Estatísticas da Wikisource inglês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikilibrariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2018+1% +18%+5%+1%+17%  +10%      0%
nov 20180% -1%+2%+1%+4%  -3%      0%
out 20180% -5%-3%+1%-2%  -62%      0%
set 2018+1% -7%+13%+1%+50%  -85%      0%
ago 2018+1% +10%+8%+1%-26%  +364%      0%
jul 2018+1% -1%-6%+1%-8%  +275%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 2018325123146612,2 M8333,6 58 k      131 k
nov 2018322811124582,2 M7113,6 52 k      131 k
out 2018321714125572,2 M6833,6 54 k      131 k
set 2018320318132592,1 M6983,7 142 k      131 k
ago 2018318522142522,1 M4663,6 954 k      130 k
jul 2018316320129482,1 M6263,2 206 k      130 k
jun 2018314322130512,1 M6813,1 55 k      130 k
mai 2018312110112432,1 M4973,1 46 k      129 k
abr 2018311121124522,0 M9953,1 67 k      129 k
mar 201830909132432,0 M4403,1 73 k      129 k
fev 2018308118120512,0 M5713,1 41 k      128 k
jan 2018306316135462,0 M5413,1 47 k      128 k
dez 2017304717134552,0 M4153,1 69 k      128 k
nov 2017303019138452,0 M4433,1 34 k      127 k
out 2017301113128501,9 M4513,1 33 k      127 k
set 201729988128461,9 M4293,1 35 k      127 k
ago 2017299023133531,9 M4233,1 37 k      126 k
jul 2017296723120491,9 M5313,1 46 k      126 k
jun 2017294415116491,9 M6673,1 56 k      125 k
mai 2017292911118551,9 M5613,1 50 k      124 k
abr 2017291815128491,8 M4843,1 46 k      124 k
mar 2017290354177561,8 M5503,1 48 k      123 k
fev 2017284921129481,8 M5973,1 35 k      123 k
jan 2017282815118501,8 M5303,2 44 k      123 k
dez 2016281321121511,8 M5223,2 41 k      122 k
nov 201627929104441,8 M4933,2 34 k      122 k
out 2016278316122501,8 M4053,2 33 k      121 k
set 201627678107441,7 M3623,2 43 k      121 k
ago 2016275916117481,7 M5543,2 40 k      120 k
jul 2016274311110511,7 M9423,2 57 k      120 k
jun 2016273215108511,7 M9053,2 47 k      119 k
mai 2016271715109441,7 M3923,2 38 k      118 k
abr 201627029105431,6 M3693,2 36 k      118 k
mar 2016269312112461,6 M3973,2 36 k      117 k
fev 2016268115111411,6 M3713,2 33 k      117 k
jan 2016266617124431,6 M6413,2 50 k      116 k
dez 201526499108441,6 M5443,2 43 k      115 k
nov 2015264017133501,6 M4763,2 58 k      115 k
out 2015262322131471,6 M9503,2 195 k      114 k
set 2015260111115431,5 M5053,2 51 k      113 k
ago 201525901399471,5 M6773,2 108 k      113 k
jul 2015257713120511,5 M4533,1 54 k      112 k
jun 201525649105461,5 M6013,1 51 k      112 k
mai 2015255510118451,5 M4973,1 36 k      111 k
abr 2015254515109431,4 M5393,1 45 k      111 k
mar 2015253011124541,4 M5213,1599451 k5,2 Gb483 M1,3 M27 k61 k224 k110 k
fev 2015251916119451,4 M4633,1602533 k5,2 Gb482 M1,3 M27 k60 k223 k110 k
jan 2015250321116531,4 M4583,2604539 k5,1 Gb482 M1,3 M27 k60 k223 k110 k
dez 2014248213103441,4 M3303,2607831 k5,1 Gb482 M1,2 M27 k60 k223 k110 k
nov 2014246916109421,4 M4603,2609942 k5,0 Gb481 M1,2 M27 k60 k223 k109 k
out 201424531296381,4 M3733,2612534 k5,0 Gb480 M1,2 M27 k59 k222 k109 k
set 201424419100441,4 M3823,2614937 k5,0 Gb479 M1,2 M27 k59 k222 k109 k
ago 2014243217111421,3 M4443,2616435 k5,0 Gb478 M1,2 M27 k58 k222 k107 k
jul 2014241513104381,3 M3933,2619630 k4,9 Gb477 M1,2 M27 k58 k222 k105 k
jun 201424021095401,3 M3783,2622731 k4,9 Gb476 M1,2 M27 k57 k222 k105 k
mai 2014239218105401,3 M4763,2625432 k4,9 Gb475 M1,2 M27 k57 k222 k105 k
abr 201423748104431,3 M2773,2627330 k4,8 Gb474 M1,2 M27 k57 k222 k105 k
mar 2014236616139491,3 M3813,2629842 k4,8 Gb473 M1,2 M27 k56 k221 k105 k
fev 2014235035134531,3 M4543,2632432 k4,8 Gb472 M1,2 M27 k56 k220 k104 k
jan 2014231524135411,3 M4463,2635636 k4,8 Gb471 M1,2 M27 k55 k220 k104 k
dez 2013229123130381,2 M4163,2639534 k4,8 Gb470 M1,2 M32 k54 k220 k104 k
nov 2013226817123421,2 M2923,2643328 k4,7 Gb468 M1,2 M32 k54 k220 k103 k
out 2013225116113431,2 M3263,2645338 k4,7 Gb467 M1,1 M32 k53 k220 k103 k
set 2013223522117401,2 M2813,2648429 k4,7 Gb466 M1,1 M32 k52 k220 k103 k
ago 2013221322114431,2 M4133,2649735 k4,7 Gb464 M1,1 M32 k52 k218 k102 k
jul 2013219119124371,2 M2803,2651929 k4,7 Gb463 M1,1 M31 k51 k218 k102 k
jun 2013217211100391,2 M5083,2652636 k4,6 Gb461 M1,1 M31 k50 k218 k102 k
mai 2013216118124471,2 M3863,2653737 k4,6 Gb459 M1,1 M31 k50 k218 k102 k
abr 2013214314123441,2 M3503,2656441 k4,6 Gb459 M1,1 M31 k49 k217 k101 k
mar 2013212920113381,1 M3193,2659636 k4,6 Gb458 M1,1 M31 k48 k217 k101 k
fev 2013210923108431,1 M4333,2661044 k4,5 Gb457 M1,1 M31 k47 k217 k100 k
jan 2013208624130401,1 M5453,2666048 k4,5 Gb456 M1,1 M30 k46 k217 k99 k
dez 2012206216102371,1 M5473,2668056 k4,5 Gb454 M1,1 M29 k45 k217 k99 k
nov 20122046995341,1 M3263,2671033 k4,5 Gb452 M1,1 M29 k44 k217 k99 k
out 2012203715115361,1 M4043,2673233 k4,5 Gb451 M1,1 M29 k43 k217 k98 k
set 2012202211100361,1 M3533,2677434 k4,4 Gb450 M1,1 M28 k43 k217 k98 k
ago 2012201115118381,1 M3853,2680439 k4,4 Gb450 M1,1 M28 k42 k216 k98 k
jul 2012199657160531,0 M3953,2682936 k4,4 Gb448 M1,0 M27 k42 k216 k97 k
jun 2012193924125371,0 M4823,2684589 k4,4 Gb446 M1,0 M27 k42 k216 k97 k
mai 2012191525123291,0 M2613,2683623 k4,3 Gb442 M1,0 M27 k41 k215 k96 k
abr 2012189017112291,0 M2013,26843103 k4,3 Gb441 M1,0 M27 k41 k215 k96 k
mar 2012187320138421000 k19993,1687479 k4,3 Gb440 M1,0 M27 k40 k215 k96 k
fev 201218532013440938 k4753,2690537 k4,1 Gb438 M1,0 M26 k39 k215 k96 k
jan 201218332213837924 k3473,2693135 k4,1 Gb438 M1,0 M26 k38 k215 k95 k
dez 201118111611135913 k3613,2695628 k4,0 Gb435 M989 k26 k37 k214 k94 k
nov 201117951511736902 k1763,2697819 k4,0 Gb434 M983 k26 k37 k214 k94 k
out 201117802712339897 k3103,2700731 k4,0 Gb433 M978 k25 k36 k214 k93 k
set 201117532912832887 k3253,27048132 k4,0 Gb432 M972 k25 k36 k214 k93 k
ago 201117241812340878 k4433,1709964 k4,0 Gb431 M964 k21 k34 k214 k92 k
jul 201117061712341864 k21953,17159203 k3,9 Gb429 M958 k20 k33 k214 k91 k
jun 201116891711444796 k14773,17220103 k3,8 Gb429 M936 k20 k32 k214 k90 k
mai 201116721812845751 k26963,17653107 k3,7 Gb416 M866 k20 k31 k213 k89 k
abr 201116541211335668 k4443,48999149 k3,4 Gb379 M731 k19 k31 k213 k89 k
mar 201116421910638655 k9803,29114137 k3,4 Gb376 M710 k19 k30 k213 k87 k
fev 201116231911035624 k9013,1923770 k3,1 Gb344 M557 k19 k30 k213 k60 k
jan 201116042012645599 k3933,2933558 k3,0 Gb316 M513 k18 k28 k213 k38 k
dez 201015842512449587 k3213,1947653 k2,9 Gb314 M499 k18 k26 k213 k37 k
nov 201015591511139577 k4093,1954241 k2,9 Gb311 M489 k18 k25 k212 k37 k
out 201015442311742565 k4023,1966957 k2,9 Gb307 M486 k18 k25 k212 k32 k
set 201015211710938552 k8083,1960454 k2,8 Gb313 M524 k17 k25 k212 k29 k
ago 201015041911140528 k3753,1954437 k2,7 Gb298 M516 k17 k24 k212 k21 k
jul 201014851812837516 k3913,1965735 k2,7 Gb294 M507 k16 k23 k212 k19 k
jun 201014672612839504 k4183,1969432 k2,6 Gb287 M477 k16 k22 k212 k16 k
mai 201014412612144492 k3173,1982933 k2,6 Gb285 M463 k15 k21 k212 k16 k
abr 201014151911532482 k2653,11000026 k2,6 Gb284 M454 k15 k21 k211 k15 k
mar 201013961912645474 k2903,11010528 k2,5 Gb283 M446 k15 k20 k211 k15 k
fev 201013771711140465 k3293,11020332 k2,5 Gb280 M439 k15 k19 k211 k15 k
jan 201013602712735456 k2773,11036533 k2,5 Gb279 M433 k14 k18 k211 k14 k
dez 200913332110838447 k3863,11056639 k2,5 Gb277 M420 k14 k17 k211 k14 k
nov 200913122211140435 k2593,110760184 k2,5 Gb276 M410 k14 k16 k211 k14 k
out 200912902412139427 k15182,710848232 k2,4 Gb273 M398 k14 k15 k211 k14 k
set 200912662711423380 k2012,41090719 k2,2 Gb268 M383 k13 k15 k210 k13 k
ago 200912392911528374 k4012,41100124 k2,2 Gb266 M377 k13 k14 k210 k13 k
jul 200912101910720362 k1152,41102712 k2,2 Gb263 M369 k13 k14 k210 k13 k
jun 200911912711727358 k1282,41106724 k2,1 Gb261 M365 k13 k13 k210 k13 k
mai 20091164209628354 k14552,41099761 k2,1 Gb255 M357 k12 k13 k209 k13 k
abr 200911441910625309 k2982,51101327 k2,0 Gb251 M351 k12 k13 k209 k12 k
mar 200911252911633300 k5022,51099131 k1,9 Gb247 M358 k12 k12 k209 k12 k
fev 200910961910627285 k8982,51102336 k1,9 Gb243 M357 k12 k12 k208 k12 k
jan 200910772110524260 k2982,61102020 k1,8 Gb238 M350 k11 k11 k208 k11 k
dez 200810563111832250 k5972,71106329 k1,8 Gb236 M344 k11 k11 k208 k11 k
nov 200810252412430232 k19662,71114472 k1,7 Gb232 M337 k11 k11 k207 k11 k
out 200810012711825173 k3363,31122322 k1,5 Gb228 M330 k11 k9,9 k206 k11 k
set 20089742411133162 k4483,31127726 k1,4 Gb226 M325 k10 k9,3 k206 k10 k
ago 20089503311234149 k4463,51137726 k1,4 Gb223 M320 k10,0 k9,0 k175 k10 k
jul 20089173012127135 k3303,61132523 k1,3 Gb215 M313 k9,6 k8,7 k8,0 k10 k
jun 20088872410628125 k1943,71139817 k1,3 Gb212 M306 k9,2 k8,4 k7,9 k10 k
mai 20088632710624119 k2893,81140635 k1,3 Gb207 M301 k8,8 k8,0 k7,8 k10,0 k
abr 20088362410220110 k523,81139810 k1,2 Gb204 M297 k8,0 k7,8 k7,6 k9,7 k
mar 2008812209627109 k693,71134310 k1,2 Gb201 M293 k7,5 k7,7 k7,5 k9,6 k
fev 2008792269927106 k6183,71128329 k1,2 Gb196 M287 k7,0 k7,5 k7,0 k9,5 k
jan 200876629972388 k4604,11172631 k1,0 Gb168 M248 k7,1 k7,1 k6,5 k9,2 k
dez 200773718881574 k624,5125368,6 k922 Mb147 M203 k6,9 k6,7 k6,1 k4,6 k
nov 200771925901072 k804,51242434 k900 Mb142 M198 k6,8 k6,5 k5,7 k4,4 k
out 200769423891370 k554,2122987,6 k857 Mb135 M191 k6,7 k6,1 k5,3 k4,3 k
set 200767122811668 k494,21221315 k832 Mb131 M185 k6,5 k5,8 k4,9 k4,2 k
ago 200764916801967 k6341203415 k803 Mb128 M182 k6,7 k5,6 k4,5 k4,1 k
jul 200763314691665 k533,9119896,5 k777 Mb124 M175 k6,3 k5,5 k4,2 k4,0 k
jun 200761917731463 k393,9119619,5 k758 Mb120 M171 k6,3 k5,4 k4,0 k3,9 k
mai 200760216681562 k503,9119987,3 k741 Mb116 M164 k6,2 k5,2 k3,9 k3,9 k
abr 200758615751360 k533,8119177,4 k721 Mb112 M159 k6,1 k4,8 k3,7 k3,7 k
mar 200757125771959 k4393,81186723 k696 Mb108 M153 k5,8 k4,5 k3,4 k3,6 k
fev 200754627761345 k644,5129787,6 k561 Mb89,5 M100 k5,4 k4,2 k3,1 k3,3 k
jan 200751917861443 k484,5129848,7 k541 Mb86,9 M99 k5,2 k4,0 k3,1 k3,2 k
dez 200650223831442 k1074,4128649,3 k521 Mb83,4 M93 k5,1 k3,9 k3,0 k2,9 k
nov 200647923661539 k684,51293612 k489 Mb78,2 M84 k4,9 k3,8 k2,8 k2,8 k
out 20064561268937 k694,5125596,5 k471 Mb75,2 M78 k4,4 k3,7 k2,5 k2,4 k
set 200644424711334 k434,6128778,7 k457 Mb72,5 M73 k4,1 k3,6 k2,4 k2,3 k
ago 200642027751133 k1744,51282716 k438 Mb69,4 M68 k4,1 k3,1 k2,2 k2,2 k
jul 200639334842028 k694,71429621 k405 Mb63,7 M64 k3,9 k3,1 k2,2 k2,2 k
jun 200635928701926 k334,31412727 k375 Mb59,3 M47 k2,8 k2,9 k2,0 k2,0 k
mai 200633120621125 k633,4141168,3 k363 Mb57,5 M38 k1,9 k2,8 k2,0 k880
abr 200631125661123 k643,31428411 k342 Mb53,4 M30 k1,7 k2,6 k1,9 k721
mar 200628622561221 k313,1146085,6 k332 Mb50,8 M27 k1,6 k2,5 k1,9 k664
fev 20062642257820 k223146203,6 k319 Mb48,7 M26 k1,1 k2,4 k1,6 k599
jan 20062422762619 k192,9144533,8 k308 Mb46,6 M24 k1,1 k2,2 k1,5 k519
dez 20052151847419 k222,7143793,2 k299 Mb44,9 M22 k1,6 k2,1 k1,2 k438
nov 20051971238418 k222,7143082,7 k282 Mb43,4 M20 k1,8 k2,0 k1,1 k377
out 20051851651417 k1092,6140555,1 k269 Mb41,4 M19 k1,8 k2,0 k985355
set 20051691335514 k462,9158813,4 k244 Mb37,9 M18 k2,2 k2,0 k926322
ago 20051561540513 k312,9165932,7 k232 Mb36,3 M17 k3,3 k1,8 k877167
jul 20051411335712 k612,9170824,8 k216 Mb34,6 M16 k3,8 k1,6 k814153
jun 200512892969,7 k333181263,2 k193 Mb31,6 M13 k3,6 k1,5 k639130
mai 200511993438,7 k243189583,0 k180 Mb29,7 M12 k3,4 k1,4 k527121
abr 2005110132848,0 k412,9193022,9 k170 Mb27,7 M11 k2,9 k1,3 k439119
mar 200597122456,8 k393204615,9 k155 Mb24,9 M9,7 k2,7 k1,2 k401108
fev 20058581815,6 k142,6204971,1 k130 Mb20,6 M8,0 k2,5 k276349100
jan 20057751745,2 k482,5207412,8 k122 Mb19,1 M7,8 k2,3 k22231289
dez 20047281543,7 k242,8248501,9 k105 Mb15,9 M5,4 k2,1 k21729057
nov 20046451212,9 k122,9258331,1 k91 Mb12,8 M4,6 k1,9 k11027648
out 20045941512,6 k112,82538594080 Mb10,8 M4,0 k1,5 k10927343
set 20045591522,2 k112,9240161,1 k65 Mb8,6 M3,6 k1,3 k9822841
ago 20044661711,9 k112,82265683555 Mb6,8 M3,3 k9619224836
jul 20044041211,6 k62,82110156639 Mb5,3 M2,6 k7978924825
jun 20043651111,4 k62,82228653833 Mb4,9 M2,3 k6508822122
mai 20043131541,2 k182,8224731,3 k28 Mb4,3 M2,1 k5348819312
abr 200428813263973,22573549816 Mb2,3 M1,1 k217881786
mar 200420411 42943,63180133813 Mb1,8 M759142881761
fev 200416410 31353,83742944311 Mb1,4 M40986331161
jan 20041236 17424,3455721607,8 Mb1,1 M38639 861
dez 2003917 12514,7568812046,8 Mb1,0 M35540 91
nov 200383619124,2570062384,8 Mb821 k20959 9 
out 20035   27 5,3944 43 kb3,5 k169  6 
set 2003512 27 5,39445043 kb3,5 k169  6 
ago 2003411 25 3,78951826 kb3,1 k170  4 
jul 20033   22 3,4841420 kb2,6 k108  1 
jun 20033   22 3,2840 20 kb2,6 k125  1 
mai 2003311 22 3,28402520 kb2,6 k125  1 
abr 20032   21 2,1645 15 kb1,8 k73  1 
mar 20032   21 2,1645115 kb1,8 k73  1 
fev 20032   21 2,1645115 kb1,8 k73  1 
jan 20032   21 2645 15 kb1,8 k73  1 
dez 20022   21 2645 15 kb1,8 k73  1 
nov 20022   21 2645 15 kb1,8 k73  1 
out 20022   21 2645115 kb1,8 k73  1 
set 20022   21 2645515 kb1,8 k73  1 
ago 20022   21 1,8645315 kb1,8 k70  1 
jul 20022   21 1,6501112 kb1,3 k70  1 
jun 20022   21 1,6502 12 kb1,3 k70  1 
mai 20022   21 1,6502 12 kb1,3 k70  1 
abr 20022   21 1,6502 12 kb1,3 k70  1 
mar 20022   21 1,6502112 kb1,3 k70  1 
fev 2002211 2111,54983012 kb1,3 k66  1 
jan 20021   1 23227 3,3 kb5326    
dez 20011   1 2322713,3 kb5326    
nov 20011   1 13218 3,3 kb5315    
out 20011   1 13218 3,3 kb5315    
set 20011   1 13218 3,3 kb5315    
ago 20011   1 13218 3,3 kb5315    
jul 20011   1 13218 3,3 kb5315    
jun 200111  1 1321813,3 kb5315    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 201814222123 2      62
jul 201813122128 3      62
abr 201812222226 1      62
jan 201811122227 2      62
out 201713222227 3      62
jul 201711122426 3      62
abr 201712222126 2      62
jan 201713222225 2      62
out 201613222325 3      62
jul 201613222126 1      62
abr 201613222527 4      62
jan 201611122329 3      62
out 201512122131 1      62
jul 201513212234 1      62
abr 201512122133 1      62
jan 20151221233018211131162
out 20141212233218211121162
jul 20141211213118211121162
abr 20141111223118211121162
jan 20141222222718211121162
out 20131111222517211121162
jul 20131111222416211121162
abr 20131111222516211121162
jan 20131112222515111121162
out 20121212222615211121161
jul 20121111222415211121161
abr 20121112232514111121161
jan 20121112222414311121161
out 20111112222414311121160
jul 20111312112414111121160
abr 2011131222229111121160
jan 2011111122239211121160
out 2010111122239211121160
jul 20101211132311211121160
abr 2010121212228111121160
jan 2010111212228211121160
out 2009111111287111121160
jul 2009111314317311121160
abr 2009111212277111121160
jan 2009111112287311122160
out 2008111212216211122160
jul 2008111111175111122360
abr 2008111213165211122360
jan 2008111211116111122360
out 200711131496311122259
jul 2007111215125411122257
abr 2007111211137111122257
jan 200711121385122122157
out 200611131165222122157
jul 200611111144111112156
abr 200611111183111232147
jan 200611121573311123144
out 200511111142111111140
jul 200511111123111211139
abr 200511112122111211137
jan 200511112122111211235
out 200411122111111311131
jul 200412112111111311127
abr 200411112122122311221
jan 200411113222222332116
out 20031111212222324115
jul 20031221212233224135
abr 20031211212232223124
jan 20031111212212221113
out 20021211212222221123
jul 20021111212212221112
abr 20021111212212221112
jan 20022111212212221112
out 20012111212212221112
jul 20012111212212221112
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikilibrariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikilibrarians (usuários registrados)
A = Wikilibrarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikilibrarians que editaram pelo menos dez vezes desde que chegaram
C = Wikilibrarians que contribuíram cinco vezes ou mais este mês
D = Wikilibrarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  25000  5  10  100  1000  10000  100000  1  3  5  10  25  100  250  1000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  5  10  100  1000 
dez 2018258159146119976142164  3311  7638291552  21   110544224941 43  
nov 2018227145124107875833134  2221  9338241331  21   107564525931143  
out 2018228143125104835740103  4432  97523013311 21   120675334173  43  
set 2018217151132114825943103  44321 91442814611 11   122594932133  42  
ago 201824116014211288522992  3321119341311741  31   11964533193  54  
jul 20182231531291058048361281 55511191422719111  22   1045646331942 44  
jun 2018230147130108825130117  5552  90362516124  22   1175942331853 43  
mai 201822112711290724332144  2211  7740251371  22   96523422115  431 
abr 201822514512497765237125  33321 8145311252  22   121584031142  531 
mar 201824015413210280433392  54421 893318951  22   112513620124  6521
fev 20182351421209581513391  2222  9343211572  22   126624732154  321 
jan 2018237156135107834631133  3331  97413222124  22   1095847321762 421 
dez 2017255163134108815535113  43211 8941331783  22   113614029123  541 
nov 2017246163138109844531101  221   80362822162  22   1195638261231 521 
out 201723915612810185503212   3321  87423316102  22   122503725113  631 
set 20172271441289882463492  321   7630181381  33   105554324142  431 
ago 201723415413310078533682  332   96362717112  22   123584125131  321 
jul 20172441391209668493184  2221  7529191471  22   9841281611   321 
jun 2017214136116957549341041 2221  74292513511 21   106584424113  431 
mai 2017208134118102835541113  222   703323137   22   11350362493  441 
abr 201723215012810581493992  3331  9645282171  21   996246311821 531 
mar 201727920817714588563684  4432  110503319134  21   1225645241542 541 
fev 20172431541299982483072  3331  9245291491  22   123614227143  521 
jan 2017219141118104785034113  5532  97483321101  22   1165938311982 431 
out 2018228143125104835740103  4432  97523013311 21   120675334173  43  
jul 20182231531291058048361281 55511191422719111  22   1045646331942 44  
abr 201822514512497765237125  33321 8145311252  22   121584031142  531 
jan 2018237156135107834631133  3331  97413222124  22   1095847321762 421 
out 201723915612810185503212   3321  87423316102  22   122503725113  631 
jul 20172441391209668493184  2221  7529191471  22   9841281611   321 
abr 201723215012810581493992  3331  9645282171  21   996246311821 531 
jan 2017219141118104785034113  5532  97483321101  22   1165938311982 431 
out 20162011361229372502961  111   8840231441  22   102584722103  432 
jul 20162181321109368512993  44431 8542332381  2    124574225131  322 
abr 201620612310582684330122  4331  874532198   1    1245841282131 211 
jan 2016225146124101804336173  4321  874837231431 32   1276250362251 8421
out 2015238151131105804729156  22221193453326102  21   126665037226  3321
jul 2015230137120947551331251 221   8434241610   32   128564431146  532 
abr 201520213410989644329135  4421  1014126149   3322 1386449301661 432 
jan 201523713711610580533573  333   9742251682  11   1457554331761 221 
out 2014217123968463382792  5442  903930178   21   128615330114  532 
jul 20142061251048256382871  443   7544281671  1    1296449311981 333 
abr 20142281311048660432761  2221  8939291911   11   1496953351931 322 
jan 201429217013510674413191  6642  8539282010   11   1658364422361 6551
out 201322013211397754331101  4432  92423223121  1    1427651402381 322 
jul 20132341471248662372172  2221  88423119101  11   1376447251451 321 
abr 201324013912393714427101  5421  774030228        1587553402061 642 
jan 2013233143130103734027114  4443  11749332394  11   1777248322252 4441
out 201222313811582643624112  432   9032241381  111  137573929172  221 
jul 2012296194160126925329101  433   118523120111       2369562392152 111 
abr 201223113811290622919611166522 10840221410        1435845322093 331 
jan 201227516413810780372541  8772  1075637221021 11   1728361421664 641 
out 20112461471239466392461  6643  11450362110411     174745233207  332 
jul 201121013412391654129114  6643211106244261051 11   1799868482991 221 
abr 20112091371138355352793  765311944534221032 222  1867360382484 322 
jan 2011241149126106804526121  99731 1347155311131 1    241113775633145 872 
out 20102241411179366423091  66522 128574226134  1111 20199634623531953 
jul 20102241461289976372073  6422  1155237191131 1111 23710672482142 441 
abr 20102521381159662321542  4432  1336540251132      1999567412363 952 
jan 201026315912710374352163  8732  1376947291331      25910675502653 64  
out 2009261147121936939184   4422111155640261741 11   22210474532961 321 
jul 2009214128107764720132   311   122543422721 11   260966138174  33  
abr 2009232134106845925145   9983  125533621621      2619566362051 321 
jan 20092411371058360241021  4421  11747271771  111  2519974462172 2   
out 2008234143118956525162   4442  1255843251131      23810073442061 1   
jul 2008231150121956827114   5432  1406244261211 21   28510677462341 22  
abr 20081961181027549208    5311  120532817611      2529466341932 31  
jan 2008208125977451231021  54221 1366646251132      2578967431973 111 
out 20071831078963441361   1     9940251361       2458258311661 11  
jul 200716498695434167    1     823321102        224644030143  1   
abr 200717396755334135    321   94361794        2277146251721 3321
jan 2007189109865635147    2221  91372494   22   2678152331741 32  
out 20061728868452995    4421  91362094        2498351301543 31  
jul 200617099846138201231  3322  9740302011   11   2429263371962 441 
abr 2006146836651301162   1111  8738251151  1111 1996948271552 1   
jan 20061398162472461    111   6826171051  11   1676140241521     
out 2005856051281742    1111  651912631       131463121111      
jul 20058449352620741         2715842        561912841      
abr 20057140281813411         1121          336551       
jan 2005542617148421         1052          33116         
out 20044318159711          1143          2151         
jul 20043316121051           8211         297211       
abr 2004281413642           3            176431       
jan 20041410631           721          711         
out 2003                                        
jul 20033                                       
abr 2003                                        
jan 2003                                        
out 2002                                        
jul 20021                                       
abr 2002                                        
jan 2002                                        
out 2001                                        
jul 2001                                        

