Estatísticas da Wikisource galês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikilibrariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2018    0%   +529%      0%
jul 2018    +1%          +2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201811   501 4,4 1      124
nov 201811   501 4,4 26      124
out 201811   501 4,4        124
set 201811   501 4,4 2      124
ago 201811   499 4,4 132      124
jul 201811 1 499 4,1 21      124
jun 201811   496 4,1 1      122
mai 201811   496 4,1        122
abr 201811   496 4,1        122
mar 201811   496 4,1 2      122
fev 201811   496 4,1 4      122
jan 201811   496 4,1 1      122
dez 201711   495 4,1        122
nov 201711 1 495 4,1 6      122
out 201711   495 4,1 3      122
set 201711   494 4,1 1      122
ago 201711   494 4,1        122
jul 201711   494 4,1        122
jun 201711   49414,1 21      122
mai 201711   473 4,2 2      122
abr 201711   473 4,2 6      122
mar 201711   472 4,2        122
fev 201711   472 4,2        122
jan 201711   472 4,2 1      122
dez 201611   472 4,2 3      122
nov 201611   471 4,2        122
out 201611 1 471 4,2 6      122
set 20161111 470 4,2 28      122
ago 201610   462 4,2 5      122
jul 201610   461 4,2 1      122
jun 201610   461 4,2        122
mai 201610   461 4,2 4      122
abr 201610   460 4,2 2      122
mar 201610   459 4,2        122
fev 201610 1 45914,2 41      122
jan 201610   425 4,4        121
dez 201510   425 4,4        121
nov 201510   425 4,4        121
out 201510   425 4,4 4      121
set 201510   423 4,5 1      121
ago 201510   423 4,5 1      121
jul 20151011 423 4,4 14      121
jun 20159   414 4,5 1      121
mai 20159   414 4,5        121
abr 201591  414 4,5 1      121
mar 20158   414 4,51830015,8 Mb1,0 M264109919121
fev 20158 1 413 4,51830095,8 Mb1,0 M264109919121
jan 20158   412 4,517803 5,6 Mb990 k261109919121
dez 20148   412 4,51780345,6 Mb990 k261109919121
nov 20148   412 4,51780335,6 Mb990 k261109919121
out 20148   412 4,517802 5,6 Mb990 k261109919121
set 20148   412 4,517802 5,6 Mb990 k261109919121
ago 20148   412 4,517802 5,6 Mb990 k261109919121
jul 20148   412 4,517802 5,6 Mb990 k261109919121
jun 20148   412 4,517802 5,6 Mb990 k261109919121
mai 20148   412 4,517802 5,6 Mb990 k261109919121
abr 20148   412 4,517802 5,6 Mb990 k261109919121
mar 20148   412 4,51780215,6 Mb990 k261109919121
fev 20148   412 4,517802 5,6 Mb990 k261109919121
jan 20148 1141224,5178021945,6 Mb990 k261109919121
dez 20138 2 357 4,618315905,5 Mb1,0 M259137818121
nov 20138 2 351 4,518253275,5 Mb1,0 M258137617121
out 20138   350 4,41826415,5 Mb1,0 M258137617118
set 2013812 349 4,418325425,5 Mb1,0 M258137617118
ago 20137   348 4,318387 5,5 Mb1,0 M259133617115
jul 20137   348 4,31838725,5 Mb1,0 M259133617115
jun 20137   347 4,318387 5,5 Mb1,0 M259133617115
mai 20137   347 4,318387 5,5 Mb1,0 M259133617115
abr 20137   347 4,318387 5,5 Mb1,0 M259133617115
mar 20137   347 4,31838755,5 Mb1,0 M259133617115
fev 20137 1 346 4,31844765,5 Mb1,0 M259133617115
jan 20137 1 345 4,318459175,5 Mb1,0 M259133617115
dez 20127 1 343 4,31847385,5 Mb1,0 M259132617115
nov 20127   341 4,31860235,5 Mb1,0 M257132615115
out 20127   341 4,318602 5,5 Mb1,0 M257103615115
set 20127 2 341 4,318602145,5 Mb1,0 M257103615115
ago 20127 1 340 4,218685225,5 Mb1,0 M257103615115
jul 20127   338 4,218677 5,5 Mb1,0 M257103615114
jun 20127   338 4,218677 5,5 Mb1,0 M257103615114
mai 20127   338 4,21867715,5 Mb1,0 M257103615114
abr 20127 1 337 4,21874255,5 Mb1,0 M257103615114
