méméd Sastrahadiprawira

mai 2017: 1 1 Mang Koko

set 2017: 1 1 Segan bergalah, hanyut serantau

nov 2017: 1 1 Piritan milu endogan

fev 2018: 1 1 Tepas

mar 2018: 1 1 Alang berjawab, tepuk berbalas

abr 2018: 1 2 Ayam ditambat disambar elang , 2 2 Ayam bertelur di atas padi mati kelaparan

jun 2018: 1 1 Cikaracak ninggang batu, laun-laun jadi legok

jul 2018: 1 1 Kurung batok

ago 2018: 1 1 Asak rampa

out 2018: 1 1 Buah jatuh tak jauh dari pohonnya

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file suwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 253 kb as gz -> 1.8 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:15 after 4 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.