 

Distribuição de edições de artigos por wikilibrarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikilibrariansEdições total
111,569100.0%4,344,363100.0%
35,13944.4%4,334,75999.8%
103,25028.1%4,323,85099.5%
321,86916.2%4,299,46199.0%
1001,0749.3%4,254,57297.9%
3166035.2%4,169,98396.0%
10003182.7%4,012,38392.4%
31621751.5%3,758,60386.5%
10000810.7%3,246,18274.7%
31623270.2%2,364,58054.4%
10000080.1%1,314,13930.2%

 

50 wikilibrarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
BillinghurstUC1 0249,716548,49427jul 28, 2008380740,3643--
IneuwUC2 0189,6192,69914,04155out 10, 2009336825,2071,740--
AkmeUC3 0167,1275,7642,02236ago 25, 2014158891,2704,139--
Charles MatthewsUC4 0158,2232,2248,453-fev 13, 2006470345,5461,610--
ShakespeareFan00UC5 0154,2881,0686,39919mar 20, 2007430365,290393--
Slowking4UC6 0147,5841,6693,27922nov 06, 2011261182,1451,173--
HesperianUC7 0141,816713,8629jun 27, 2005493485,6687--
BD2412UC8 0105,7662,1671,1302mar 23, 2005503012,2261,941--
BeeswaxcandleUC9 095,8679710,44633fev 13, 2009360751,77540--
Kathleen.wright5UC10 085,4144762,0852jul 08, 2008382714,181105--
JasonanaggieUC11+185,0533,06952132dez 29, 201673121,2801,335--
LondonjackbooksUC12-182,2521111,15017jun 15, 2009348530,3706--
MpaaUC15 059,3471853,72734abr 06, 2011282512,3875--
Bob BurkhardtUC16 053,5985292,99014set 10, 2008376325,682214--
Beleg TâlUC17+149,6566817,027146dez 23, 2013183313,928134--
EncycloPeteyUC18+149,6131,2308,768310abr 21, 2006463620,907298--
Library GuyUC24 037,1942083,1562out 17, 2013190018,81766--
GreyHeadUC25 037,1694691435jul 09, 2011273118,139162--
SusanarbUC26+136,916681557-mai 28, 2013204213,475443--
Gumr51UC28 029,721608265-out 07, 2010300610,112---
HrishikesUC29 028,155173,0933jul 17, 2014162713,62713--
ZoeannlUC30 026,5874642,01315set 04, 2014157811,454413--
ProsodyUC32 025,3023391,7237set 01, 200741388,25691--
Esme ShepherdUC33+223,1701,723859set 30, 20168219,343759--
Dick BosUC36+220,9939986029nov 13, 201126045,409344--
PeteforsythUC37-120,6925511,44323jan 02, 200647457,531228--
DivermanAUUC38-120,5564434041ago 14, 201223294,74738--
SuslindisambiguatorUC39 019,9641,0439811jun 16, 201031194,948336--
UnderlyingBotUC40+1819,8975,6831031jul 10, 20181734,445902--
Sp1nd01UC41+219,0767671166jan 03, 201610925,960212--
HtonlUC44-218,34221,018-mai 01, 200935305,1622--
ChrisguiseUC45+718,2862,44125-jun 20, 20181935,363754--
InductiveloadUC54-115,80435,995-dez 16, 200933015,182---
Einstein95UC55 015,30334344218fev 14, 201514155,49069--
JpezUC61+213,2672891,33314nov 22, 201414996,640147--
Rajasekhar1961UC64 012,936806301out 28, 200933506,51259--
Underlying lkUC67+112,3843912952mar 05, 20183005,35614--
RaboKarbakianUC71+1611,3802,435678115abr 08, 20182665,665736--
MarkLSteadmanUC73+111,0593062561set 25, 201222875,157268--
MukkakukakuUC75-210,80631,01716dez 02, 201318545,4551--
Hazmat2UC77-110,48711,246-jan 21, 201418044,432---
ZyephyrusUC78 010,3931041,919-mai 21, 200646062,78623--
PasiclesUC81-110,18910290-dez 30, 201125573,899---
M-le-mot-ditUC83 09,76017280-out 18, 201415344,644163--
BradypeUC85-19,6441361562jan 26, 201514345,578117--
Maile66UC87-19,10251116-out 24, 20112624912---
MahagajaUC90 08,6441625483fev 25, 200550562,517---
Outlier59UC91+18,450108777-out 12, 201511753,85078--
JimreganUC93 08,1145130-set 10, 201126684,4452--
NigmontUC105 06,834128237-mar 07, 201513943,909114--

 

20 wikilibrarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Cygnis insignisUC1372,736set 07, 20074132nov 29, 201831
William Maury Morris IIUC1459,502out 22, 20102991jan 09, 2018355
Captain NemoUC1949,338abr 03, 20083923nov 03, 20151153
ZhaladsharUC2042,201jun 09, 20045317jun 03, 2017575
Spangineer's botUC2141,453jan 26, 20112895jul 19, 2017529
MudbringerUC2238,848nov 07, 20122244out 13, 201878
George Orwell IIIUC2337,821jun 19, 20093481abr 03, 20161001
MoondyneUC2736,463fev 06, 20055075out 24, 201867
LlywelynIIUC3125,646abr 21, 20103175nov 11, 201849
AdamBMorganUC3422,261jul 28, 20074173mai 15, 20151325
Mike sUC3521,855jan 14, 20141811ago 10, 2018142
Sfan00 IMGUC4218,826ago 06, 20083798fev 25, 20132134
JamAKiskaUC4318,435mar 03, 20103224jun 22, 20112748
Wabbit98UC4618,268dez 12, 20064401dez 15, 20112572
MariewaltonUC4718,255jun 11, 20122393jul 31, 2018152
IngramUC4817,621mai 25, 20083871ago 20, 2017497
MattisseUC4917,134jul 30, 20103075out 24, 20112624
ResidentScholarUC5016,722jan 24, 20083993ago 02, 20141611
John VandenbergUC5116,690mar 11, 20074312ago 04, 2016878
LaverockUC5216,458out 29, 20064445set 06, 20131941