mar 20127 1 336 4,218755835,5 Mb1,0 M257103615114
fev 20127 1132714,1188191015,5 Mb1,0 M257102615114
jan 20127 1 301 4,119260385,5 Mb1,0 M252102515114
dez 20117 1 297 419685175,5 Mb1,0 M251102515114
nov 20117   296 41925235,5 Mb1,0 M251101515114
out 20117 1 296 3,91925275,5 Mb1,0 M25172515114
set 20117 1 296 3,919323155,5 Mb1,0 M25168515114
ago 20117   295 3,919325115,5 Mb1,0 M25166515114
jul 20117 1 295 3,919325505,5 Mb1,0 M25056515114
jun 20117 1 29413,719793535,5 Mb1,0 M2505641596
mai 20117 11271 3,8197762955,5 Mb1,0 M1835641596
abr 20117   267 2,819468 5,3 Mb999 k1818141610
mar 20117   267 2,819468 5,3 Mb999 k1818141610
fev 20117   267 2,81946815,3 Mb999 k1818141610
jan 20117   266 2,819542 5,3 Mb999 k1818141610
dez 20107 1 266 2,81954255,3 Mb999 k1818141610
nov 20107   265 2,81954225,3 Mb999 k1818141610
out 20107   265 2,81954215,3 Mb999 k1818141610
set 20107   265 2,819542 5,3 Mb999 k1818041610
ago 20107   265 2,81954225,3 Mb999 k1818041610
jul 20107   265 2,71954235,3 Mb999 k1818041610
jun 20107   264 2,719615 5,3 Mb999 k1818041610
mai 20107   264 2,71961515,3 Mb999 k1818041610
abr 20107   264 2,719615 5,3 Mb999 k1818041610
mar 20107 1 264 2,71961595,3 Mb999 k1818041610
fev 20107   263 2,719690 5,3 Mb999 k1818041610
jan 20107   263 2,71969015,3 Mb999 k1818041610
dez 20097   262 2,71976535,3 Mb999 k1798041610
nov 20097   261 2,719841 5,3 Mb999 k179804169
out 20097   261 2,719841 5,3 Mb999 k179804169
set 20097   261 2,71984115,3 Mb999 k179804169
ago 2009711 261 2,71984175,3 Mb999 k179804169
jul 20096   256 2,720131 5,3 Mb997 k179804169
jun 20096   256 2,72013135,3 Mb997 k179804169
mai 20096   256 2,72013125,3 Mb997 k179804169
abr 20096   256 2,72013155,3 Mb997 k179804169
mar 20096 1125532,7202051765,3 Mb997 k179804169
fev 20096   171 318635456 kb60 k39554159
jan 20096   169 318761454 kb59 k39534159
dez 20086   169 31876 454 kb59 k39524159
nov 20086   169 318762454 kb59 k39524159
out 20086   169 31876 454 kb59 k39524159
set 20086   169 3187610454 kb59 k39524159
ago 2008612 168 3188591454 kb59 k41524159
jul 20085   168 2,418916452 kb59 k85524159
jun 20085   168 2,41891 452 kb59 k85524159
mai 20085   168 2,41891 452 kb59 k85524159
abr 20085   168 2,418912452 kb59 k85524159
mar 20085   168 2,41891 452 kb59 k85524159
fev 20085   168 2,41891 452 kb59 k85524159
jan 20085   168 2,418913452 kb59 k85524159
dez 20075   167 2,41898 451 kb59 k85514159
nov 20075   167 2,418987451 kb59 k85514159
out 20075   166 2,318987451 kb59 k85524158
set 20075   165 2,318981338 kb59 k85524157
ago 20075   165 2,318985338 kb59 k85524157
jul 20075   161 2,319212334 kb59 k85514157
jun 20075   161 2,319216334 kb59 k85514157
mai 20075   161 2,319213334 kb59 k85514157
abr 20075   158 2,319337329 kb58 k85514157
mar 20075 1 156 2,319415326 kb57 k85514157
fev 20075 1 15112,3195820319 kb56 k85514157
jan 20075 2 13312,5208958299 kb53 k82514157
dez 2006511 9123245970240 kb43 k41514155
nov 20064   32 6,44041 139 kb25 k23334154
out 20064   32 6,440411139 kb25 k23334154
set 2006411 32 6,4404149139 kb25 k23334154
ago 20063   21 7,445881102 kb18 k1233323
jul 20063   21 7,34588 102 kb18 k1232323
jun 20063   21 7,345883102 kb18 k1232323
mai 20063 1 21 7,245838101 kb18 k1232313
abr 20063   19 7,547871101 kb18 k1033 13
mar 20063   19 7,54789 101 kb18 k1033 13
fev 20063   19 7,547894101 kb18 k1033 13
jan 20063   18 7,73565 75 kb12 k1033 13
dez 20053 1 18 7,735654975 kb12 k1033 13
nov 2005311 17 5,222471547 kb7,5 k109 2 
out 20052   17 4,42424346 kb7,2 k109 1 
set 20052   16 4,42456544 kb6,8 k109 1 
ago 20052 1 16 4,124561144 kb6,8 k109 1 
jul 20052   13 4,23092 40 kb6,2 k79 1 
jun 20052   13 4,23092140 kb6,2 k79 1 
mai 20052   13 4,23092 40 kb6,2 k79 1 
abr 20052   13 4,23092 40 kb6,2 k79 1 
mar 20052   13 4,23092 40 kb6,2 k79 1 
fev 20052   13 4,23092340 kb6,2 k79 1 
jan 20052   12 4,22224 30 kb3,9 k79 1 
dez 20042   12 4,22224 30 kb3,9 k79 1 
nov 20042   12 4,22224230 kb3,9 k79 1 
out 20042   11 4,52221229 kb3,9 k69 1 
set 20042   11 4,324511029 kb3,8 k69 1 
ago 20042   11 3,42779629 kb3,8 k69 1 
jul 2004221 9 3,432693127 kb3,2 k410 1 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikilibrariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikilibrarians (usuários registrados)
A = Wikilibrarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikilibrarians que editaram pelo menos dez vezes desde que chegaram
C = Wikilibrarians que contribuíram cinco vezes ou mais este mês
D = Wikilibrarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  5  10  1  3  5  10  25  100  5  10 
dez 2018        2            
nov 20182                    
out 2018             3       
set 20181       1    1       
ago 20181    111             
jul 20185311          642     
jun 20181                    
mai 2018                     
abr 2018             1       
mar 20182                    
fev 2018        1    2       
jan 20181                    
dez 2017        1    2       
nov 2017111      2    31      
out 20171                    
set 2017        1    1       
ago 2017                     
jul 2017                     
jun 2017             2       
mai 20171            1     1 
abr 20172            211     
mar 2017                     
fev 2017             3       
jan 2017                     
out 2018             3       
jul 20185311          642     
abr 2018             1       
jan 20181                    
out 20171                    
jul 2017                     
abr 20172            211     
jan 2017                     
out 2016111                   
jul 20161                    
abr 20161       1    1       
jan 2016        2            
out 201511           2     1 
jul 20151111     1    311     
abr 20151          222     1 
jan 2015        11   11      
out 2014             2       
jul 2014             1       
abr 2014             4       
jan 2014321111    31   731     
out 20131       1    51      
jul 20131            6       
abr 2013             2       
jan 20133111     3            
out 2012        1    32      
jul 2012             2       
abr 2012111      11   111     
jan 201211111    1    211     
out 2011111           4       
jul 201111111    1    421     
abr 2011             211     
jan 2011             4       
out 20101       1    3       
jul 20101            2       
abr 2010             31      
jan 20101       1    1111    
out 2009                     
jul 2009             2       
abr 20092            311     
jan 2009             111     
out 2008        1    322     
jul 20081       2    4       
abr 20081            2       
jan 20081       1    311     
out 200721      2    31      
jul 20071       1    2       
abr 20073                    
jan 200722221    21   2211    
out 20061       1    4111    
jul 2006             1       
abr 2006                     
jan 2006        2    2       
out 2005                     
jul 2005                     
abr 2005                     
jan 2005                     
out 2004                     
jul 20041111          11      