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 87.671 edições foram feitas por usuários anônimos, de um total de 7960.219 edições ( 1e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Wikisource-botUC11,312,380ago 12, 20151236set 02, 201811930,526-
TarmstroBotUC2916,503fev 28, 20093592ago 12, 2016870289,247-
SDrewthbotUC3304,736fev 14, 20093606out 05, 201886509-
ThomasBotUC4201,492ago 28, 20054872jul 23, 2011271722,908-
MjbotUC5152,683jun 29, 20083836jan 19, 20112902152,180-
MpaaBotUC6130,802dez 23, 20112564dez 30, 2018-7,129699
BenchBotUC7126,601jun 23, 20103112abr 09, 2011282250,223-
JVbotUC869,870set 03, 20074136abr 23, 2011280839,889-
LA2-botUC966,499ago 13, 20103061mar 05, 2012249160,732-
Phe-botUC1052,988ago 12, 20112697dez 21, 2018948,39842
PathosbotUC1138,602mar 05, 20064683set 06, 20083767--
InductiveBotUC1232,213abr 30, 20103166jul 20, 201223541,453-
PolbotUC1331,676jan 21, 20083996mar 03, 2008395425,155-
TalBotUC1418,878out 05, 20064469out 26, 2016795--
PoliticalBotUC1516,781jun 25, 20064571ago 29, 200741414,225-
Xenophon (bot)UC1612,584jun 07, 20064589abr 05, 20093556347-
RiccardobotUC1711,254fev 28, 20074323mar 07, 2007431611,017-
ZSBotUC189,869out 28, 20064446abr 11, 200935505,895-
CandalBotUC197,707jun 21, 20112749jan 08, 20141817--
File Upload Bot (LA2)~enwikisourceUC202,208out 14, 20054825out 16, 200548232,208-
Robbie the RobotUC211,911fev 02, 20132157abr 28, 20151342--
EmausBotUC221,432jan 18, 20141807dez 19, 201811--
Sanbeg (bot)UC231,394jun 28, 20074203fev 20, 201032352-
DamonBotUC241,212out 01, 20064473out 19, 200644551,212-
DougBotUC251,077jan 19, 20112902ago 10, 20112699538-
CSNbotUC26722set 18, 20054851set 24, 20054845722-
SHSPbotUC27582ago 14, 20151234dez 01, 20151125--
SKbotUC28487set 12, 20093396set 29, 20103014--
JackBotUC29442nov 02, 20102980set 17, 20141565--
VolkovBotUC30408jun 08, 20083857out 16, 20102997--
タチコマ robotUC31342mar 17, 20083940out 31, 20122251--
Cswikisource-botUC32304ago 26, 20093413jan 14, 20132176--
555.botUC33257jul 03, 20064563fev 23, 20083963--
FluxbotUC34251dez 18, 2016742out 23, 201868--
Schlep (bot)UC35221nov 04, 20093343fev 19, 20103236180-
Alex brolloBotUC36163mai 07, 20103159jan 17, 20112904158-
YannBotUC37118set 29, 20083744jan 02, 2009364996-
DexbotUC3873jan 15, 20141810jan 15, 20141810--
Commons fair use upload bot (usurped)UC3960jan 03, 20132187mai 05, 20132065--
BetacommandBotUC4056out 02, 20064472mar 20, 20083937--
SmackBotUC4146mar 04, 20064684jun 07, 20103128--
AkBotUC4243nov 11, 20151145nov 11, 20151145--
AuCoBotUC4337out 31, 20122251nov 09, 20122242--
WybotUC4433mai 19, 20083877mai 19, 20083877--
TVT-botUC4526set 18, 20093390mar 03, 20103224--
SLQbotUC4620set 11, 20131936set 19, 20131928--
Albamhandaebot~enwikisourceUC4716jul 11, 20083824out 14, 20102999--
VacioBotUC4816set 12, 2017474dez 06, 2017389--
SQLBotUC4915nov 14, 20074064jan 05, 20084012--
Robot MonkUC5012dez 29, 20093288out 02, 20112646--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJpgOggOgvPdfPngSvgTif
dez 2018543 k14 k2,6 k23 k3327,4 k18117 k2,7 k36 k1,7 M14 k        227171,0 k8112322 k161
nov 2018538 k14 k2,6 k23 k3327,4 k18117 k2,7 k36 k1,7 M13 k        227171,0 k8112122 k161
out 2018534 k14 k2,6 k23 k3327,4 k18017 k2,7 k36 k1,7 M13 k        227171,0 k8112122 k161
set 2018530 k13 k2,6 k23 k3327,4 k18017 k2,7 k36 k1,7 M13 k        227171,0 k8111822 k161
ago 2018526 k13 k2,6 k23 k3327,3 k17917 k2,7 k35 k1,7 M13 k        226171,0 k8111822 k161
jul 2018525 k13 k2,6 k23 k3327,3 k17917 k2,7 k35 k1,7 M13 k        226171,0 k8111822 k161
jun 2018521 k13 k2,6 k23 k3287,2 k17917 k2,7 k35 k1,6 M13 k        222171,0 k8111822 k161
mai 2018514 k13 k2,6 k23 k3287,1 k17917 k2,6 k35 k1,6 M12 k        220171,0 k8111822 k161
abr 2018512 k13 k2,6 k23 k3247,1 k17917 k2,6 k34 k1,6 M12 k        218171,0 k8111822 k161
mar 2018510 k13 k2,6 k23 k3247,1 k17917 k2,6 k34 k1,6 M12 k        216179938111822 k161
fev 2018508 k13 k2,6 k20 k3217,0 k17817 k2,6 k34 k1,6 M12 k        210179908111719 k161
jan 2018506 k13 k2,6 k20 k3217,0 k17717 k2,6 k34 k1,6 M12 k        210179878111319 k161
dez 2017503 k13 k2,6 k20 k3196,9 k17717 k2,6 k34 k1,5 M12 k        210179818111319 k161
nov 2017501 k13 k2,6 k20 k3196,9 k17717 k2,6 k33 k1,5 M12 k        206179668111319 k161
out 2017499 k13 k2,6 k20 k3196,9 k17717 k2,6 k33 k1,5 M12 k        203179608111019 k161
set 2017496 k13 k2,6 k20 k3186,8 k17717 k2,6 k33 k1,5 M12 k        203179578110919 k161
ago 2017493 k13 k2,6 k20 k3186,8 k17717 k2,6 k33 k1,5 M11 k        201179558110819 k161
jul 2017491 k13 k2,6 k20 k3186,8 k17717 k2,6 k32 k1,5 M11 k        200179558110619 k161
jun 2017488 k13 k2,6 k20 k3186,8 k17717 k2,5 k32 k1,5 M11 k        200179418110619 k161
mai 2017485 k13 k2,6 k20 k3186,8 k17717 k2,5 k32 k1,5 M11 k        200179378110619 k161
abr 2017481 k13 k2,6 k20 k3186,8 k17617 k2,5 k32 k1,4 M11 k        195179348110619 k161
mar 2017478 k13 k2,5 k20 k3176,7 k17617 k2,5 k32 k1,4 M11 k        194179348110319 k161
fev 2017475 k13 k2,5 k20 k3176,7 k17617 k2,5 k31 k1,4 M11 k        193179348110319 k161
jan 2017471 k13 k2,4 k20 k3176,7 k17617 k2,5 k31 k1,4 M10 k        192179308110319 k161
dez 2016467 k13 k2,4 k20 k3166,6 k17617 k2,5 k30 k1,4 M10 k        185179038110119 k161
nov 2016465 k12 k2,4 k19 k3166,6 k17617 k2,5 k30 k1,4 M10 k        183179038110018 k161
out 2016462 k12 k2,4 k18 k3166,6 k17616 k2,5 k29 k1,4 M10 k        17917903819917 k161
set 2016460 k12 k2,4 k17 k3166,6 k17616 k2,5 k29 k1,4 M9,9 k        17817896819816 k161
ago 2016458 k12 k2,4 k17 k3146,6 k17616 k2,5 k29 k1,4 M9,8 k        17817896819716 k161
jul 2016456 k12 k2,4 k17 k3146,5 k17616 k2,5 k29 k1,3 M9,6 k        17617896819716 k161
jun 2016454 k12 k2,4 k16 k3136,5 k17616 k2,5 k29 k1,3 M9,5 k        17517887819615 k161
mai 2016451 k12 k2,4 k16 k3136,5 k17616 k2,5 k28 k1,3 M9,4 k        17517883817215 k161
abr 2016450 k12 k2,3 k16 k3136,5 k17616 k2,5 k28 k1,3 M9,3 k        17417846817215 k151
mar 2016448 k12 k2,3 k16 k3136,5 k17616 k2,5 k28 k1,3 M9,3 k        17317845817215 k141
fev 2016446 k12 k2,3 k16 k3136,5 k17616 k2,4 k28 k1,3 M9,2 k        17217845817115 k121
jan 2016444 k12 k2,3 k16 k3116,5 k17616 k2,4 k27 k1,2 M9,1 k        17217843817115 k121
dez 2015440 k12 k2,3 k15 k3106,4 k17616 k2,4 k27 k1,2 M8,6 k        17017810816814 k121
nov 2015438 k12 k2,3 k15 k3106,4 k17516 k2,4 k27 k1,2 M8,5 k        16417810816614 k121
out 2015436 k12 k2,3 k14 k3096,4 k17516 k2,4 k27 k1,2 M8,4 k        16217807816613 k111
set 2015433 k12 k2,3 k13 k3096,3 k17516 k2,4 k26 k1,2 M8,3 k        15917807816611 k111
ago 2015431 k12 k2,2 k12 k3096,3 k17316 k2,3 k26 k1,2 M8,2 k        15917807816611 k111
jul 2015429 k12 k2,2 k12 k3096,3 k17216 k2,3 k26 k1,1 M8,0 k        15617807816511 k111
jun 2015427 k12 k2,2 k12 k3056,3 k17216 k2,3 k25 k1,1 M7,7 k        14817802816511 k111
mai 2015425 k12 k2,2 k12 k3016,2 k17116 k2,3 k25 k1,1 M7,6 k        14517802816511 k101
abr 2015423 k12 k2,2 k10 k2976,2 k17116 k2,3 k25 k1,1 M7,4 k        1451579981659,1 k101
mar 2015422 k12 k2,2 k10 k2976,2 k17116 k2,3 k24 k1,1 M7,3 k       470251421579881649,1 k101
fev 2015420 k12 k2,1 k9,8 k2906,2 k17016 k2,3 k24 k1,1 M7,2 k       328681411579381648,8 k61
jan 2015419 k11 k2,1 k9,7 k2866,1 k16916 k2,2 k24 k1,1 M7,1 k       376051381379181648,7 k51
dez 2014416 k11 k2,1 k9,6 k2846,1 k16916 k2,2 k24 k1,0 M7,0 k       293641381376581648,7 k51
nov 2014415 k11 k2,1 k9,6 k2806,1 k16916 k2,2 k24 k1,0 M7,0 k       378981371376381648,7 k51
out 2014413 k11 k2,1 k9,6 k2796,1 k16916 k2,2 k24 k1,0 M6,9 k       304941371374281648,6 k51
set 2014412 k11 k2,0 k9,5 k2786,1 k16916 k2,2 k24 k1,0 M6,9 k       329131371358081648,6 k51
ago 2014409 k11 k1,9 k9,5 k2756,0 k16915 k2,2 k24 k1,0 M6,8 k       310651351358081648,6 k51
jul 2014406 k10 k1,9 k9,4 k2685,9 k16915 k2,2 k23 k993 k6,7 k       282831341358081638,6 k51
jun 2014404 k10 k1,8 k9,4 k2675,9 k16615 k2,2 k23 k983 k6,6 k       277971311356381628,6 k51
mai 2014403 k10 k1,8 k9,4 k2655,8 k16415 k2,2 k23 k973 k6,6 k       249571281356281628,6 k51
abr 2014402 k10 k1,7 k9,4 k2635,8 k16415 k2,2 k23 k959 k6,6 k       281211281356281618,6 k51
mar 2014400 k10 k1,7 k9,3 k2625,8 k16415 k2,2 k23 k953 k6,4 k       409111281356281618,5 k51
fev 2014398 k10 k1,7 k8,5 k2455,8 k16315 k2,2 k22 k942 k6,3 k       314251271356281617,7 k51
jan 2014396 k9,9 k1,7 k8,2 k2405,7 k16015 k2,2 k22 k932 k6,2 k       324701261354981617,5 k51
dez 2013395 k9,9 k1,7 k8,0 k2365,7 k16015 k2,1 k22 k920 k6,1 k       333551241353981607,3 k51
nov 2013392 k9,8 k1,7 k7,8 k2275,6 k15915 k2,1 k22 k910 k6,0 k       246441211353981597,0 k51
out 2013390 k9,8 k1,7 k7,5 k2225,6 k15915 k2,1 k21 k903 k5,9 k       315031201353981596,7 k51
set 2013387 k9,7 k1,7 k7,1 k2215,6 k15915 k2,1 k21 k895 k5,9 k       262431191353981596,4 k51
ago 2013386 k9,6 k1,7 k7,0 k2185,5 k15715 k2,1 k21 k889 k5,8 k       337501181353981596,3 k51
jul 2013384 k9,6 k1,6 k6,9 k2185,3 k15615 k2,1 k20 k878 k5,8 k       271501171353881596,1 k51
jun 2013382 k9,5 k1,6 k6,9 k2175,3 k15315 k2,1 k20 k871 k5,7 k       308631141353881596,1 k51
mai 2013378 k9,5 k1,6 k6,6 k2175,2 k15315 k2,1 k20 k860 k5,6 k       310711131353881595,9 k51
abr 2013376 k9,4 k1,6 k6,5 k2155,2 k14815 k2,1 k20 k850 k5,5 k       308571121353081595,8 k51
mar 2013373 k9,3 k1,6 k6,2 k2105,2 k14815 k2,0 k20 k841 k5,5 k       334871111347781585,6 k51
fev 2013371 k9,3 k1,6 k5,9 k2085,1 k14614 k2,0 k19 k833 k5,4 k       344671101347781575,2 k51
jan 2013368 k9,2 k1,5 k5,3 k2005,1 k14614 k1,7 k19 k824 k5,3 k       416301091345681564,6 k5 
dez 2012365 k9,2 k1,5 k9802005,0 k14514 k1,7 k19 k811 k5,3 k       40358109134538 563365 
nov 2012361 k9,1 k1,5 k9791915,0 k14414 k1,7 k19 k797 k5,3 k       31308109134538 563355 
out 2012358 k9,1 k1,5 k9771855,0 k13614 k1,6 k18 k791 k5,2 k       31773108134538 553355 
set 2012355 k9,0 k1,5 k9771844,9 k13414 k1,6 k18 k781 k5,1 k       29709108134538 553355 
ago 2012353 k9,0 k1,5 k9761814,9 k12714 k1,5 k18 k772 k5,1 k       35989108134538 553345 
jul 2012351 k8,9 k1,4 k9741814,8 k12514 k1,5 k17 k762 k5,1 k       33648108134518 553345 
jun 2012348 k8,7 k1,4 k9731794,8 k11814 k1,5 k17 k753 k4,9 k       27934108134518 543345 
mai 2012345 k8,6 k1,4 k9661754,7 k11314 k1,5 k17 k742 k4,9 k       21174106134518 543295 
abr 2012343 k8,6 k1,4 k9661704,7 k11114 k1,5 k17 k736 k4,8 k       60643106134518 543295 
mar 2012341 k8,5 k1,4 k9651644,6 k11014 k1,5 k17 k732 k4,2 k       23354106134518 543285 
fev 2012339 k8,4 k1,4 k9651634,6 k10914 k1,4 k17 k672 k4,1 k       22451106134518 543285 
jan 2012337 k8,3 k1,4 k9651574,5 k10513 k1,4 k17 k660 k4,1 k       24910106134518 543285 
dez 2011334 k8,2 k1,3 k9591524,5 k10513 k1,4 k16 k651 k3,9 k       20758105124518 543245 
nov 2011332 k8,1 k1,3 k9511494,4 k10413 k1,3 k16 k642 k3,8 k       17616105124518 543165 
out 2011331 k8,0 k1,3 k9491494,3 k10113 k1,3 k16 k639 k3,7 k       24239103124518 543165 
set 2011328 k8,0 k1,3 k9441484,2 k9813 k1,3 k15 k632 k3,6 k       28018100124518 523165 
ago 2011326 k7,9 k1,3 k9271454,2 k9413 k1,3 k15 k624 k3,6 k       3261696124518 523035 
jul 2011323 k7,8 k1,3 k8821444,1 k9113 k1,3 k14 k613 k3,4 k       3582394124298 522825 
jun 2011318 k7,7 k1,3 k8151443,9 k8213 k1,3 k14 k549 k3,2 k       3327992123798 512685 
mai 2011315 k7,6 k1,3 k8101443,9 k7913 k1,2 k13 k508 k3,1 k       3016991123778 512665 
abr 2011312 k7,5 k1,2 k8081433,8 k7813 k1,2 k13 k428 k2,7 k       3259291123778 512645 
mar 2011307 k7,4 k1,2 k8031433,7 k7713 k1,1 k12 k419 k2,5 k       3442290123748 502645 
fev 2011256 k7,3 k1,2 k7911413,7 k7713 k1,1 k12 k413 k2,4 k       3021489123728 502555 
jan 2011216 k7,3 k1,2 k7821393,6 k7512 k1,1 k12 k406 k2,3 k       3403584123718 502525 
dez 2010213 k7,2 k1,2 k7671363,5 k7412 k1,0 k11 k396 k2,2 k       2712070123718 502515 
nov 2010211 k7,0 k1,2 k7621343,3 k7012 k99111 k388 k2,1 k       2476969123707 482515 
out 2010201 k6,9 k1,2 k7571333,3 k6912 k94910 k382 k2,0 k       2866668123687 472505 
set 2010192 k6,9 k1,2 k7481293,2 k6812 k92110 k375 k1,9 k       2946166123647 472475 
ago 2010176 k6,8 k1,2 k7441283,1 k6712 k9119,9 k359 k1,9 k       2972865123637 472455 
jul 2010172 k6,6 k1,1 k7291263,0 k6712 k7979,4 k351 k1,8 k       2829356123617 462425 
jun 2010165 k6,6 k1,1 k7161242,9 k6412 k7789,3 k344 k1,7 k       2548153123587 452365 
mai 2010161 k6,5 k1,1 k7121242,7 k6012 k7598,3 k335 k1,6 k       2941552123577 432365 
abr 2010158 k6,3 k1,1 k7071192,7 k5812 k7537,8 k328 k1,4 k       2224152123547 422355 
mar 2010156 k6,2 k1,1 k7051192,6 k5812 k7427,7 k323 k1,4 k       2448852123547 422335 
fev 2010152 k6,2 k1,0 k6971162,5 k5712 k7407,6 k317 k1,3 k       2810148123547 422295 
jan 2010150 k6,1 k1,0 k6871162,4 k5411 k7347,5 k310 k1,3 k       2679846123547 422215 
dez 2009147 k6,0 k9706801122,3 k5111 k7307,3 k304 k1,2 k       2459343123537 412195 
nov 2009145 k5,9 k9596501112,2 k4911 k7217,1 k295 k1,1 k       2359341123517 381965 
out 2009142 k5,7 k9296421052,2 k4711 k7166,9 k289 k1,1 k       2083737123487 381955 
set 2009140 k5,6 k9046121022,1 k4711 k7126,5 k245 k1,0 k       1537035123437 381734 
ago 2009139 k5,5 k845607952,1 k4611 k7076,3 k240 k955       1503335123437 381693 
jul 2009137 k5,4 k807605942,0 k4611 k7016,2 k229 k907       1183834123437 371693 
jun 2009136 k5,4 k784603942,0 k4611 k6946,0 k227 k889       1397433123437 361693 
mai 2009135 k5,2 k760591921,9 k4511 k6875,8 k225 k853       1921033123437 241693 
abr 2009133 k5,2 k750591881,9 k4511 k6725,5 k181 k771       1588333123437 241693 
mar 2009131 k5,1 k737587881,9 k4511 k6685,3 k174 k709       1399933123437 241653 
fev 2009129 k5,0 k670584871,8 k4310 k6455,1 k160 k650       1403930123437 241653 
jan 2009127 k4,9 k660582871,8 k3910 k6395,0 k137 k576       1185329123437 241643 
dez 2008126 k4,8 k654582851,7 k3910 k6314,8 k130 k553       1390429123437 241643 
nov 2008124 k4,7 k641580851,5 k3910 k6174,5 k113 k521       1706627123437 241643 
out 2008121 k4,6 k623577811,2 k3910 k5804,3 k57 k340       1252125123437 231643 
set 2008120 k4,5 k601568811,1 k3710 k5704,1 k47 k275       1452519123427 221642 
ago 2008118 k4,4 k552565771,1 k3610 k5483,8 k36 k237       1662319123417 211641 
jul 2008115 k4,3 k544557741,0 k359,9 k5263,7 k26 k196       1503212123417 21164  
jun 2008113 k4,2 k530550721,0 k359,9 k5193,6 k18 k150       138759123407 20162  
mai 2008111 k4,0 k51552471964359,8 k5113,4 k14 k128       94679123157 19162  
abr 2008110 k3,9 k50451365897319,7 k5043,3 k6,2 k78       71991123156 18161  
mar 2008108 k3,8 k49251064862319,7 k4903,2 k6,0 k62       87551113156 18159  
fev 2008107 k3,7 k48449861823319,6 k4283,0 k5,5 k53       116051113076 15158  
jan 200890 k3,6 k47849556719299,5 k4092,9 k4,5 k35       112151113046 15158  
dez 200771 k3,5 k47141351614289,4 k3912,6 k4,2 k31       65811102236 15158  
nov 200770 k3,3 k46241151596279,3 k3812,5 k4,0 k26       68771102226 15157  
out 200767 k3,3 k43338551571279,3 k3702,4 k3,9 k24       6944 102106 10149  
set 200766 k3,2 k43037950546279,2 k3252,3 k3,6 k21       5469 102056 10148  
ago 200765 k3,1 k38837649530279,2 k3162,2 k3,3 k17       7231 82046 10148  
jul 200763 k2,9 k38035248500279,1 k2382,2 k3,3 k10       5627 81806 10148  
jun 200761 k2,9 k35433447491279,1 k2332,1 k3,1 k9       5886 81786 10132  
mai 200760 k2,8 k35033045484279,0 k2082,1 k3,0 k8       6472 71786 7132  
abr 200759 k2,7 k33832643459268,8 k1952,0 k2,9 k5       5681 71776 6130  
mar 200757 k2,6 k32831343441268,7 k1822,0 k2,9 k5       7117 71726 4124  
fev 200743 k2,5 k31127043409233,4 k1431,8 k2,9 k4       5811 61326 3123  
jan 200741 k2,4 k30326142389231,6 k1401,7 k2,9 k4       5549 61236 3123  
dez 200640 k2,3 k29325941364211,4 k1341,5 k2,9 k4       7513 61226 3122  
nov 200637 k2,3 k28225941341211,3 k1281,5 k2,9 k4       6714 61226 3122  
out 200634 k2,1 k25518740324211,1 k1211,4 k2,9 k2       4500 61216 351  
set 200632 k2,0 k24518640295211,0 k1181,4 k2,9 k        5785 61206 351  
ago 200631 k1,9 k23716540277209801141,3 k2,9 k        6162 61014 351  
jul 200626 k1,8 k23115740264198911111,2 k2,9 k        14385 6964 150  
jun 200623 k1,6 k2249640252186001061,1 k2,9 k        14415 6354 150  
mai 200622 k1,5 k2129240226185461059692,8 k        7250 6354 146  
abr 200620 k1,2 k1899140198174991048802,8 k        7286 6354 145  
mar 200618 k9901688440173174341048242,8 k        5082 6284 145  
fev 200617 k8541527339159174081027562,8 k        2943 622   45  
jan 200616 k7551336838146173771017152,8 k        3000 221   45  
dez 200515 k67893653810915338976522,8 k        2607  21   44  
nov 200515 k2658752369413316876092,8 k        2110  8   44  
out 200514 k1978452368711286825972,8 k        2499  8   44  
set 200514 k12380493674625645565         2289  5   44  
ago 200512 k212041 34323131537         2030      41  
jul 200511 k191934 30319630514         4382      34  
jun 20059,3 k181134 30312829464         2754      34  
mai 20058,4 k181134 27310729433         2679      34  
abr 20057,7 k18934 2637129395         2528      34  
mar 20056,5 k18934 2226729362         5463      34  
fev 20055,3 k148  823626337         868         
jan 20054,9 k148  613624315         2510         
dez 20043,5 k128  612719251         1664         
nov 20042,7 k127  61717216         973         
out 20042,4 k116  5 617197         783         
set 20042,1 k96  5 517171         817         
ago 20041,8 k85  4 216149         619         
jul 20041,5 k75     15119                   
jun 20041,3 k65     15108                   
mai 20041,1 k64     1496                   
abr 200459964     1242                   
mar 200439654     1130                   
fev 200429654     915                   
jan 200416924     63                   
dez 200312123     53                   
nov 20038811      2                   
out 2003261                           
set 2003261                           
ago 200324                            
jul 200321                            
jun 200321                            
mai 200321                            
abr 200321                            
mar 200321                            
fev 200321                            
jan 200321                            
dez 200221                            
nov 200221                            
out 200221                            
set 200221                            
ago 200221                            
jul 200221                            
jun 200221                            
mai 200221                            
abr 200221                            
mar 200221                            
fev 200221                            
jan 2002          
dez 2001          
nov 2001          
out 2001          
set 2001          
ago 2001          
jul 2001          
jun 2001          

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2001: 1 1 The Open Source Definition

dez 2001: 1 1 The Open Source Definition

fev 2002: 1 1 The Open Source Definition

mar 2002: 1 1 Library of Congress Classification/Class C

jul 2002: 1 1 The Open Source Definition

ago 2002: 1 1 Library of Congress Classification/Class G

set 2002: 1 2 Library of Congress Classification/Class K

fev 2003: 1 1 Library of Congress Classification/Class A

mar 2003: 1 1 Library of Congress Classification/Class Q

mai 2003: 1 2 Library of Congress Classification/Class A , 2 1 Library of Congress Classification/Class Z

jul 2003: 1 1 The House on the Hill

ago 2003: 1 1 Library of Congress Classification/Class P, subclass P -- Philology linguistics

set 2003: 1 3 Library of Congress Classification/Class P, subclass PB -- Modern languages and Celtic languages , 2 2 Library of Congress Classification/Class P , 3 2 Library of Congress Classification/Class L , 4 2 Library of Congress Classification/Class C , 5 1 Library of Congress Classification/Class P, subclass P -- Philology linguistics

nov 2003: 1 16 Main Page , 2 3 The Tay Bridge Disaster , 3 2 The Sonnets , 4 2 William Shakespeare , 5 1 The Raven (Poe)

dez 2003: 1 11 Main Page , 2 2 The House on the Hill , 3 2 Bilac's poems , 4 2 Universal Declaration of Human Rights , 5 2 Declaration of Independence (Israel)

jan 2004: 1 3 To a friend intending a difficult work , 2 2 Beowulf (Harrison and Sharp) , 3 2 From a reading of Athenaeus , 4 1 Library of Congress Classification/Class P, subclass PS -- American Literature

fev 2004: 1 8 Main Page , 2 3 Manifesto of the Communist Party/2 , 3 3 Manifesto of the Communist Party , 4 2 Gadsby , 5 2 Advanced Automation for Space Missions , 6 2 Woodrow Wilson Urges Congress to Declare War on Germany , 7 2 John Kerry's testimony before the Senate Foreign Relations Committee , 8 2 Constitution of Fiji 1997 , 9 2 The Time Machine (Heinemann text) , 10 2 Karl Marx , 11 2 Friedrich Engels , 12 2 Manifesto of the Communist Party/1 , 13 2 Aphorisms , 14 1 The House on the Hill

mar 2004: 1 5 Main Page , 2 2 United Nations Security Council Resolution 687 , 3 2 Reinsurance Treaty , 4 2 The Song of Hiawatha , 5 2 Constitution of the People's Republic of China , 6 2 Montevideo Convention , 7 2 Ode (O'Shaughnessy) , 8 2 First Olbiil Era Kelulau , 9 2 Articles of Confederation and Perpetual Union , 10 1 Gadsby

abr 2004: 1 3 The New Method of Evaluation as Applied to Pi (unsourced) , 2 3 Main Page , 3 2 The Open Source Definition , 4 2 Library of Congress Classification/Class B , 5 2 United Nations Security Council Resolution 1035 , 6 2 United Nations Security Council Resolution 975 , 7 2 United Nations Security Council Resolution 1537 , 8 2 United Nations Security Council Resolution 1536 , 9 2 United Nations Security Council Resolution 1534 , 10 2 United Nations Security Council Resolution 1533 , 11 2 United Nations Security Council Resolution 1532 , 12 2 United Nations Security Council Resolution 1531 , 13 2 United Nations Security Council Resolution 1530 , 14 2 United Nations Security Council Resolution 1535 , 15 2 United Nations Security Council Resolution 687 , 16 2 United Nations Security Council Resolution 1529 , 17 2 House Divided Speech , 18 2 The Iliad (Butler) , 19 2 Homer , 20 2 Edwin Abbott Abbott , 21 2 United Nations Security Council Resolution 8

mai 2004: 1 5 Main Page , 2 3 United Nations Security Council Resolution 1412 , 3 3 John Calvin Coolidge , 4 3 Ronald Wilson Reagan , 5 3 Flame and Shadow , 6 3 US Army 15-6 Report of Abuse of Prisoners in Iraq , 7 3 Geneva Convention , 8 3 Edgar Allan Poe , 9 2 Gadsby , 10 2 United Nations Security Council Resolution 1446 , 11 2 United Nations Security Council Resolution 1428 , 12 2 United Nations Security Council Resolution 978 , 13 2 United Nations Security Council Resolution 736 , 14 2 United Nations Security Council Resolution 663 , 15 2 The Dying Swan , 16 2 Gerald Rudolph Ford , 17 2 James Earl Carter , 18 2 George Herbert Walker Bush , 19 2 John Fitzgerald Kennedy , 20 2 Mark Twain's Library of Humor , 21 2 Autobiography of a Yogi , 22 2 Joseph Isadore Lieberman , 23 2 Harry S. Truman , 24 2 United Nations Security Council Resolution 48 , 25 2 James Madison

jun 2004: 1 4 Main Page , 2 3 United Nations Security Council Resolution 443 , 3 3 Address at Omaha Beach , 4 3 Ronald Wilson Reagan , 5 2 The Open Source Definition , 6 2 United Nations Security Council Resolution 660 , 7 2 United Nations Security Council Resolution 1550 , 8 2 United Nations Security Council Resolution 1549 , 9 2 United Nations Security Council Resolution 1548 , 10 2 United Nations Security Council Resolution 1547 , 11 2 United Nations Security Council Resolution 1541 , 12 2 The Dying Swan , 13 2 Ozymandias (Shelley) , 14 2 Working Group Report on Detainee Interrogations , 15 2 United Nations Security Council Resolution 429 , 16 2 United Nations Security Council Resolution 441 , 17 2 United Nations Security Council Resolution 423 , 18 2 United Nations Security Council Resolution 455 , 19 2 Gerald Ford's First State of the Union Address , 20 2 United Nations Security Council Resolution 564

jul 2004: 1 3 The Angel of the Odd , 2 3 Edgar Allan Poe , 3 2 Treaty of Taipei , 4 2 Horatio Alger , 5 2 To Helen (Poe, 1831) , 6 2 Constitution of the German Empire , 7 2 Edward Bellamy , 8 2 The Parable of the Water-Tank , 9 2 The Works of the Late Edgar Allan Poe/Volume 1/MS. found in a Bottle , 10 2 The Autobiography of Charles Darwin , 11 2 Charles Robert Darwin , 12 2 Robinson Crusoe , 13 2 Daniel Defoe , 14 2 Mikhail Bakunin , 15 2 Constitution of Fiume , 16 2 The Works of the Late Edgar Allan Poe/Volume 2/Eldorado , 17 2 Leonid Brezhnev , 18 2 United Nations Security Council Resolution 131 , 19 2 Robert Herrick , 20 1 The Raven and Other Poems/The Valley of Unrest

ago 2004: 1 5 John Adams (1735-1826) , 2 3 Robert Service , 3 3 Henrik Johan Ibsen , 4 3 Karl Marx , 5 3 Main Page , 6 2 Ralph Waldo Emerson , 7 2 Upton Beall Sinclair , 8 2 Thomas Paine , 9 2 The Hunting of the Snark , 10 2 The Five Nations/The Broken Men , 11 2 Citizenship in a Republic , 12 2 Brave Men at Fires , 13 2 Benjamin Franklin , 14 2 Letter on a Manuscript against the Doctrine of a Particular Providence , 15 2 Typee , 16 2 The Adventure of the Speckled Band , 17 2 The Atlantic Monthly/Volume 10/Number 60/Autumnal Tints , 18 2 Henry David Thoreau , 19 2 Peer Gynt , 20 2 David Hume , 21 2 An Enquiry Concerning Human Understanding , 22 2 Herbert George Wells , 23 2 Herman Melville , 24 2 Battle-Pieces and Aspects of the War , 25 2 Bartleby the Scrivener

set 2004: 1 7 Main Page , 2 4 John Adams (1735-1826) , 3 3 John Dewey , 4 3 Fleeming Jenkin , 5 3 Henry Abbey , 6 3 Martin Luther King , 7 3 Carl Clinton Van Doren , 8 3 Mark Van Doren , 9 3 Karl Marx , 10 3 Friedrich Engels , 11 2 John Locke , 12 2 Leon Trotsky , 13 2 The Works of the Late Edgar Allan Poe/Volume 1/The Pit and the Pendulum , 14 2 Mahadev Desai , 15 2 Robert Browning , 16 2 Thomas Mann , 17 2 The Science of Getting Rich , 18 2 Declaration of Paris , 19 2 William Percy French , 20 2 Stephen Leacock , 21 2 The Wealth of Nations/Book V/Chapter 3 , 22 2 The Wealth of Nations/Book V/Chapter 2 , 23 2 The Wealth of Nations/Book V/Chapter 1 , 24 2 The Wealth of Nations/Book IV/Chapter 9 , 25 2 The Wealth of Nations/Book IV/Chapter 8

out 2004: 1 5 Main Page , 2 3 Edith Nesbit , 3 3 John Kerry , 4 3 Arthur Conan Doyle , 5 3 Constitution of the United States of America , 6 2 Max Weber , 7 2 Kidnapped (Stevenson) , 8 2 John Buchan , 9 2 Treasure Island (1883) , 10 2 Robert Louis Stevenson , 11 2 The Railway Children , 12 2 Francis Bacon , 13 2 Essays, civil and moral (Harvard Classics) , 14 2 James K. Polk's Inaugural Address , 15 2 James Knox Polk , 16 2 Novanglus Essays/No. 9 , 17 2 Novanglus Essays/No. 8 , 18 2 Oscar O'Flahertie Wills Wilde , 19 2 Arthur Conan Doyle/Sherlock Holmes , 20 2 Adna Romanza Chaffee , 21 2 Brave and Bold , 22 2 The Memoirs of Sherlock Holmes/The 'Gloria Scott' , 23 2 Robert Service , 24 2 Charles Robert Darwin , 25 2 Richard Bruce Cheney

nov 2004: 1 4 Nathaniel Hawthorne , 2 4 George Walker Bush , 3 4 William Shakespeare , 4 4 Main Page , 5 3 The Last of the Dragons , 6 3 Francis Bacon , 7 3 Charles Sanders Peirce , 8 3 John Adams (1735-1826) , 9 3 Charles Lutwidge Dodgson , 10 3 Karl Marx , 11 3 Arthur Conan Doyle , 12 2 The Open Source Definition , 13 2 Library of Congress Classification/Class P, subclass PJ -- Oriental philology and literature , 14 2 Library of Congress Classification/Class N , 15 2 Mosses from an Old Manse/The Celestial Rail-road , 16 2 Alexander Muir , 17 2 Andrew Jackson , 18 2 Andrew Johnson , 19 2 Martin Van Buren , 20 2 John Tyler , 21 2 The Laxdaela Saga , 22 2 Scarlet Letter (1850) 2ed , 23 2 Is There a Santa Claus? (New York Sun) , 24 2 Zachary Taylor , 25 2 William Howard Taft

dez 2004: 1 3 Emily Dickinson , 2 3 James Joyce , 3 3 Main Page , 4 2 John Locke , 5 2 Pius XI , 6 2 NASA FACTS/Cover Letter , 7 2 Poems by Wilfred Owen/Disabled , 8 2 Love's Philosophy , 9 2 The Scrutiny , 10 2 To Celia (Jonson) , 11 2 The Funeral (Donne) , 12 2 Elegy XVI: On His Mistress , 13 2 A Blighted Life/Section 8 , 14 2 Elegy XIX: To His Mistress Going to Bed , 15 2 A Blighted Life/Section 7 , 16 2 A Blighted Life/Section 6 , 17 2 Richard Nixon's farewell address , 18 2 A Blighted Life/Section 5 , 19 2 Myths of the Norsemen: From the Eddas and Sagas , 20 2 A Blighted Life/Section 4 , 21 2 A Blighted Life/Section 3 , 22 2 A Blighted Life/Section 2 , 23 2 Troilus and Criseyde/Book V , 24 2 Troilus and Criseyde/Book IV , 25 2 Troilus and Criseyde/Book III

jan 2005: 1 4 Edgar Allan Poe , 2 4 Main Page , 3 3 \"Arcturus\" is his other name — , 4 3 Nobody knows this little Rose — , 5 3 Garland for Queens, may be — , 6 3 If recollecting were forgetting , 7 3 Summer for thee, grant I may be , 8 3 Adrift! A little boat adrift! , 9 3 If those I loved were lost , 10 3 So has a Daisy vanished , 11 3 Morns like these — we parted — , 12 3 There is a morn by men unseen — , 13 3 I had a guinea golden — , 14 3 One Sister have I in our house , 15 3 My wheel is in the dark! , 16 3 Through lane it lay — through bramble — , 17 3 The feet of people walking home , 18 3 Emily Dickinson/1-99 , 19 3 Awake ye muses nine, sing me a strain divine , 20 3 George Orwell , 21 3 Howard Phillips Lovecraft , 22 3 George Walker Bush , 23 2 Hymn of Pan , 24 2 To Stella (Shelley) , 25 2 Frontiers

fev 2005: 1 5 Main Page , 2 4 Constitution of the United States of America , 3 3 The Prince (Hill Thomson) , 4 3 Charles Robert Darwin , 5 2 Grimm's Household Tales (Edwardes)/The Golden Goose , 6 2 William Wines Phelps , 7 2 The Convict King , 8 2 There is no Frigate like a Book , 9 2 William Langland , 10 2 The Call of the Wild (London) , 11 2 Jack London , 12 2 Ten Days That Shook the World , 13 2 John Reed , 14 2 Far from the Madding Crowd , 15 2 Commonwealth of Australia Constitution Act , 16 2 Hawaii Admission Act , 17 2 Nebraska v. Verma J. Harrison , 18 2 The Art of War (Sun) , 19 2 Aristotle , 20 1 Salvador Allende's Last Speech

mar 2005: 1 10 Main Page , 2 5 Constitution of the United States of America , 3 3 Bleak House/Chapter VII , 4 3 Bleak House/Chapter VI , 5 3 Bleak House/Chapter V , 6 3 Bleak House/Chapter IV , 7 3 Bleak House/Chapter III , 8 3 Bleak House/Chapter II , 9 3 Bleak House/Chapter I , 10 3 Bleak House/Preface , 11 3 Barnaby Rudge/Chapter the Last , 12 3 Barnaby Rudge/Chapter 81 , 13 3 Barnaby Rudge/Chapter 80 , 14 3 Barnaby Rudge/Chapter 79 , 15 3 Barnaby Rudge/Chapter 78 , 16 3 Barnaby Rudge/Chapter 77 , 17 3 Barnaby Rudge/Chapter 76 , 18 3 Barnaby Rudge/Chapter 75 , 19 3 Barnaby Rudge/Chapter 74 , 20 3 Barnaby Rudge/Chapter 73 , 21 3 Barnaby Rudge/Chapter 72 , 22 3 Barnaby Rudge/Chapter 71 , 23 3 Barnaby Rudge/Chapter 70 , 24 3 Barnaby Rudge/Chapter 69 , 25 3 Barnaby Rudge/Chapter 68

abr 2005: 1 5 Main Page , 2 3 The Return of the Native/Book 6/Chapter 4 , 3 3 Franklin Delano Roosevelt's Tenth State of the Union Address , 4 3 Samuel Taylor Coleridge , 5 3 Edgar Allan Poe , 6 2 The Raven (Poe) , 7 2 The Dying Swan , 8 2 Excelsior (Longfellow) , 9 2 Forged from the Love of Liberty , 10 2 Gladstone's 1886 Manifesto , 11 2 The Future Policy of the Liberal Party , 12 2 Tales of a Wayside Inn/Part First/The Landlord's Tale/Paul Revere's Ride , 13 2 Enoch Powell , 14 2 William Ewart Gladstone , 15 2 Benjamin Disraeli , 16 2 Conservative Principles , 17 2 Rotuma Act , 18 2 A Vindication of the Doctrine that the Sacrifice of the Mass is Idolatry , 19 2 Oliver Twist/Chapter 1 , 20 2 Catholic Emancipation , 21 2 The Citizenship of Women: A Plea for Woman's Suffrage , 22 2 Irish Home Rule Speech , 23 2 Response to Woodrow Wilsons Speech of 11 February 1918 , 24 2 Fourteen Points Speech , 25 2 Suez Canal Speech

mai 2005: 1 11 Main Page , 2 4 Greeting to American Soldiers by the Women of France , 3 3 Munich Pact , 4 3 Shulchan Aruch/Orach Chaim , 5 3 After Death , 6 3 Answer , 7 3 Anglo-French Declaration , 8 3 Goblin Market and Other Poems (1862)/\"A Bruised Reed Shall He Not Break\" , 9 3 Francis Whiting Halsey , 10 3 The Awakening (Chopin) , 11 3 Dracula , 12 3 US Army 15-6 Report of Abuse of Prisoners in Iraq , 13 3 Edgar Allan Poe , 14 3 Constitution of the United States of America , 15 2 Rudyard Kipling/Poetry , 16 2 The Art of War (Machiavelli) , 17 2 Eric Defoort , 18 2 An Attempt to Dominate the World by Force , 19 2 Nancy Ling Perry , 20 2 Honourary Citizenship Award for Winston Churchill , 21 2 Executive Order 13112 , 22 2 Executive Order 9066 , 23 2 Letter from Congress regarding Downing Street memo , 24 2 Shulchan Aruch/Even HaEzer/25 , 25 2 Poems That Every Child Should Know/Old Ironsides

jun 2005: 1 10 Main Page , 2 4 Percy Bysshe Shelley , 3 3 United States Code/Title 10/Subtitle A/Part II/Chapter 47 , 4 3 United States Code , 5 3 William Schwenck Gilbert , 6 3 The Sonnets , 7 3 Universal Declaration of Human Rights , 8 2 He is a Member of Parliament , 9 2 Adonaïs , 10 2 Flag Code of India , 11 2 What think you of Christ? is the test , 12 2 A Word from Jesus Calms the Sea , 13 2 The Bohemian Girl (Bunn) , 14 2 Alfred Bunn , 15 2 Sonnet 10 (Shakespeare) , 16 2 Sonnet 9 (Shakespeare) , 17 2 Sonnet 8 (Shakespeare) , 18 2 Sonnet 7 (Shakespeare) , 19 2 Sonnet 6 (Shakespeare) , 20 2 Sonnet 5 (Shakespeare) , 21 2 Sonnet 4 (Shakespeare) , 22 2 Sonnet 3 (Shakespeare) , 23 2 Sonnet 2 (Shakespeare) , 24 2 Sonnet 1 (Shakespeare) , 25 2 Greek Creation Myth