 

Distribuição de edições de artigos por wikilibrarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikilibrariansEdições total
153100.0%1,882100.0%
31935.8%1,82997.2%
101018.9%1,78194.6%
32713.2%1,74192.5%
10035.7%1,52681.1%
31611.9%1,24065.9%
100011.9%1,24065.9%

 

20 wikilibrarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
MahagajaUC11,240set 24, 20064480ago 08, 2018144
Llywelyn2000UC2144jul 20, 20083815jul 09, 2018174
Janus~cywikisourceUC3142dez 22, 20064391ago 19, 20074151
AlwynapHuwUC470jul 13, 20151266set 04, 2018117
MarnanelUC562jul 14, 20045282dez 11, 20054767
AnatiomarosUC649set 10, 20131937nov 28, 20131858
AntonBrylUC734set 05, 2016846out 02, 2016819
imported>AngrUC816fev 25, 20055056nov 12, 20054796
Llygadebrill~cywikisourceUC913out 22, 20064452ago 13, 20093426
RumpelstilzchenUC1011fev 01, 20151428jun 24, 20151285
PwyllUC118jul 05, 20103100jan 13, 2018351
Adam7davies~cywikisourceUC127mai 07, 20064620jun 25, 20064571
Y ddraig felenUC137mar 07, 20103220mar 07, 20103220
VIGNERONUC145mar 22, 20122474jul 06, 2018177
NwdlsUC155mar 21, 20132110out 18, 20131899
EclecticologyUC164set 04, 20045230set 04, 20045230
Ekips39UC174dez 21, 20141470dez 22, 20141469
Beleg TâlUC184out 21, 20151166out 21, 20151166
TptUC194mar 22, 2018283jul 06, 2018177
LloffiwrUC203jun 25, 20064571set 14, 20131933

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 179 edições foram feitas por usuários anônimos, de um total de 2208 edições ( 8e %)
  