jul 2005: 1 16 Main Page , 2 4 1911 Encyclopædia Britannica/Vol 1:1 , 3 4 1911 Encyclopædia Britannica , 4 4 George Walker Bush , 5 4 The War of the Worlds , 6 3 Édouard Daladier , 7 3 Karl von Clausewitz , 8 3 1911 Encyclopædia Britannica/Vol 1:3 , 9 3 1911 Encyclopædia Britannica/Vol 1:2 , 10 3 1911 Encyclopædia Britannica/United States, The , 11 3 1911 Encyclopædia Britannica/A , 12 3 Algernon Blackwood , 13 3 Clark Ashton Smith , 14 3 Tony Blair , 15 3 Barack Hussein Obama , 16 3 Montesquieu , 17 3 Encyclopædia Britannica , 18 2 Harold Macmillan , 19 2 On War , 20 2 Divine Comedy (Longfellow 1867)/Volume 1/Canto 1 , 21 2 Divine Comedy (Longfellow 1867)/Volume 1/Canto 2 , 22 2 Divine Comedy (Longfellow 1867)/Volume 1/Canto 3 , 23 2 Divine Comedy (Longfellow 1867)/Volume 1/Canto 4 , 24 2 Divine Comedy (Longfellow 1867)/Volume 1/Canto 5 , 25 2 Divine Comedy (Longfellow 1867)/Volume 1/Canto 6

ago 2005: 1 10 Main Page , 2 4 Joseph Medlicott Scriven , 3 4 Colin Luther Powell , 4 4 Dante Alighieri , 5 4 Charles John Huffam Dickens , 6 3 Rudyard Kipling/Poetry , 7 3 Harold James Ruthven Murray , 8 3 Colin L. Powell's statement at press briefing on new U.S. humanitarian assistance for Afghanistan , 9 3 John Muir , 10 3 Robert Emmett , 11 3 Rules for the Direction of the Mind , 12 3 Edith Sitwell , 13 3 Opticks , 14 3 William Cullen Bryant , 15 3 Swami Vivekananda , 16 3 René Descartes , 17 3 Ralph Waldo Emerson , 18 3 George Gordon Byron , 19 3 Henry Wadsworth Longfellow , 20 3 The Internationale (Pottier, English) , 21 2 Salvador Allende's Last Speech , 22 2 The Open Source Definition , 23 2 Thomas De Quincey , 24 2 Robin Cook , 25 2 Library of Congress Classification/Class D

set 2005: 1 5 Constitution of the United States of America , 2 4 John Adams (1735-1826) , 3 4 The Internationale (Pottier, English) , 4 3 A Letter From The Rocky Mountains, 1836 (Spalding) , 5 3 Tony Blair , 6 3 Snorri Sturluson , 7 3 Herbert George Wells , 8 3 9/11 Commission Report , 9 3 The Star-Spangled Banner , 10 3 Universal Declaration of Human Rights , 11 2 The Raven (Poe) , 12 2 Rudyard Kipling/Poetry , 13 2 March of the Volunteers , 14 2 The Ballad of the Red Earl , 15 2 Don Quixote/Volume 1 , 16 2 Don Quixote/Translator's Preface/Some Commendatory Verses , 17 2 Don Quixote , 18 2 Émile François Zola , 19 2 Moonlight (Smith) , 20 2 Niccolò Machiavelli , 21 2 The Art of War (Machiavelli)/Preface , 22 2 Euripides , 23 2 Kama Sutra , 24 2 1911 Encyclopædia Britannica/Andronicus I , 25 2 1911 Encyclopædia Britannica/Andronicus II

out 2005: 1 4 Constitution of the United States of America , 2 3 Pro Marcello , 3 3 Global War on Terrorism , 4 2 The Open Source Definition , 5 2 Love and Death (Yeats) , 6 2 Elizabeth I's Farewell Speech , 7 2 The Sykes–Picot Agreement , 8 2 Richard Barnfield , 9 2 Don Juan (Byron)/Dedication , 10 2 Don Juan (Byron) , 11 2 \"Style is a greater Social Asset than Beauty\" , 12 2 The Raggle Taggle Gypsy , 13 2 Mariana , 14 2 The Last of the Light Brigade , 15 2 Alexandre Dumas (1802-1870) , 16 2 The Count of Monte Cristo , 17 2 The Count of Monte Cristo/Chapter 1 , 18 2 Paul Keating , 19 2 Articles Declaratory of the Constitution of the Church of Scotland , 20 2 The Pickering Manuscript/Auguries of Innocence , 21 2 John Ormsby , 22 2 Elizabeth I of England , 23 2 James Edwin Thorold Rogers , 24 2 Divine Comedy (Longfellow 1867)/Volume 1/Canto 1 , 25 2 Donald Rumsfeld

nov 2005: 1 3 The Count of Monte Cristo/Chapter 21 , 2 3 The Count of Monte Cristo/Chapter 20 , 3 3 The Count of Monte Cristo/Chapter 15 , 4 3 The Count of Monte Cristo/Chapter 12 , 5 3 The Count of Monte Cristo/Chapter 10 , 6 3 The Count of Monte Cristo/Chapter 9 , 7 3 The Count of Monte Cristo/Chapter 8 , 8 3 The Count of Monte Cristo/Chapter 6 , 9 3 The Count of Monte Cristo/Chapter 2 , 10 3 Select Historical Documents of the Middle Ages/Book III/The Donation of Constantine , 11 3 USDOJ OSC Federal indictment of Lewis Libby , 12 3 The Sword Speech , 13 3 The Count of Monte Cristo , 14 3 Charles John Huffam Dickens , 15 3 Rudyard Kipling , 16 3 Alfred Tennyson , 17 2 California Streets and Highways Code/Section 301-635 , 18 2 A Letter From The Rocky Mountains, 1836 (Spalding) , 19 2 Emily Dickinson , 20 2 Kim/Chapter 1 , 21 2 Kim , 22 2 The Sun Was Slumbering in the West , 23 2 The Bridge of Sighs , 24 2 The Song of the Shirt , 25 2 Faithless Sally Brown

dez 2005: 1 3 On the Crime Against Kansas , 2 3 1927 New Jersey state highway renumbering , 3 3 Talmud , 4 3 Little Women , 5 3 René Descartes , 6 3 Jamaica, Land We Love , 7 3 James Madison , 8 3 Rudyard Kipling , 9 3 Samuel Langhorne Clemens , 10 3 Bible (King James)/Genesis , 11 3 Constitution of the United States of America , 12 2 California Streets and Highways Code/Section 301-635 , 13 2 Sleeping Beauty , 14 2 Reconstruction Acts , 15 2 Elizabeth Bishop , 16 2 The New Student's Reference Work , 17 2 The Raven (Poe) , 18 2 Sun Yat-sen's speech on Pan-Asianism , 19 2 John Ball (priest) , 20 2 Harold Frederic , 21 2 Matthew George Easton , 22 2 Diary of Samuel Pepys/1662/May , 23 2 Diary of Samuel Pepys/1662/March , 24 2 Diary of Samuel Pepys/1662/February , 25 2 Diary of Samuel Pepys/1662/January

jan 2006: 1 4 Osama bin Laden , 2 4 Jane Eyre (c. 1900 W. Nicholson & Sons edition) , 3 4 Constitution of the United States of America , 4 3 A Letter From The Rocky Mountains, 1836 (Spalding) , 5 3 Bahá'u'lláh , 6 3 The Times/1790/Obituary/Adam Smith , 7 3 Alexander Sergeyevich Pushkin , 8 3 USA PATRIOT Act/Title I , 9 3 USA PATRIOT Act , 10 3 USA PATRIOT Act/Title II , 11 3 Adriana , 12 3 Sometimes , 13 3 To You , 14 3 José Asunción Silva , 15 3 Beyond Good and Evil , 16 3 William James , 17 3 Lev Nikolayevich Tolstoy , 18 3 Plato , 19 3 Richard Milhous Nixon , 20 3 Angutivaun Taina , 21 3 George Walker Bush , 22 3 Abraham Lincoln , 23 3 The Time Machine (Heinemann text) , 24 3 The Tragedy of Macbeth (unsourced) , 25 3 Main Page

fev 2006: 1 4 Wang Xizhi , 2 4 Jules Verne , 3 3 Isabella Augusta Persse Gregory , 4 3 Zodiac Killer letters , 5 3 Albert Richard Parsons , 6 3 My soul is dark , 7 3 Lucius Apuleius , 8 3 George W. Bush's Sixth State of the Union Address , 9 3 Alexander Sergeyevich Pushkin , 10 3 USA PATRIOT Act , 11 3 Samuel Smiles , 12 3 Robert Emmet , 13 3 Friedrich Nietzsche , 14 3 What a Friend We Have in Jesus (unsourced) , 15 3 Robert Emmet's letter to Sarah Curran , 16 3 Bolesław Prus , 17 3 Barack Hussein Obama , 18 3 Hans Christian Andersen , 19 3 Edmund Spenser , 20 3 Wuthering Heights (unsourced edition) , 21 3 Jonathan Swift , 22 3 Robert Louis Stevenson , 23 3 Gilbert Keith Chesterton , 24 2 Local Government Act 1972 , 25 2 Sacred Books of the East

mar 2006: 1 6 Constitution of the United States of America , 2 5 Oscar O'Flahertie Wills Wilde , 3 4 Reconstruction Acts , 4 4 John Greenleaf Whittier , 5 4 Swami Vivekananda , 6 4 Robert Louis Stevenson , 7 4 Plato , 8 3 A Letter From The Rocky Mountains, 1836 (Spalding) , 9 3 Beasts and Super-Beasts/Laura , 10 3 Kumartuli Speech , 11 3 Jhalakati Speech , 12 3 Beadon Square Speech , 13 3 Sri Aurobindo , 14 3 George Saintsbury , 15 3 An Encounter , 16 3 At Verona , 17 3 Eliza Haywood , 18 3 Wild Weasel mission 1 October 1967 , 19 3 Virginia Woolf , 20 3 Winning the War in Iraq , 21 3 Procopius , 22 3 The Antichrist , 23 3 Energy Security is National Security , 24 3 Charles Fort , 25 3 War Message to Congress

abr 2006: 1 5 The New Student's Reference Work , 2 5 Constitution of the United States of America , 3 4 Constitution of the Libertarian Party of Canada , 4 3 The Raven (Poe) , 5 3 Insects, Their Ways and Means of Living , 6 3 Salomé , 7 3 The Polish Question , 8 3 The Annexation of Cracow , 9 3 Les Misérables , 10 3 The New Student's Reference Work/Yellow Bird , 11 3 The Wonderful Wizard of Oz/Chapter 1 , 12 3 A true account of Nayomy Wise , 13 3 Beasts and Super-Beasts/On Approval , 14 3 Beasts and Super-Beasts/The Philanthropist and the Happy Cat , 15 3 Beasts and Super-Beasts/Fur , 16 3 Beasts and Super-Beasts/The Lumber Room , 17 3 Beasts and Super-Beasts/The Name-Day , 18 3 Beasts and Super-Beasts/The Elk , 19 3 Beasts and Super-Beasts/A Defensive Diamond , 20 3 Beasts and Super-Beasts/The Stalled Ox , 21 3 Beasts and Super-Beasts/A Holiday Task , 22 3 Beasts and Super-Beasts/Clovis on Parental Responsibilities , 23 3 Beasts and Super-Beasts/The Stake , 24 3 Beasts and Super-Beasts/The Forbidden Buzzards , 25 3 Beasts and Super-Beasts/The Quince Tree

mai 2006: 1 10 Ahmadinejad's 2006 letter to Bush , 2 6 A Grave Threat to Peace , 3 5 The Time Machine (Heinemann text) , 4 4 The Channel Tunnel (Gladstone) , 5 4 Mother's Day Proclamation , 6 4 1911 Encyclopædia Britannica/Vol 17 LORD CHAMBERLAIN to MECKLENBURG , 7 4 1911 Encyclopædia Britannica/Vol 1 A to ANDROPHAGI , 8 4 Found , 9 4 Bible (King James)/Genesis , 10 3 Virginia Statute for Religious Freedom , 11 3 Bible (Wycliffe)/3 Joon , 12 3 Bible (Wycliffe)/Dedis of Apostlis , 13 3 Bible (Wycliffe)/John , 14 3 Bible (Wycliffe)/Luke , 15 3 Bible (Wycliffe)/Mark , 16 3 Bible (Wycliffe)/Matheu , 17 3 Bible (Wycliffe)/2 Machabeis , 18 3 Bible (Wycliffe)/1 Machabeis , 19 3 Bible (Wycliffe)/Naum , 20 3 Bible (Wycliffe)/Preier of Jeremye , 21 3 Bible (Wycliffe)/Psalms , 22 3 Bible (Wycliffe)/Deuteronomy , 23 3 Bible (Wycliffe)/Numbers , 24 3 Bible (Wycliffe)/Leviticus , 25 3 Bible (Wycliffe)/Exodus

jun 2006: 1 5 Dulce et Decorum est (Stallworthy edition) , 2 5 Gettysburg Address , 3 4 The Open Source Definition , 4 4 Gaston Louis Alfred Leroux , 5 4 Power and Global Leadership , 6 4 Daisy Bell , 7 4 Rusk note of 1951 , 8 4 James Clerk Maxwell , 9 4 Metaphysics (Ross, 1908) , 10 4 United States Bill of Rights , 11 4 Dao De Jing , 12 4 Laozi , 13 4 The Iliad (Butler) , 14 3 The Age of Fable/Chapter XI , 15 3 Scots of the Riverina (poem) , 16 3 United States White House briefing on terror threats of August 6, 2001 , 17 3 Henry Mayhew , 18 3 On Macedonian Matters , 19 3 William Wilkie Collins , 20 3 Silas Marner/Chapter 1 , 21 3 1911 Encyclopædia Britannica/Jehovah , 22 3 James Legge , 23 3 A Treatise on Electricity and Magnetism/Preface , 24 3 A Treatise on Electricity and Magnetism - Volume 1.djvu/23 , 25 3 Paradise Regained/Book 4

jul 2006: 1 5 Poems That Every Child Should Know , 2 5 Rail-Head , 3 4 Sun Yat-sen's speech on Pan-Asianism , 4 4 Speech against the bill for laying a tax on Papists , 5 4 The Macedonian question , 6 4 Tommaso da Celano , 7 4 Autobiography of a Yogi , 8 4 A Tale of Two Cities (1898) , 9 4 The Cambridge History of American Literature , 10 4 George Washington's First State of the Union Address , 11 3 Pro Marcello , 12 3 Cligès , 13 3 On Chorea , 14 3 Charlotte Elizabeth Schreiber , 15 3 Cable Television Consumer Protection and Competition Act of 1992 , 16 3 Thomas Malory , 17 3 Chrétien de Troyes , 18 3 Rip Van Winkle , 19 3 Petko Rachov Slaveykov , 20 3 Bede , 21 3 Moniot d'Arras , 22 3 The Cave Girl , 23 3 Chanson de Rencontre (d'Arras) , 24 3 The Curse of Capistrano , 25 3 Saxo Grammaticus

ago 2006: 1 4 Why I joined the Army , 2 3 United Nations Security Council Resolution 1697 , 3 3 The Hunchback of Notre Dame , 4 3 Samuel Adams Drake , 5 3 The Macedonian question , 6 3 Fear (Abdullah) , 7 3 The Wind in the Willows (1913) , 8 3 What they Think in the Trenches , 9 3 Songs of Experience , 10 3 Representative Men/Shakespeare; or, the Poet , 11 3 The Origin of Species (1872) , 12 3 United Nations Security Council Resolution 338 , 13 3 United States Declaration of Independence (Dunlap Broadside) , 14 2 The Open Source Definition , 15 2 Administrative Order 9 , 16 2 Soiled Dove Plea , 17 2 Metamorphoses (tr. Garth, Dryden, et al.) , 18 2 Sacred Books of the East , 19 2 The Tay Bridge Disaster , 20 2 The Lusiads (tr. Mickle) , 21 2 The Nixon Tapes/4-14-73 , 22 2 The Rime of the Ancyent Mariner (1798) , 23 2 The New Student's Reference Work/Fortuny y Carbo, Mariano , 24 2 Prairie Flowers/Winter , 25 2 The New Student's Reference Work/Fortune Bay

set 2006: 1 5 A Ballad of Suicide , 2 4 Civil Rights Act of 1866 , 3 4 Brundtland Report.djvu/1 , 4 4 The Kalevala , 5 3 Lil the Whore , 6 3 Reconstruction Acts , 7 3 `Abdu'l-Bahá , 8 3 The New Student's Reference Work , 9 3 Brundtland Report.djvu/3 , 10 3 Jewish Encyclopedia , 11 3 An account of the founding of St. Louis , 12 3 The Lusiads (tr. Mickle) , 13 3 Additional amendments to the United States Constitution , 14 3 The Annotated 'Travels with a Donkey in the Cévennes'/Map , 15 3 The Annotated 'Travels with a Donkey in the Cévennes'/Background , 16 3 The Annotated 'Travels with a Donkey in the Cévennes'/Introduction , 17 3 The Annotated 'Travels with a Donkey in the Cévennes'/Velay , 18 3 The Annotated 'Travels with a Donkey in the Cévennes'/Dedication , 19 3 The Annotated 'Travels with a Donkey in the Cévennes' , 20 3 Frog Poem , 21 3 Moby-Dick , 22 3 London (Songs of Experience) , 23 3 Holy Thursday (Blake, 1794) , 24 3 Songs of Innocence/Introduction , 25 3 William Blake

out 2006: 1 4 Constitution of the United States of America , 2 3 The Hand That Rocks the Cradle , 3 3 1911 Encyclopædia Britannica/Brick , 4 3 Aristophanes: The Eleven Comedies/Birds , 5 3 Moniot d'Arras , 6 3 Aristophanes , 7 3 Additional amendments to the United States Constitution , 8 3 Elegie II , 9 3 Frog Poem , 10 3 Tao Te Ching , 11 3 Tao Te Ching , 12 3 Mishnah/Seder Zeraim/Tractate Berakhot/Chapter 1/4/Translation , 13 3 Bible (Mechon Mamre)/Torah/Bereishit , 14 3 Joseph Addison , 15 3 Rewards and Fairies/If— , 16 2 Elfenlied , 17 2 Hagia Sophia , 18 2 More tender than tender , 19 2 To read only children's books , 20 2 The Christmas trees are shining , 21 2 The careful and muted sound , 22 2 Library of Congress Classification/Class Q, subclass QK -- Botany , 23 2 Osama bin Laden's letter of assurance to a Mujahadeen father , 24 2 United Nations Security Council Resolution 1696 , 25 2 United Nations Security Council Resolution 1704

nov 2006: 1 4 Gargantua , 2 4 The Tragedy of Hamlet, Prince of Denmark , 3 3 Saddam speech January 17, 2001 , 4 3 Saddam speech August 8, 1999 , 5 3 Saddam speech July 17, 1999 , 6 3 9/11 Dispatcher transcript , 7 3 Library of Congress Classification/Class D, subclass DC -- History of France, Andorra, and Monaco , 8 3 Library of Congress Classification/Class D , 9 3 Sacred Books of the East , 10 3 Korean Armistice Agreement , 11 3 Mahmoud Ahmadinejad's 2006 letter to the American people , 12 3 Louis Riel , 13 3 William Styron - interview , 14 3 Come not, when I am dead , 15 3 Samuel Butler (1835-1902) , 16 3 A Night in a Moorish Harem , 17 3 Mozart and Salieri , 18 3 Pantagruel , 19 3 John Cunningham , 20 3 Orville Wright diary/1902 , 21 3 Draft United Nations Guiding principles on Human Rights and Extreme Poverty , 22 3 Augustine of Hippo , 23 3 Katherine Philips , 24 3 With Blood and Iron , 25 3 ACLU v. NSA/438 F. Supp. 2d 754

dez 2006: 1 6 The New Student's Reference Work , 2 6 Iraq Study Group Report , 3 4 Iraq Study Group Report/II , 4 4 Iraq Study Group Report/I , 5 4 William Butler Yeats , 6 4 Mapp v. Ohio , 7 3 Reconstruction Acts , 8 3 United Nations Security Council Resolution 1696 , 9 3 Botticelli's Madonna in the Louvre , 10 3 Alfred Edward Woodley Mason , 11 3 Iraq Study Group Report/Letter from the Co-Chairs , 12 3 Charles Kingsley , 13 3 Clark Ashton Smith , 14 3 Gideon v. Wainwright , 15 3 United Nations Security Council Resolution 111 , 16 3 The Tragedy of Othello, The Moor of Venice , 17 2 New York Times v. Sullivan (376 U.S. 254) , 18 2 Anthem for Doomed Youth (Stallworthy edition) , 19 2 A Letter From The Rocky Mountains, 1836 (Spalding) , 20 2 National Thanksgiving Proclamation , 21 2 Sacred Books of the East , 22 2 Saddam Hussein , 23 2 The New Student's Reference Work/Atom , 24 2 The New Student's Reference Work/Atoll , 25 2 The New Student's Reference Work/Atlantis

jan 2007: 1 5 Constitution of the United States of America , 2 4 Presidential Speech Regarding Iraq, January 10 2007 , 3 4 Additional amendments to the United States Constitution , 4 4 Barack Hussein Obama , 5 4 George Walker Bush , 6 4 The Tragedy of Romeo and Juliet (unsourced) , 7 3 Administrative Order 9 , 8 3 The New Student's Reference Work , 9 3 Most Influential Books , 10 3 Augustine of Hippo , 11 3 Littell's Living Age/Volume 115/Issue 1489/Paradise or Peacock Fish , 12 3 The Canterbury Tales/The Monk's Tale , 13 3 Achmed Abdullah , 14 3 Malcolm X , 15 3 Invictus , 16 3 Universal Declaration of Human Rights , 17 2 Bryan Waller Procter , 18 2 A Letter From The Rocky Mountains, 1836 (Spalding) , 19 2 Virginia Statute for Religious Freedom , 20 2 Enoch , 21 2 John Locke , 22 2 Ode to the Queen , 23 2 The New Student's Reference Work/Nanking , 24 2 Madame Bovary (Marx-Aveling translation)/Part I/Chapter IV , 25 2 Madame Bovary (Marx-Aveling translation)/Part I/Chapter III

fev 2007: 1 7 Transcript of the 'friendly fire' incident video (28 March 2003) , 2 5 Darkness (Byron) , 3 4 The New Student's Reference Work , 4 4 Richard Francis Burton , 5 4 The New Student's Reference Work/Alaska , 6 4 Most Influential Books , 7 4 The New Student's Reference Work/Australia , 8 3 Child's Ballads/10 , 9 3 Child's Ballads/286 , 10 3 The New Student's Reference Work/Vol I , 11 3 Child's Ballads/1 , 12 3 Child's Ballads , 13 3 Cyrus cylinder , 14 3 Walter de la Mare , 15 3 The Perfumed Garden , 16 3 The Long Island Rail Road: A Comprehensive History, Part Two: The Flushing, North Shore & Central Railroad , 17 3 The Travels of Marco Polo/Preface/Chapter 1 , 18 3 The History of the Ten \"Lost\" Tribes/Part 2/Chapter 1 , 19 3 Treaty on European Union , 20 3 Resignation letter (Roosevelt) , 21 3 Additional amendments to the United States Constitution , 22 3 The Annotated 'Travels with a Donkey in the Cévennes'/Map , 23 3 The Annotated 'Travels with a Donkey in the Cévennes'/Background , 24 3 The Annotated 'Travels with a Donkey in the Cévennes'/The Last Day , 25 3 The Annotated 'Travels with a Donkey in the Cévennes'/The Heart Of The Country

mar 2007: 1 6 The Three Musketeers , 2 5 Constitution of the United States of America , 3 4 The Elements of Euclid , 4 4 Journey into the Interior of the Earth/Chapter VIII , 5 4 Is There a Santa Claus? (New York Sun) , 6 3 Elfenlied , 7 3 Library of Congress Classification/Class H, subclass HV -- Social Pathology, Social and Public Welfare, and Criminology , 8 3 Library of Congress Classification/Class H, subclass HT -- Communities, Classes, and Races , 9 3 Library of Congress Classification/Class H, subclass HS -- Societies , 10 3 Library of Congress Classification/Class H, subclass HQ -- Family, Marriage, Woman, and Sexuality , 11 3 Library of Congress Classification/Class H, subclass HM -- Sociology (General) , 12 3 Library of Congress Classification/Class H, subclass HJ -- Public Finance , 13 3 Library of Congress Classification/Class H, subclass HG -- Finance , 14 3 The New Student's Reference Work , 15 3 Isaac Todhunter , 16 3 Sweatt v. Painter , 17 3 The Importance of Being Dada , 18 3 Journey into the Interior of the Earth/Chapter III , 19 3 Charles E. Lauriat, Jr , 20 3 Ulysses (11th edition) , 21 3 Journey to the Center of the Earth , 22 3 Additional amendments to the United States Constitution , 23 3 Zodiac Killer letters , 24 3 John Greenleaf Whittier , 25 3 William Wordsworth

abr 2007: 1 4 Theobald Wolfe Tone , 2 4 Anna Komnene , 3 4 The North American Review , 4 4 Additional amendments to the United States Constitution , 5 4 Lev Nikolayevich Tolstoy , 6 3 Jules Vallès , 7 3 Fortney Hillman Stark , 8 3 Poems of Gerard Manley Hopkins/The child is father to the man , 9 3 Srinivasa Ramanujan , 10 3 Catholic Encyclopedia (1913) , 11 3 Wang Xizhi , 12 3 Friedrich Nietzsche , 13 3 The Road Not Taken , 14 3 Robert Louis Stevenson , 15 3 Mohandas Karamchand Gandhi , 16 3 Gilbert Keith Chesterton , 17 3 Iron Curtain Speech , 18 3 Alfred Tennyson , 19 3 Constitution of the United States of America , 20 2 Treaty of Concordia , 21 2 The Open Source Definition , 22 2 The Tales of Mother Goose/Blue Beard , 23 2 To a Wreath of Snow , 24 2 1911 Encyclopædia Britannica/Amsterdam (Holland) , 25 2 Library of Congress Classification/Class D, subclass DR -- History of the Balkan Peninsula

mai 2007: 1 6 Additional amendments to the United States Constitution , 2 5 Constance Garnett , 3 5 O Canada , 4 4 Sidney Lanier , 5 4 The Three Musketeers , 6 4 Uncle Tom's Cabin , 7 4 Edmund Spenser , 8 4 John Keats , 9 4 Howard Phillips Lovecraft , 10 3 Treaty of Concordia , 11 3 To Charlotte Cushman , 12 3 The Mathematical Principles of Natural Philosophy (1729)/Axioms, or Laws of Motion , 13 3 The Mathematical Principles of Natural Philosophy (1729)/Definitions , 14 3 The Mathematical Principles of Natural Philosophy (1729)/Author's Preface , 15 3 Leo Tolstoy: His Life and Work/Chapter 4 , 16 3 Leo Tolstoy: His Life and Work , 17 3 Histories (Godley translation)/Book 8 , 18 3 Veto statement , 19 3 William Halse Rivers Rivers , 20 3 The Raven (Poe) , 21 3 The History of the Ten \"Lost\" Tribes , 22 3 Edna St. Vincent Millay , 23 3 Siegfried Sassoon , 24 3 The Brothers Karamazov , 25 3 Donald Robert Perry Marquis

jun 2007: 1 5 Yā Banīy As-Saharā , 2 4 United States v. Donner, 528 F.2d 276 , 3 4 Additional amendments to the United States Constitution , 4 3 Reconstruction Acts , 5 3 Singer v. American Psychological Association No. 92 CIV. 6082 (1993) , 6 3 To the Small Farmers of Ireland/Letter II , 7 3 To the Small Farmers of Ireland/Letter I , 8 3 Ibn Kathir , 9 3 Edward Woodley Bowling , 10 3 For Land and Life! , 11 3 Dotter v. Maine Employment Sec. Commission 435 A.2d 1368 , 12 3 Divine Light Mission v. Katz , Katz , Katz , Buck 691 F.2d 512 , 13 3 Divine Light Mission v. Katz 688 F.2d 851 , 14 3 The Jewish Problem - Its Solution or, Israel's Present and Future , 15 3 William Hope Hodgson , 16 3 William O. Douglas , 17 3 Alphonse Daudet , 18 3 The Man Who Planted Trees , 19 3 Hilaire Belloc , 20 3 Henry Rider Haggard , 21 3 Stephen Gerald Breyer , 22 3 Brigham Young , 23 3 Robert Joseph Dole , 24 3 Isabella Augusta Persse Gregory , 25 3 Edmund Strother Dargan

jul 2007: 1 4 Edgar Allan Poe , 2 3 A Letter From The Rocky Mountains, 1836 (Spalding) , 3 3 John Arbuthnot , 4 3 The Mystery of the Yellow Room , 5 3 Poems of Cheer , 6 3 The Goddess in the Wood , 7 3 The Voice (Brooke) , 8 3 The Charm (Brooke) , 9 3 The Life Beyond , 10 3 The Jolly Company , 11 3 The One before the Last , 12 3 The Hill , 13 3 The Fish , 14 3 Orson Pratt , 15 3 Finished with the War: A Soldier’s Declaration , 16 3 Richard Francis Burton , 17 3 Zodiac Killer letters , 18 3 The Stolen Child , 19 3 James Matthew Barrie , 20 3 Henry Wadsworth Longfellow , 21 2 Bryan Waller Procter , 22 2 The Book of the Thousand Nights and a Night , 23 2 Treaty of Miramar , 24 2 The Octopus Cycle , 25 2 Wilhelm's telegraph to the Crown Prince

ago 2007: 1 5 William Butler Yeats , 2 4 Henry Ford , 3 4 The poetical works of Matthew Arnold/Dover Beach , 4 4 Herbert George Wells , 5 3 The Open Source Definition , 6 3 Parliamentary Assembly of the Council of Europe - Resolution 1549 (2007) Functioning of democratic institutions in Ukraine , 7 3 William Le Queux , 8 3 Re Kingston Cotton Mill Company (No.2) (1896) , 9 3 Riaz Ahmed Gohar Shahi , 10 3 Dedication. To my mother , 11 3 Anne Lynch Botta , 12 3 Toleration of the corset1023.png , 13 3 Valuyev Circular , 14 3 My Life and Work/10 , 15 3 Poems , 16 3 Finished with the War: A Soldier’s Declaration , 17 3 South Africa Act 1909 (Brand) , 18 3 James Cook , 19 3 Clarence Thomas , 20 3 John Paul Stevens , 21 3 Antonin Scalia , 22 3 United States Code/Title 10/Subtitle A/Part I/Chapter 15/2006-10-16 , 23 3 Napoleon Bonaparte , 24 3 Laozi (E.T. Tan translation) , 25 3 Gertrude Stein

set 2007: 1 4 Yā Banīy As-Saharā , 2 4 Letter to the editor of the Literary Review , 3 4 Success (Brooke) , 4 4 Richard Francis Burton , 5 4 Nikolai Vasilievich Gogol , 6 4 Constitution of the United States of America , 7 3 A Contemplation upon Flowers , 8 3 Balade to Rosemounde , 9 3 The Secret Sharer , 10 3 Curtis's Botanical Magazine , 11 3 Curtis's Botanical Magazine/Volume 19/715 Bauera rubioides , 12 3 Alfred Nobel , 13 3 Curtis's Botanical Magazine/Volume 19/697 , 14 3 Curtis's Botanical Magazine/Volume 19/738 Banksia Ericaefolia , 15 3 Curtis's Botanical Magazine/Volume 19 , 16 3 The Botanical Magazine/Volume 1/2 , 17 3 The Botanical Magazine , 18 3 Finished with the War: A Soldier’s Declaration , 19 3 South Africa Act 1909 (Brand) , 20 3 The Protocols of the Learned Elders of Zion , 21 3 How To Take Measurements , 22 3 Voltaire , 23 3 The Corset , 24 3 Sonnet 38 (Shakespeare) , 25 3 Hans Christian Andersen

out 2007: 1 6 Reconstruction Acts , 2 4 Virginia Statute for Religious Freedom , 3 4 Mary Howitt , 4 4 The Protocols of the Learned Elders of Zion , 5 4 Additional amendments to the United States Constitution , 6 4 United States Bill of Rights , 7 4 Thomas Wyatt , 8 4 Constitution of the United States of America , 9 3 Osama bin Laden , 10 3 Ludwig Uhland , 11 3 Boxer Protocol , 12 3 Keith Edward Abbott , 13 3 Heber C. Kimball , 14 3 La Fayette , 15 3 Ivan Turgenev , 16 3 Kerry Wendell Thornley , 17 3 Rafael Sabatini , 18 3 Romance of the Three Kingdoms/Chapter 1 , 19 3 Rudyard Kipling/Poetry , 20 3 Henry Brooks Adams , 21 3 Bridge of Arta , 22 3 Algernon Charles Swinburne , 23 3 The Awakening (Chopin) , 24 3 Robinson Crusoe , 25 3 Christopher Marlowe

nov 2007: 1 5 The Jumblies , 2 4 History of Washington: The Rise and Progress of an American State/Chapter LVII , 3 4 The Mirror of the Sea , 4 4 Metamorphoses/Pygmalion and Galatea , 5 3 The Morning Hymn , 6 3 Le Directeur , 7 3 Stories from the Arabian nights , 8 3 The Chinese Language Spoken at Fuh Chau , 9 3 Jennie Elizabeth Tupper Dowe , 10 3 Ethan Smith , 11 3 Scientific American , 12 3 Flen flyys , 13 3 Arthur Burks , 14 3 Order of relief, Mrs M. B., Mr P. T., Mr F. D. vs. Wikimedia Foundation Inc. , 15 3 Hawaii approved for national crop insurance program , 16 3 Castro Hlongwane, Caravans, Cats, Geese, Foot & Mouth and Statistics: HIV/Aids and the Struggle for the Humanisation of the African , 17 3 Adventure (London)/Chapter VIII , 18 3 Max Beerbohm , 19 3 Clinton A. Snowden , 20 3 The Secret Agent , 21 3 Notes on My Books , 22 3 Ruth (Bunyan) , 23 3 Almayer's Folly , 24 3 Max Havelaar , 25 3 Ivan Turgenev

dez 2007: 1 5 Executive Order 13198 , 2 4 New Palestine Party; Visit of Menachen Begin and Aims of Political Movement Discussed , 3 4 Executive Order 13199 , 4 4 3 John , 5 3 Virginia Statute for Religious Freedom , 6 3 Yā Banīy As-Saharā , 7 3 Aditya Hridayam , 8 3 Letter announcing Selassie's Ascension , 9 3 Mark , 10 3 International Regulations for Preventing Collisions at Sea , 11 3 Palin Report , 12 3 Select British Eloquence , 13 3 Journal of the Royal Geographical Society of London , 14 3 The congregation for the propagation of the Faith to Augusto Bonetti - Second letter , 15 3 Augusto Bonetti to the Congregation for the Propagation of the Faith , 16 3 The congregation for the propagation of the faith to Augusto Bonetti , 17 3 Theodosius, the metropolitan of Skopje, to Pope Leo XIII , 18 3 Rusk note of 1951 , 19 3 1932 Royal Christmas Message , 20 3 Exodus , 21 3 Charles H. Morrison , 22 3 Possible Methods of Resolving Liancourt Rocks Dispute between Japan and ROK2 , 23 3 Possible Methods of Resolving Liancourt Rocks Dispute between Japan and ROK , 24 3 Appleton's Cyclopedia of American Biography , 25 3 John

jan 2008: 1 6 Ovid , 2 5 Virginia Statute for Religious Freedom , 3 5 Lydia Emilie Florentine Jannsen , 4 4 Catullus 34 , 5 4 The Emancipation Proclamation , 6 4 Samuel Langhorne Clemens , 7 4 Main Page , 8 3 Alice's Adventures in Wonderland (1866)/Chapter 1 , 9 3 Alice's Adventures in Wonderland (1866)/Chapter 10 , 10 3 Alice's Adventures in Wonderland (1866)/Chapter 11 , 11 3 Alice's Adventures in Wonderland (1866)/Chapter 12 , 12 3 Alice's Adventures in Wonderland (1866)/Chapter 2 , 13 3 Alice's Adventures in Wonderland (1866)/Chapter 3 , 14 3 Alice's Adventures in Wonderland (1866)/Chapter 4 , 15 3 Alice's Adventures in Wonderland (1866)/Chapter 5 , 16 3 Alice's Adventures in Wonderland (1866)/Chapter 6 , 17 3 Alice's Adventures in Wonderland (1866)/Chapter 7 , 18 3 Alice's Adventures in Wonderland (1866)/Chapter 8 , 19 3 Alice's Adventures in Wonderland (1866)/Chapter 9 , 20 3 George W. Bush's Eighth State of the Union Address , 21 3 Ida Minerva Tarbell , 22 3 James Lane Allen , 23 3 Joan of Arc , 24 3 A Shropshire Lad/I , 25 3 Charles Coulson Rich

fev 2008: 1 6 Augustus John Cuthbert Hare , 2 6 Barack Hussein Obama , 3 5 Sabine Baring-Gould , 4 4 Edward Young , 5 4 The Western Mail - Christmas 1897 - Page 3.jpg , 6 4 The Bell Buoy (comparison) , 7 4 George Bernard Shaw , 8 4 George Gordon Byron , 9 4 Rudyard Kipling , 10 3 Yā Banīy As-Saharā , 11 3 The Religion of God , 12 3 Ferdinand Brunetière , 13 3 The Complaint: or Night-Thoughts on Life, Death, & Immortality , 14 3 Albert Abraham Michelson , 15 3 Ramon Llull , 16 3 Giacomo Leopardi , 17 3 Hours of Idleness , 18 3 Sex , 19 3 Against the Grain , 20 3 O Hymen! O Hymenee! , 21 3 The Mystic Trumpeter , 22 3 In Cabin’d Ships at Sea , 23 3 Earth! my Likeness! , 24 3 Margaret Mitchell , 25 3 Frances Sargent Osgood

mar 2008: 1 6 George Walker Bush , 2 5 A More Perfect Union , 3 4 Code of Indian Offenses , 4 4 A Concise History of the U.S. Air Force.djvu/5 , 5 4 Steven Weinberg , 6 4 Bush 1974 Tender of Resignation.png , 7 4 Presidential Radio Address - 1 March 2008 , 8 4 Genesis , 9 3 Poems That Every Child Should Know/Part I , 10 3 John Dyer , 11 3 Ode to Adversity , 12 3 Pindar , 13 3 Edmund Doidge Anderson Morshead , 14 3 George Edward Moore , 15 3 A Concise History of the U.S. Air Force.djvu/8 , 16 3 A Concise History of the U.S. Air Force.djvu/7 , 17 3 A Concise History of the U.S. Air Force.djvu/6 , 18 3 A Concise History of the U.S. Air Force.djvu/4 , 19 3 A Concise History of the U.S. Air Force.djvu/2 , 20 3 A Concise History of the U.S. Air Force.djvu/1 , 21 3 Should Students Study? , 22 3 Presidential Radio Address - 19 October 2007 , 23 3 Romain Rolland , 24 3 Colossians , 25 3 The Bosnia Tragedy