4 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Wikisource-botUC1132ago 14, 20151234ago 10, 2018142--
CandalBotUC211ago 14, 20112695dez 09, 20112578--
タチコマ robotUC33ago 18, 20112691ago 18, 20112691--
TVT-botUC41mar 03, 20103224mar 03, 20103224--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifPng
dez 20184923511342453 127  1312        13
nov 20184923511342453 127  1312        13
out 20184923511342453 127  1312        13
set 20184923501342453 127  1312        13
ago 20184903501342453 126  1312        13
jul 20184903501342453 126  1312        13
jun 20184853501342353 119  1312        13
mai 20184853501342353 119  1312        13
abr 20184853501342353 119  1312        13
mar 20184853501342353 119  1312        13
fev 20184853501342353 119  1312        13
jan 20184853491342353 119  1312        13
dez 20174843481342353 119  1312        13
nov 20174843471342353 119  1312        13
out 20174843451342353 119  1312        13
set 20174833451342353 119  1312        13
ago 20174833441342353 119  1312        13
jul 20174833441342353 119  1312        13
jun 20174833441342353 119  1312        13
mai 20174623441342353 119  1312        13
abr 20174623441342353 119  1312        13
mar 20174613441342353 119  1312        13
fev 20174613441342353 119  1312        13
jan 20174613421342353 119  1312        13
dez 20164613421342353 119  1312        13
nov 20164603421342353 119  1312        13
out 20164603421342353 119  1312        13
set 20164593421342353 119  1312        13
ago 20164513421342353 118  1312        13
jul 20164503411342353 114  1312        13
jun 20164503411342353 114  1312        13
mai 20164503411342353 114  1312        13
abr 20164493401342353 114  1312        13
mar 20164483391342353 114  1312        13
fev 20164483391342353 114  1312        13
jan 20164143391342353 114  1302        13
dez 20154143391342353 114  1302        13
nov 20154143361342353 114  1302        13
out 20154143351342353 114  1302        13
set 20154123351342346 114  1302        13
ago 20154123351342346 114  1302        13
jul 20154123351342345 114  1302        13
jun 20154033331342345 111  1302        13
mai 20154033331342345 111  1302        13
abr 20154033331342345 111  1302        13
mar 20154033321342344 111  1302       113
fev 20154023321342344 111  1302       913
jan 20154013271342344 111  1302        13
dez 20144013251342344 111  1302       413
nov 20144013241342338 111  1302       313
out 20144013221342338 111  1302        13
set 20144013211342338 111  1302        13
ago 20144013181342338 111  1302        13
jul 20144013141342338 111  1302        13
jun 20144013131342338 111  1302        13
mai 20144013131342338 111  1302        13
abr 20144013131342338 111  1302        13
mar 20144013101342338 111  1302       113
fev 20144013081342338 111  1302        13
jan 20144013041342338 111  1302       19413
dez 20133993011322333 110  772       9011
nov 201339830113 2325 103  722       27  
out 201339529613 2325 102  712       1  
set 201339429213 2325 102  712       42  
ago 201339027912 2324 87  712          
jul 201339027612 2324 87  712       2  
jun 201339027112 2324 87  702          
mai 201339027012 2324 87  702          
abr 201339026812 2324 87  702          
mar 201339026512 2324 87  702       5  
fev 201338925912 2324 86  702       6  
jan 201338925212 2324 86  692       15  
dez 201238925112 2324 86  672       8  
nov 201238724712 2324 85  672       3  
out 201238724712 2324 85  672          
set 201238724312 2324 85  672       14  
ago 201238724012 2324 82  662       18  
jul 201238623312 2324 82  642          
jun 201238623312 2324 82  642          
mai 201238622712 2324 82  642       1  
abr 201238522412 2324 82  642       5  
mar 201238521912 2324 82  632       83  
fev 201238521812 2322 74  542       101  
jan 201238521212 2322 74  291       38  
dez 201138521012 2319 74  251       16  
nov 201138520712 2319 74  241       2  
out 201138519412 2118 74  241       7  
set 201138519012 2118 73  241       10  
ago 201138518512 2018 73  231          
jul 201138518012 2017 73  231       50  
jun 201136717112 1717 73  221       53  
mai 201136716712 1414 73           294  
abr 201127716210 1414 71              
mar 201127715610 1414 71              
fev 201127715610 1414 71           1  
jan 201127615210 1414 70              
dez 201027614910 1414 70           5  
nov 201027514810 1414 70           2  
out 201027514610 1414 70           1  
set 201027514310 1414 70              
ago 201027513810 1414 70              
jul 201027512210 1414 70           1  
jun 201027412110 1414 69              
mai 201027411010 1414 69              
abr 201027410810 1414 69              
mar 201027410310 1414 69           8  
fev 201027310010 1414 69              
jan 20102739810 1414 69           1  
dez 20092728610 1414 69           3  
nov 2009270859 1414 69              
out 2009270839 1414 69              
set 2009270839 1414 69           1  
ago 2009270799 1414 69           6  
jul 2009265799 1414 69              
jun 2009265779 1414 69           1  
mai 2009265749 1413 69           1  
abr 2009265749 1413 69           4  
mar 2009264669 1413 68           175  
fev 2009180649 1410 66           5  
jan 2009178609 1410 66              
dez 2008178609 1410 66              
nov 2008178599 1410 66           1  
out 2008178469 1410 66              
set 2008178369 1410 66           3  
ago 2008177339 144 65           90  
jul 2008177329 144 57           1  
jun 2008177329 144 57              
mai 2008177269 134 57              
abr 2008177259 134 57           1  
mar 2008177249 134 56              
fev 2008177199 134 56              
jan 2008177199 134 56           1  
dez 2007176189 132 55              
nov 2007176159 132 55           3  
out 2007174149 132 55           5  
set 2007172129 132 55              
ago 2007172108 132 55           4  
jul 2007168108 132 55           1  
jun 200716898 132 55           2  
mai 200716888 132 55           3  
abr 200716588 132 55           4  
mar 200716388 132 55           5  
fev 200715888 132 54           19  
jan 200714078 132 47           57  
dez 20069677 132 30           67  
nov 20063677 132 14              
out 20063677 132 14           1  
set 20063676 112 14           49  
ago 20062474 112 8              
jul 20062474 112 8              
jun 20062464 112 8           3  
mai 20062464 112 8           6  
abr 20062264 111 8              
mar 20062264 111 8              
fev 20062264 111 8              
jan 20062144 111 8              
dez 20052124 111 8           42  
nov 200517 4                   
out 200517 4                   
set 200516 4                   
ago 200516 4                   
jul 200513 4                   
jun 200513 4                   
mai 200513 4                   
abr 200513 4                   
mar 200513 4                   
fev 200513 4                   
jan 200512 3                   
dez 200412 3                   
nov 200412 3                   
out 200411 3                   
set 200411 3                   
ago 200411 3                   
jul 20049 3                   

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2004: 1 1 Yr Arwr

set 2004: 1 1 Yr Arwr

fev 2005: 1 1 Pwyll Pendeuic Dyuet

ago 2005: 1 2 Yr Internationale

nov 2005: 1 2 Hafan , 2 1 Yr Internationale

dez 2005: 1 2 Hafan , 2 1 Y Gododdin

mai 2006: 1 1 Yr Hwyr

jun 2006: 1 1 Hafan

set 2006: 1 1 Mae bod yn fyw o fawr ryfeddod

out 2006: 1 1 Ein Tad

dez 2006: 1 1 Cystal am ofal im yw

jan 2007: 1 1 Awdl Farwnad Syr Edward Stradling

fev 2007: 1 1 Marwnad Dafydd ap Gwilym

mar 2007: 1 1 I Ofyn March

abr 2007: 1 2 Yr Arwr , 2 1 Yr Adfail

mai 2007: 1 1 Y Pwll Mawm

jun 2007: 1 1 Y Gododdin

jul 2007: 1 1 Ar Farwolaeth Llywelyn yr Ail

ago 2007: 1 1 Suo Gân

out 2007: 1 2 Y Gogodin

nov 2007: 1 1 Rhyfelgyrch Gwyr Harlech

jan 2008: 1 1 Bugeilio'r gwenith gwyn

abr 2008: 1 1 Awdl Farwnad Syr Edward Stradling

jul 2008: 1 1 Cywydd Merch

ago 2008: 1 2 Marunad Madawc fil Maredut , 2 2 I'r Farn Fawr , 3 2 Coed Marchan , 4 2 Dau Englyn , 5 2 Hirlas Owain , 6 1 Suo Gân

set 2008: 1 1 Y Nefoedd Uwch fy Mhen

nov 2008: 1 1 Hafan

fev 2009: 1 2 O! Deuwch, ffyddloniaid

mar 2009: 1 1 Beibl (1588)/Llithiadur

abr 2009: 1 2 Dychan i Uto'r Glyn

mai 2009: 1 1 Beibl (1620)/Actau

jun 2009: 1 1 Geraint fab Erbin

ago 2009: 1 1 Cywydd i Harri Ddu

set 2009: 1 1 Hafan

dez 2009: 1 1 Cyfri'r Geifr

jan 2010: 1 1 Bachgen bach o dincer

mar 2010: 1 2 Hafan , 2 1 Myfanwy

jul 2010: 1 1 Beibl (1620)/Sant Luc

out 2010: 1 1 Yr Internationale

nov 2010: 1 1 Ein Tad

dez 2010: 1 1 Buched Dewi

fev 2011: 1 1 Ty'r Arglwyddi yn 1912

mai 2011: 1 2 Bywyd a marwolaeth Theomemphus o'i enedigaeth i'w fedd , 2 1 Beibl (1588)/Genesis