abr 2008: 1 5 William Lyon Mackenzie King , 2 4 Reconstruction Acts , 3 4 General Principles of the Civil Law of the People's Republic of China , 4 4 The Aran Islands , 5 4 John Gould , 6 3 Theognostus of Alexandria , 7 3 Fred Weatherley , 8 3 Dow Jones & Company Inc. v Gutnick , 9 3 William Ellis , 10 3 Gulistan , 11 3 Mehmed Talat , 12 3 Getting Married/What Does the Word Marriage Mean , 13 3 Letter from John Gould to R. Denny , 14 3 Charles Harington Harington , 15 3 Bulgarian Policies on the Republic of Macedonia , 16 3 Philip Thomas Godsal , 17 3 Vitruvius , 18 3 Michael Douglas Griffin , 19 3 Ten Books on Architecture , 20 3 The Lord's My Shepherd (unsourced) , 21 3 Charles Joseph Kickham , 22 3 A Drama in Mexico , 23 3 The Moslem World/Volume 11/Number 1/Is Allah Angry with Islam , 24 3 Peter Jones , 25 3 Do Not Have Vile Actions in Your Religion

mai 2008: 1 5 Percival Lowell , 2 4 Edward Everett Wilson , 3 4 Jean Webster , 4 4 Henri-Alban Fournier , 5 4 ACLU v. NSA/438 F. Supp. 2d 754 , 6 3 Ce fut en mai , 7 3 A Description of a City Shower , 8 3 Frederic Harrison , 9 3 Edward Coote Pinkney , 10 3 Notebook , 11 3 Thus Spake Zarathustra - Thomas Common - 1917.djvu/32 , 12 3 The Joys of Being a Negro , 13 3 Samuel Logan Brengle , 14 3 Daddy-Long-Legs , 15 3 Münsterberg , 16 3 Anne Kingsmill Finch , 17 3 Best Russian Short Stories/Vanka , 18 3 Vsevolod Mikhailovich Garshin , 19 3 Ellen Wood , 20 3 Mary Gaunt , 21 3 Will Carleton , 22 3 Allometric Scaling of the Active Hematopoietic Stem Cell Pool across Mammals , 23 3 Ode to Joy , 24 3 Frederic Edward Weatherly , 25 3 The Travels of Marco Polo

jun 2008: 1 5 Dictionary of National Biography, 1885-1900 , 2 5 John , 3 5 Isaac Asimov , 4 4 Administrative Order 9 , 5 4 Stéphane Mallarmé , 6 4 Søren Aabye Kierkegaard , 7 4 Poems (Wordsworth, 1815)/Volume 1/To the Cuckoo , 8 4 Childhood (Tolstoy) , 9 4 John Masefield , 10 4 John McCain , 11 4 Lev Nikolayevich Tolstoy , 12 3 Reconstruction Acts , 13 3 Catullus 102 , 14 3 Catullus 60 , 15 3 Hebrews , 16 3 Henry Head , 17 3 Joseph Warton , 18 3 Devil Worship (Joseph) , 19 3 A human experiment in nerve division/Chapter 1 , 20 3 Equitation.djvu/17 , 21 3 Equitation.djvu/16 , 22 3 Dictionary of National Biography, 1885-1900/Vol 39 Morehead - Myles , 23 3 Southern Life in Southern Literature.djvu/35 , 24 3 Southern Life in Southern Literature.djvu/34 , 25 3 History of Iowa From the Earliest Times to the Beginning of the Twentieth Century Volume 1.djvu

jul 2008: 1 5 Scottish Gaelic Dialects , 2 5 Irving Berlin , 3 4 Personal Recollections of Joan of Arc.djvu/67 , 4 4 Wind in the Willows (1913).djvu/215 , 5 4 Wind in the Willows (1913).djvu/160 , 6 4 Wind in the Willows (1913).djvu , 7 4 Charles Haddon Spurgeon , 8 4 Order of relief, Mrs M. B., Mr P. T., Mr F. D. vs. Wikimedia Foundation Inc. , 9 4 ACLU v. NSA/438 F. Supp. 2d 754 , 10 4 Barack Hussein Obama , 11 4 Mohandas Karamchand Gandhi , 12 4 Edgar Allan Poe , 13 3 To one who has been long in city pent , 14 3 Why did I laugh tonight? , 15 3 GeorgeTCoker.djvu/23 , 16 3 Isaac Rosenberg , 17 3 GeorgeTCoker.djvu/22 , 18 3 GeorgeTCoker.djvu/21 , 19 3 Charles Moncrieff Robertson , 20 3 Goody Two-Shoes (1888).djvu/13 , 21 3 Goody Two-Shoes (1888).djvu/12 , 22 3 Goody Two-Shoes (1888).djvu/4 , 23 3 Goody Two-Shoes (1888).djvu/11 , 24 3 Goody Two-Shoes (1888).djvu/10 , 25 3 Goody Two-Shoes (1888).djvu/1

ago 2008: 1 7 Constitution of Ecuador 2008 , 2 5 A Summary View of the Rights of British America , 3 5 German Instrument of Surrender (May 7, 1945) - page 2.jpg , 4 5 German Instrument of Surrender (May 7, 1945) - page 1.jpg , 5 4 Albert Schweitzer , 6 4 The Hollow Needle , 7 4 CACCF FAQ revised.djvu , 8 4 Joseph Estrada , 9 4 GeorgeTCoker.djvu/8 , 10 4 Paul Laurence Dunbar , 11 3 A Nightmare (Marquis) , 12 3 Sanskrit Grammar by Whitney p1.djvu/33 , 13 3 Sanskrit Grammar by Whitney p1.djvu/8 , 14 3 The Question of Zion and Territory , 15 3 The Socialism of Poale Zionism in the U.S. , 16 3 Two Currents in Poale Zionism , 17 3 At the Cradle of Zionist Socialism , 18 3 The Jubilee of the Jewish Labor Movement , 19 3 Reminiscences (Borochov) , 20 3 Eretz Yisrael in our Program and Tactics , 21 3 The Economic Development of the Jewish People , 22 3 Albert Jay Nock , 23 3 The Quest of the Historical Jesus , 24 3 Federal Reporter/Third series , 25 3 Federal Reporter/Second series

set 2008: 1 6 K-K-K-Katy , 2 5 Virginia Statute for Religious Freedom , 3 5 The Pilgrim Cookbook.djvu/68 , 4 5 The Pilgrim Cookbook.djvu/26 , 5 4 James Tait Black , 6 4 John Sutherland Black , 7 4 Henry Beveridge (1837-1929) , 8 4 Montagu Burrows , 9 4 Thomas Wilson Bayne , 10 4 Robert Adamson , 11 4 Benedict XIV , 12 4 Benedict XIII , 13 4 Pius XII , 14 4 The Pilgrim Cookbook.djvu/163 , 15 4 The Pilgrim Cookbook.djvu/33 , 16 4 The Pilgrim Cookbook.djvu/32 , 17 4 The Pilgrim Cookbook.djvu/25 , 18 4 The Pilgrim Cookbook.djvu/21 , 19 4 The Pilgrim Cookbook.djvu/20 , 20 4 The Pilgrim Cookbook.djvu/17 , 21 4 The Pilgrim Cookbook.djvu/12 , 22 4 The Pilgrim Cookbook.djvu/6 , 23 4 The Pilgrim Cookbook.djvu/5 , 24 4 The Pilgrim Cookbook.djvu , 25 4 Isaac Brock

out 2008: 1 5 Maximilien Robespierre , 2 4 Cold Nuclear Fusion: A Hypothesis , 3 4 Diary of ten years.djvu/8 , 4 4 George Clement Boase , 5 4 John Alexander McCrae (1872-1918) , 6 4 Sun Yat-sen , 7 3 Virginia Statute for Religious Freedom , 8 3 Song of the Free , 9 3 The music of Bohemia.djvu/25 , 10 3 Regulations Concerning Foreign Journalists and Permanent Offices of Foreign News Agencies , 11 3 John Philip Sousa , 12 3 The Mound , 13 3 Ein Yaakov/Volume I , 14 3 Ein Yaakov , 15 3 Letter of William J. Haynes, II opposing SCOTUS access for troops , 16 3 The Book of Abraham, Its Authenticity Established... , 17 3 Antonín Dvořák , 18 3 Oom Paul's People , 19 3 The Day of Atonement , 20 3 Por una Cabeza , 21 3 I Want To Go Back To Michigan , 22 3 Sidney Oldall Addy , 23 3 JamesERay.djvu/22 , 24 3 Dictionary of National Biography, 1885-1900/List of Contributors , 25 3 Aristotelous peri psuxes.djvu/300

nov 2008: 1 11 Virginia Statute for Religious Freedom , 2 8 Barack Hussein Obama , 3 6 Barack Obama's election victory speech in Chicago , 4 6 John McCain , 5 5 Dictionary of National Biography, 1885-1900 , 6 5 Remarks of Senator Barack Obama on New Hampshire Primary Night , 7 4 Edward Estlin Cummings , 8 4 Gerald Butler , 9 4 Armistice Day.djvu/15 , 10 4 Aristotelous peri psuxes.djvu/38 , 11 4 Emily Dickinson Poems (1890).djvu/62 , 12 4 Emily Dickinson Poems (1890).djvu/28 , 13 4 Emily Dickinson Poems (1890).djvu/25 , 14 4 Emily Dickinson Poems (1890).djvu/27 , 15 4 Emily Dickinson Poems (1890).djvu/26 , 16 4 Emily Dickinson Poems (1890).djvu/24 , 17 4 Emily Dickinson Poems (1890).djvu/35 , 18 4 Emily Dickinson Poems (1890).djvu/34 , 19 4 Emily Dickinson Poems (1890).djvu/32 , 20 4 Emily Dickinson Poems (1890).djvu/31 , 21 4 Emily Dickinson Poems (1890).djvu/30 , 22 4 Emily Dickinson Poems (1890).djvu/22 , 23 4 Emily Dickinson Poems (1890).djvu/33 , 24 4 John Alexander McCrae (1872-1918) , 25 3 Edict on the Transfer of the Capital

dez 2008: 1 8 Virginia Statute for Religious Freedom , 2 4 Our American Holidays - Christmas.djvu/122 , 3 4 Our American Holidays - Christmas.djvu/121 , 4 4 Our American Holidays - Christmas.djvu/120 , 5 4 Our American Holidays - Christmas.djvu/104 , 6 4 Our American Holidays - Christmas.djvu/102 , 7 4 Our American Holidays - Christmas.djvu/94 , 8 4 Our American Holidays - Christmas.djvu/33 , 9 4 Oregon Constitution/Article I , 10 4 Our American Holidays - Christmas.djvu/14 , 11 4 Our American Holidays - Christmas.djvu , 12 4 John Greenleaf Whittier , 13 3 Allen B. Tranquen , 14 3 Alfred Louis Kroeber , 15 3 Gesenius' Hebrew Grammar , 16 3 Our American Holidays - Christmas.djvu/11 , 17 3 Our American Holidays - Christmas.djvu/356 , 18 3 Our American Holidays - Christmas.djvu/355 , 19 3 Our American Holidays - Christmas.djvu/354 , 20 3 Our American Holidays - Christmas.djvu/353 , 21 3 Our American Holidays - Christmas.djvu/352 , 22 3 Our American Holidays - Christmas.djvu/351 , 23 3 Our American Holidays - Christmas.djvu/133 , 24 3 Our American Holidays - Christmas.djvu/132 , 25 3 Our American Holidays - Christmas.djvu/125

jan 2009: 1 19 Barack Obama's First Inaugural Address , 2 13 Barack Hussein Obama , 3 5 Barack Hussein Obama/Executive orders , 4 4 Modern Money Mechanics/Bank Reserves—How They Change , 5 3 Barack Obama's interview on Al Arabiya , 6 3 Speech on African American Suffrage , 7 3 Bonie Jean-a Ballad , 8 3 Highland Mary , 9 3 Executive Order 13486 , 10 3 Executive Order 13490 , 11 3 Carducci - Poems of Italy.djvu/13 , 12 3 Notes by the Way.djvu/22 , 13 3 Gesenius' Hebrew Grammar (1910 Kautzsch-Cowley edition).djvu/88 , 14 3 Barack Hussein Obama/Weekly addresses , 15 3 The Times , 16 3 Space Shuttle Columbia Disaster Transcript , 17 3 Eben Moglen , 18 3 Henry James , 19 3 Michel de Nostredame , 20 3 Virgil , 21 3 Lev Nikolayevich Tolstoy , 22 3 The Tragedy of Macbeth (unsourced) , 23 2 Virginia Statute for Religious Freedom , 24 2 Bollettino della Vittoria , 25 2 Middle Class Working Families Task Force

fev 2009: 1 5 Virginia Statute for Religious Freedom , 2 5 Barack Obama's First Inaugural Address , 3 4 Laws (Plato)/Book VII , 4 4 Feminism for Men , 5 4 Marie de France Lays Mason.djvu/99 , 6 4 Marie de France Lays Mason.djvu/91 , 7 4 Marie de France Lays Mason.djvu/48 , 8 4 Barack Hussein Obama , 9 4 Main Page , 10 3 Constitution of Ghana , 11 3 The Jumblies , 12 3 The Iliad , 13 3 Speech on the Labourers Acts , 14 3 The Times/1918/Obituary/Walter Armstrong , 15 3 The Greek Skeptics/Introduction I , 16 3 The Greek Skeptics , 17 3 Barack Obama's First State of the Union Address , 18 3 Floyd Dell , 19 3 Robert Filmer , 20 3 Children's Health Insurance Program Reauthorization Act of 2009 , 21 3 Marie de France Lays Mason.djvu/98 , 22 3 Marie de France Lays Mason.djvu/97 , 23 3 Marie de France Lays Mason.djvu/96 , 24 3 Marie de France Lays Mason.djvu/95 , 25 3 Marie de France Lays Mason.djvu/94

mar 2009: 1 5 PIRA Constitution , 2 5 John , 3 5 United States Declaration of Independence (Dunlap Broadside) , 4 4 Popular Science Monthly Volume 86.djvu , 5 4 Joseph McCabe , 6 4 The Swiss Family Robinson, In Words of One Syllable.djvu , 7 4 Genesis , 8 4 Global Warming: a Time to Act , 9 4 The Emancipation Proclamation , 10 4 Robert Burns (1759-1796) , 11 3 Alice's Adventures in Wonderland (1866)/Chapter 1 , 12 3 Gesenius' Hebrew Grammar (1910 Kautzsch-Cowley edition).djvu/121 , 13 3 Mill , 14 3 Pro Caelio/Section 42 , 15 3 The Lives of the Twelve Caesars/Vespasian , 16 3 What Will He Do with It? , 17 3 H. RES. 224 Supporting the designation of Pi Day, and for other purposes , 18 3 Curtis's Botanical Magazine, Volume 58 (1831).djvu/22 , 19 3 Jean-Christophe , 20 3 Popular Science Monthly Volume 86.djvu/512 , 21 3 Popular Science Monthly Volume 86.djvu/208 , 22 3 Popular Science Monthly Volume 86.djvu/13 , 23 3 Popular Science Monthly Volume 86.djvu/12 , 24 3 Popular Science Monthly Volume 86.djvu/11 , 25 3 Popular Science Monthly Volume 86.djvu/10

abr 2009: 1 10 Shall Liberty or Empire Be Sought? , 2 5 Virginia Statute for Religious Freedom , 3 5 Leyden Papyrus X , 4 4 Collected Papers on Analytical Psychology (1916).djvu/214 , 5 4 Fables of Aesop and other eminent mythologists.djvu/7 , 6 4 Oliver Heaviside , 7 4 Moses , 8 4 Carl Gustav Jung , 9 3 Collected Papers on Analytical Psychology/Chapter 4 , 10 3 The Covent-Garden Journal/Number 5 , 11 3 Journal of Major Andre , 12 3 Fables of Aesop and other eminent mythologists.djvu/59 , 13 3 Fables of Aesop and other eminent mythologists.djvu/56 , 14 3 William Augustus Brevoort Coolidge , 15 3 John Partridge , 16 3 Edward Atkinson , 17 3 Kathleen Schlesinger , 18 3 George William Redway , 19 3 What will he do with it.djvu , 20 3 Dictionary of National Biography, 1885-1900/Vol 8 Burton - Cantwell , 21 3 Thomas Finlayson Henderson , 22 3 United States Statutes at Large Volume 1.djvu/693 , 23 3 Poems , 24 3 The Ancient Scriptures and the Modern Jew , 25 3 The New York Times

mai 2009: 1 7 Anton Chekhov , 2 7 Shall Liberty or Empire Be Sought? , 3 5 Margaritae Sorori , 4 4 Northwest Ordinance of 1784 , 5 4 William Blair Morton , 6 3 Edict on the Transfer of the Capital , 7 3 George Buchanan , 8 3 Francis Charles Montague , 9 3 Mary Frances Sandars , 10 3 Victoria Mary Sackville-West , 11 3 William H. Flower , 12 3 Thomas Sackville , 13 3 Charles Sackville , 14 3 Bouquett, Philip (DNB00) , 15 3 Stanley Lane-Poole , 16 3 Old Age (Chekhov) , 17 3 Arthur Penrhyn Stanley , 18 3 After the Theatre (Chekhov) , 19 3 Ionitch , 20 3 William Bartram , 21 3 Francis Buchanan-Hamilton , 22 3 André Michaux , 23 3 Charles Peter Mason , 24 3 Anne Whitney , 25 3 Edward M. Kennedy Serve America Act

jun 2009: 1 6 Shall Liberty or Empire Be Sought? , 2 5 Chiang Kai-shek , 3 4 John Bunyan's Dream Story , 4 4 John Strutt, 3rd Baron Rayleigh , 5 4 A New Beginning , 6 4 Edward Bernays , 7 4 Soong May-ling , 8 4 Omnibuses and Cabs.djvu/67 , 9 4 Omnibuses and Cabs.djvu/62 , 10 4 Bible (King James) , 11 4 Main Page , 12 3 Constitution of Ghana , 13 3 Marcelo Hilario del Pilar , 14 3 CromwellHugo.djvu , 15 3 Stevenson - Prince Otto. A Romance.djvu , 16 3 Pierre du Calvet , 17 3 Edmonton Bulletin editorial on the results of the 1893 Edmonton municipal election , 18 3 George Thomas Orlando Bridgeman , 19 3 The Critique of Judgement/P1/S1/B1/M2 , 20 3 Dewitt Bristol Brace , 21 3 Zha Haisheng , 22 3 Recollections of a Virginian in the Mexican, Indian, and Civil Wars , 23 3 Henry Peter Brougham , 24 3 Edward Philip Coleridge , 25 3 History of the Rise, Progress, and Termination of the American Revolution

jul 2009: 1 8 Outline of the Post-War New World Map , 2 5 Rubén Darío , 3 4 A Dictionary of Music and Musicians vol 1.djvu , 4 4 Albert Frederick Pollard , 5 4 The Awful German Language , 6 3 Germany Must Perish! , 7 3 \"The Queen of Hearts\", \"The King of Spades\", \"The King of Clubs\", and \"The Diamond King\" , 8 3 Laudabiliter , 9 3 Moral letters to Lucilius/Letter 1 , 10 3 Moral letters to Lucilius , 11 3 Walter Rye , 12 3 John Batchelor , 13 3 Official Languages Act, 1963 , 14 3 Edward Boucher James , 15 3 Gilbert Charles Bourne , 16 3 Ellis Hovell Minns , 17 3 To Roosevelt , 18 3 Geoffrey Haward Martin , 19 3 John Standish , 20 3 George Grove , 21 3 High Barbaree , 22 3 Essays on Political Economy/Government , 23 3 Exploration of the Valley of the Amazon, Vol.I , 24 3 A Dictionary of Music and Musicians vol 1.djvu/14 , 25 3 A Dictionary of Music and Musicians vol 1.djvu/13