jun 2011: 1 1 Y bibl cyssegr-lan.djvu/16

jul 2011: 1 1 Broken/Y bibl cyssegr-lan.djvu/1193

set 2011: 1 1 Y bibl cyssegr-lan.djvu/18

out 2011: 1 1 Rhyfelgyrch Gwŷr Harlech (1)

nov 2011: 1 1 Hafan

dez 2011: 1 1 Y bibl cyssegr-lan.djvu/19

jan 2012: 1 1 Y bibl cyssegr-lan.djvu/23

fev 2012: 1 1 Y bibl cyssegr-lan.djvu/27

mar 2012: 1 1 Y bibl cyssegr-lan.djvu/32

abr 2012: 1 1 Y bibl cyssegr-lan.djvu/33

mai 2012: 1 1 Y Faner Goch

ago 2012: 1 1 Y bibl cyssegr-lan.djvu/34

set 2012: 1 1 Beibl Cyssegr-Lan 01 Intro+Genesis.pdf/31

nov 2012: 1 1 Beibl

dez 2012: 1 1 Yr Wylan

jan 2013: 1 3 Hafan , 2 1 Beibl Cyssegr-Lan 01 Intro+Genesis.pdf/32

fev 2013: 1 1 Y bibl cyssegr-lan.djvu/36

mar 2013: 1 1 Siroedd Cymru: IX. Meirionnydd

jul 2013: 1 1 Beibl Cyssegr-Lan 01 Intro+Genesis.pdf/33

set 2013: 1 2 Hafan , 2 1 Kervit vrten

out 2013: 1 1 Y Gwyddel a'r Cymro

nov 2013: 1 2 Urien Yrechwydd , 2 1 Da Fuâr Drindod

dez 2013: 1 1 Y bibl cyssegr-lan.djvu/40

jan 2014: 1 1 Beibl Cyssegr-Lan 01 Intro+Genesis.pdf/59

mar 2014: 1 1 Llyfr Du Caerfyrddin

nov 2014: 1 1 Beibl (1620)/Sant Marc

dez 2014: 1 1 Beibl Cyssegr-Lan 01 Intro+Genesis.pdf/5

fev 2015: 1 1 Beibl (1588)/Exodus

mar 2015: 1 1 Beibl (1588)/Lefiticus

abr 2015: 1 1 Beibl (1588)/Lefiticus

jun 2015: 1 1 Beibl (1588)/Exodus

jul 2015: 1 1 Ffugenwau (Mynyddog)

out 2015: 1 1 Rhyfelgyrch Gwŷr Harlech (2)

fev 2016: 1 1 Syr Watcin Williams Wynn

abr 2016: 1 1 Beibl (1588)/Sant Marc

mai 2016: 1 1 Gweddi'r Orsedd

jul 2016: 1 1 Fy Mam (Ieuan Gwynedd)

ago 2016: 1 1 Datganiad Cyffredinol o Hawliau Dynol

set 2016: 1 1 Y Ddwy Lili

out 2016: 1 1 Kulhwch ac Olwen

dez 2016: 1 1 Mab Gyfreu Taliessin

abr 2017: 1 1 Ty cwrdd dolobran

mai 2017: 1 1 Mwyalchen

out 2017: 1 1 Hen wlad fy nhadau

nov 2017: 1 1 Beibl (1588)/Sant Marc

jan 2018: 1 1 Hawl i Fyw

mar 2018: 1 2 Y bibl cyssegr-lan.djvu

jun 2018: 1 1 Hafan

jul 2018: 1 2 Yr Anrhydeddus T Price, Prif Weinidog Deheubarth Awstralia (Y Faner 1908) , 2 2 Yr Anrhydeddus Thomas Price (Y Winllan Ionawr 1908) , 3 1 YR ANRHYDEDDUS THOMAS PRICE (Y Winllan Ionawr 1908)

ago 2018: 1 1 Beibl (1620)/Genesis

set 2018: 1 1 Yspwng (Geiriadur Charles)

nov 2018: 1 2 Ein Tad

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 03:45 (final run)

Dump file cywikisource-20190101-stub-meta-history.xml.gz (edits only), size 260 kb as gz -> 1.8 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:42 after 4 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.