ago 2009: 1 9 Moral letters to Lucilius/Letter 1 , 2 5 Outline of the Post-War New World Map , 3 4 Constitution of Ecuador 2008 , 4 4 Virginia Statute for Religious Freedom , 5 4 A Tale of the Huguenots or Memoirs of a French Refugee Family , 6 4 The English Constitution (1894).djvu/114 , 7 4 The English Constitution (1894).djvu/113 , 8 4 William Lewis Herndon , 9 4 The English Constitution (1894).djvu/91 , 10 4 The English Constitution (1894).djvu/19 , 11 4 The English Constitution (1894) , 12 4 The Jewish Manual.djvu/27 , 13 4 The Jewish Manual.djvu/26 , 14 4 Charter of Freedoms and Exemptions , 15 4 The English Constitution (1894).djvu , 16 4 Carl Linnaeus , 17 4 Winston Leonard Spencer Churchill , 18 3 Matthew Fontaine Maury/15 , 19 3 James Justinian Morier , 20 3 Charter of the Dutch West India Company , 21 3 The adventures of Hajji Baba of Ispahan/00 , 22 3 A Tale of the Huguenots or Memoirs of a French Refugee Family/1 , 23 3 The Million Pound Bank Note , 24 3 1911 Encyclopædia Britannica/Haro, Clameur de , 25 3 The English Constitution (1894).djvu/151

set 2009: 1 9 Moral letters to Lucilius/Letter 1 , 2 4 Barack Obama speech to joint session of Congress, September 2009 , 3 4 Constitution of the United States of America , 4 3 Constitution of Ecuador 2008 , 5 3 The History of the Decline and Fall of the Roman Empire (Oxford)/I , 6 3 Dictionary of National Biography volume 28.djvu/115 , 7 3 An introduction to linear drawing.djvu/14 , 8 3 An introduction to linear drawing.djvu/6 , 9 3 An introduction to linear drawing.djvu/4 , 10 3 An introduction to linear drawing.djvu/3 , 11 3 Robert Ervin Howard/Poetry , 12 3 Benjamin Franklin, Catalogue of Books.djvu/2 , 13 3 Maltbie Davenport Babcock , 14 3 Notes on the churches in the counties of Kent, Sussex, and Surrey.djvu/82 , 15 3 Notes on the churches in the counties of Kent, Sussex, and Surrey.djvu/437 , 16 3 Valley Hospital Association, Inc. v. Mat-Su Coalition for Choice , 17 3 Charles Welch , 18 3 Milton (excerpts)/Book the Second , 19 3 Notes on the churches in the counties of Kent, Sussex, and Surrey.djvu/220 , 20 3 Notes on the churches in the counties of Kent, Sussex, and Surrey.djvu/33 , 21 3 Notes on the churches in the counties of Kent, Sussex, and Surrey.djvu/11 , 22 3 Notes on the churches in the counties of Kent, Sussex, and Surrey.djvu/9 , 23 3 1911 Encyclopædia Britannica/Jā'alin , 24 3 A General History for Colleges and High Schools (Myers)/Chapter 1 , 25 3 Remarks Prepared for Delivery at the Trade Mart in Dallas

out 2009: 1 8 Moral letters to Lucilius/Letter 1 , 2 5 Treaty with Algeria (1795) , 3 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/148 , 4 4 History of West Australia.djvu/30 , 5 4 Abd-ar-Rahman V , 6 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/110 , 7 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/72 , 8 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/68 , 9 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/38 , 10 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/59 , 11 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/58 , 12 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/51 , 13 4 Old-Time Recipes for Home Made Wines Cordials and Liqueurs.djvu/9 , 14 4 War Damage in the Nanking area Dec. 1937 to Mar. 1938 , 15 4 Popular Science Monthly Volume 1.djvu/790 , 16 4 Popular Science Monthly Volume 1.djvu/789 , 17 4 Gordon Goodwin , 18 4 Thompson Cooper , 19 4 James McMullen Rigg , 20 4 A treasury of war poetry, British and American poems of the world war, 1914-1919/Serbia, Greece, and Roumania , 21 4 John Joseph Knight , 22 4 John Knox Laughton , 23 4 Treaty of Lisbon , 24 4 Death of Edgar Allan Poe , 25 4 Barack Hussein Obama

nov 2009: 1 5 Plato or Protagoras.djvu/19 , 2 5 Michael Faraday , 3 4 The War and the Churches.djvu/17 , 4 4 The War and the Churches.djvu/6 , 5 4 Death (Mackintosh) , 6 4 War, The Liberator, and Other Pieces , 7 4 The Martyrdom of Ferrer.djvu/9 , 8 4 The Myth of Occams Razor.djvu/8 , 9 4 Plato or Protagoras.djvu/21 , 10 4 The Martyrdom of Ferrer.djvu/16 , 11 4 The Martyrdom of Ferrer.djvu/15 , 12 4 The Martyrdom of Ferrer.djvu/14 , 13 4 The Martyrdom of Ferrer.djvu/13 , 14 4 The Martyrdom of Ferrer.djvu/12 , 15 4 The Martyrdom of Ferrer.djvu/11 , 16 4 The Fight at Dame Europa's School , 17 4 On the Relative Motion of the Earth and the Luminiferous Ether.djvu/8 , 18 4 Samuel Taylor Coleridge , 19 3 Outline of the Post-War New World Map , 20 3 Articles by Malcolm X from LA Herald-Dispatch/July 18, 1957 , 21 3 Lundy's Lane Battle.djvu , 22 3 More Tales from Tolstoi/The Two Brothers and the Gold , 23 3 Τέτλαθι δὴ κραδίη , 24 3 A Highland Regiment and Other Poems , 25 3 Dora 1887.djvu/11

dez 2009: 1 6 Thomas Carlyle , 2 5 Barack Obama's Nobel Peace Prize acceptance speech , 3 5 Romain Rolland Handel.djvu/3 , 4 4 Treaty with Algeria (1795) , 5 4 Popular Science Monthly/Volume 1/May 1872/The Study of Sociology I , 6 4 Handel (Rolland)/His Life , 7 4 Satires and Profanities/Jesus: as God; as a Man , 8 4 Queen Lucia.djvu , 9 4 When You Go Home Take This Book With You.djvu/3 , 10 4 Romain Rolland Handel.djvu/153 , 11 4 Romain Rolland Handel.djvu/35 , 12 4 Romain Rolland Handel.djvu/31 , 13 4 Romain Rolland Handel.djvu/26 , 14 4 Romain Rolland Handel.djvu/24 , 15 4 Romain Rolland Handel.djvu/23 , 16 4 Romain Rolland Handel.djvu/22 , 17 4 Romain Rolland Handel.djvu/20 , 18 4 Romain Rolland Handel.djvu/15 , 19 4 Romain Rolland Handel.djvu/12 , 20 4 Romain Rolland Handel.djvu/11 , 21 4 Romain Rolland Handel.djvu/9 , 22 4 The Western Mail/24 December 1897/The Abrolhos tragedy , 23 4 Robert Dale , 24 4 Barack Hussein Obama , 25 4 William Butler Yeats

jan 2010: 1 5 Celtic Fairy Tales.djvu/309 , 2 5 The Passenger Pigeon - Mershon.djvu/80 , 3 4 Arukh ha-Shulchan/Choshen Mishpat/1 , 4 4 Warrington Academy , 5 4 The Passenger Pigeon/Chapter VIII , 6 4 The Passenger Pigeon/Introduction , 7 4 The Passenger Pigeon - Mershon.djvu/13 , 8 4 Slavery in Europe.djvu/6 , 9 4 Appearance and Reality , 10 4 Celtic Fairy Tales.djvu/310 , 11 4 Moses , 12 4 Dictionary of National Biography, 1885-1900/Vol 28 Howard - Inglethorpe , 13 4 Dictionary of National Biography, 1885-1900/Vol 19 Finch - Forman , 14 4 The Passenger Pigeon - Mershon.djvu/261 , 15 4 The Passenger Pigeon - Mershon.djvu/129 , 16 4 The Passenger Pigeon - Mershon.djvu/101 , 17 4 The Passenger Pigeon - Mershon.djvu/55 , 18 4 The Passenger Pigeon - Mershon.djvu/47 , 19 4 The Passenger Pigeon - Mershon.djvu/24 , 20 4 Jane Eyre.djvu , 21 4 Edgar Allan Poe , 22 3 Mandragora , 23 3 Tales, Edgar Allan Poe, 1846.djvu , 24 3 Arukh ha-Shulchan/Choshen Mishpat , 25 3 Secretary of State Clinton on Internet Freedom

fev 2010: 1 6 Mars - Lowell.djvu/283 , 2 5 Mars - Lowell.djvu/302 , 3 5 The Craftsmanship of Writing.djvu/288 , 4 5 The Craftsmanship of Writing.djvu/286 , 5 5 The Craftsmanship of Writing.djvu/279 , 6 5 Mars - Lowell.djvu/284 , 7 5 The Craftsmanship of Writing.djvu/289 , 8 5 Mars - Lowell.djvu/32 , 9 4 Mars - Lowell.djvu/301 , 10 4 Mars - Lowell.djvu/299 , 11 4 Mars - Lowell.djvu/298 , 12 4 Mars - Lowell.djvu/203 , 13 4 Mars - Lowell.djvu/287 , 14 4 The Craftsmanship of Writing.djvu/287 , 15 4 The Craftsmanship of Writing.djvu/285 , 16 4 The Craftsmanship of Writing.djvu/284 , 17 4 The Craftsmanship of Writing.djvu/148 , 18 4 The Craftsmanship of Writing.djvu/217 , 19 4 The Craftsmanship of Writing.djvu/216 , 20 4 The Craftsmanship of Writing.djvu/215 , 21 4 The Craftsmanship of Writing.djvu/167 , 22 4 Mars - Lowell.djvu/238 , 23 4 Mars - Lowell.djvu/210 , 24 4 Mars - Lowell.djvu/209 , 25 4 Mars - Lowell.djvu/204

mar 2010: 1 4 The New York Times, 1901-08-01.djvu/1 , 2 4 BulldogDrummondSapper.djvu/79 , 3 4 BulldogDrummondSapper.djvu/77 , 4 4 Thomas Seccombe , 5 3 State of the Nation Address 2010 by President Jacob Zuma , 6 3 A Gent From Bear Creek (Novella)/Chapter III , 7 3 Hiring Incentives to Restore Employment Act , 8 3 Trademark Technical and Conforming Amendment Act of 2010 , 9 3 Shakespeare, William (DNB00) , 10 3 Tamerlane and other poems (1884)/Poe's Tamerlane , 11 3 Stanhope, Charles (1753-1816) (DNB00) , 12 3 The New York Times, 1901-08-01.djvu , 13 3 Tamerlane (1845) , 14 3 BulldogDrummondSapper.djvu/99 , 15 3 BulldogDrummondSapper.djvu/82 , 16 3 Evolution and Ethics (wikisource annotations) , 17 3 BulldogDrummondSapper.djvu/239 , 18 3 BulldogDrummondSapper.djvu/78 , 19 3 BulldogDrummondSapper.djvu/76 , 20 3 BulldogDrummondSapper.djvu/205 , 21 3 BulldogDrummondSapper.djvu/204 , 22 3 Tamerlane and other poems (1884).djvu/23 , 23 3 BulldogDrummondSapper.djvu/187 , 24 3 BulldogDrummondSapper.djvu/186 , 25 3 BulldogDrummondSapper.djvu/184

abr 2010: 1 6 July 12, 2007 Baghdad airstrike transcript , 2 6 The Religion of God , 3 5 Riaz Ahmed Gohar Shahi , 4 4 Flags of Maritime Nations (1899).djvu , 5 4 George Howard Earle (1856-1928) , 6 4 Executive Order 291 , 7 4 Newton's Principia (1846).djvu/96 , 8 4 Personal Recollections of Joan of Arc.djvu/530 , 9 4 Personal Recollections of Joan of Arc.djvu/529 , 10 3 Banking Act of 1933 (Federal Reserve Circular 1248).djvu/3 , 11 3 William Robert Wills Wilde , 12 3 James Leslie Mitchell , 13 3 Likutei Moharan , 14 3 Post Office Reform , 15 3 An account of a voyage to establish a colony at Port Philip in Bass's Strait.djvu/28 , 16 3 An account of a voyage to establish a colony at Port Philip in Bass's Strait.djvu/22 , 17 3 Likutey Halakhot , 18 3 Executive Order 290 , 19 3 Executive Order 288 , 20 3 Wonderful Balloon Ascents, 1870.djvu/20 , 21 3 Flatland , 22 3 The Play-Function of Sex , 23 3 Dictionary of National Biography volume 28.djvu/90 , 24 3 Dictionary of National Biography volume 28.djvu/20 , 25 3 Newton's Principia (1846).djvu/280

mai 2010: 1 6 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/103 , 2 6 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/21 , 3 5 Condor24(6).djvu/8 , 4 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/38 , 5 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/195 , 6 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/145 , 7 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/93 , 8 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/49 , 9 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/46 , 10 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/31 , 11 5 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/254 , 12 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu , 13 4 The Feather of Finist the Falcon , 14 4 Crainquebille, Putois, Riquet and other profitable tales/Crainquebille , 15 4 Dictionary of National Biography, 1885-1900/Vol 30 Johnes - Kenneth , 16 4 Thomas Finlayson Henderson , 17 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/257 , 18 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/258 , 19 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/135 , 20 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/111 , 21 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/83 , 22 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/73 , 23 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/65 , 24 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/62 , 25 4 Crainquebille, Putois, Riquet and other profitable tales, 1915.djvu/61

jun 2010: 1 5 Frederic Shoberl - Persia.djvu/16 , 2 4 Outline of the Post-War New World Map , 3 4 The thirty-six dramatic situations (1921).djvu , 4 4 Sweet, sweet is the greeting of eyes , 5 4 Frederic Shoberl - Persia.djvu/68 , 6 4 Losing Our Memory/The lessons for the digital age , 7 4 Losing Our Memory/Introduction , 8 4 Losing Our Memory , 9 4 Frederic Shoberl - Persia.djvu/42 , 10 4 Frederic Shoberl - Persia.djvu/19 , 11 4 Frederic Shoberl - Persia.djvu/20 , 12 4 Frederic Shoberl - Persia.djvu/12 , 13 4 Popular Science Monthly Volume 3.djvu/271 , 14 4 Dictionary of National Biography, 1885-1900/Vol 34 Llywd - MacCartney , 15 4 Richard Garnett , 16 3 Marlow, William (DNB00) , 17 3 The thirty-six dramatic situations (1921).djvu/13 , 18 3 Frederic Shoberl - Persia.djvu/100 , 19 3 Frederic Shoberl - Persia.djvu/97 , 20 3 Imperial Household Law (1889) , 21 3 Frederic Shoberl - Persia.djvu/87 , 22 3 Frederic Shoberl - Persia.djvu/86 , 23 3 Frederic Shoberl - Persia.djvu/84 , 24 3 The thirty-six dramatic situations (1921).djvu/11 , 25 3 Will of Chiang Kai-shek

jul 2010: 1 5 Benigno Aquino III's Inaugural Address , 2 4 Full Disclosure Appendix, Eighteen Major Cases.djvu , 3 4 Agreement relating to Malaysia between United Kingdom of Great Britain and Northern Ireland, Federation of Malaya, North Borneo, Sarawak and Singapore , 4 4 Federalist, Dawson edition, 1863.djvu/18 , 5 4 Sidney Lee , 6 4 Dictionary of National Biography, 1885-1900/Vol 21 Garnett - Gloucester , 7 4 Dictionary of National Biography, 1885-1900/Vol 19 Finch - Forman , 8 4 Dictionary of National Biography, 1885-1900/Vol 10 Chamber - Clarkson , 9 4 Dictionary of National Biography, 1885-1900/Vol 9 Canute - Chaloner , 10 4 Dictionary of National Biography, 1885-1900/Vol 23 Gray - Haighton , 11 4 Dictionary of National Biography, 1885-1900/Vol 2 Annesley - Baird , 12 3 Letter recommending removal of the Navajo to Bosque Redondo , 13 3 Dictionary of National Biography volume 48.djvu/291 , 14 3 Full Disclosure Appendix, Eighteen Major Cases.djvu/2 , 15 3 Full Disclosure Appendix, Eighteen Major Cases.djvu/13 , 16 3 Full Disclosure Appendix, Eighteen Major Cases.djvu/1 , 17 3 The passing of Korea.djvu/417 , 18 3 On the Sublime 1890.djvu/14 , 19 3 Manual of English Grammar and Composition , 20 3 Agreement relating to Malaysia between United Kingdom of Great Britain and Northern Ireland, Federation of Malaya, North Borneo, Sarawak and Singapore/Annex A , 21 3 The Stolen Bacillus.djvu , 22 3 Captain of the Polestar.djvu/5 , 23 3 Federalist, Dawson edition, 1863.djvu/20 , 24 3 Federalist, Dawson edition, 1863.djvu/19 , 25 3 Federalist, Dawson edition, 1863.djvu/15

ago 2010: 1 5 Elizabethan People.djvu/81 , 2 5 Elizabethan People.djvu/97 , 3 5 Elizabethan People.djvu/91 , 4 5 Elizabethan People.djvu/103 , 5 5 Elizabethan People.djvu/22 , 6 5 Elizabethan People.djvu/11 , 7 4 In the Roar of the Sea.djvu , 8 4 Elizabethan People.djvu/261 , 9 4 Elizabethan People.djvu/264 , 10 4 Elizabethan People.djvu/59 , 11 4 Elizabethan People.djvu/72 , 12 4 Elizabethan People.djvu/15 , 13 4 Elizabethan People.djvu/346 , 14 4 Old Deccan Days.djvu/67 , 15 4 Elizabethan People.djvu/21 , 16 4 Elizabethan People.djvu , 17 4 Thomas Finlayson Henderson , 18 4 Gordon Goodwin , 19 4 William Prideaux Courtney , 20 3 Devonshire Characters and Strange Events.djvu , 21 3 Conrad Gesner , 22 3 In the Roar of the Sea.djvu/415 , 23 3 In the Roar of the Sea , 24 3 In the Roar of the Sea.djvu/13 , 25 3 In the Roar of the Sea.djvu/16

set 2010: 1 7 Picturesque New Zealand, 1913.djvu , 2 7 Picturesque New Zealand , 3 7 Picturesque New Zealand, 1913.djvu/17 , 4 6 Picturesque New Zealand, 1913.djvu/93 , 5 6 Dictionary of National Biography, 1885-1900/Vol 2 Annesley - Baird , 6 5 Picturesque New Zealand, 1913.djvu/21 , 7 5 Picturesque New Zealand, 1913.djvu/46 , 8 5 Picturesque New Zealand, 1913.djvu/32 , 9 5 Picturesque New Zealand, 1913.djvu/27 , 10 5 Picturesque New Zealand, 1913.djvu/25 , 11 5 John Knox Laughton , 12 4 Picturesque New Zealand, 1913.djvu/472 , 13 4 Picturesque New Zealand, 1913.djvu/473 , 14 4 Picturesque New Zealand, 1913.djvu/476 , 15 4 Picturesque New Zealand, 1913.djvu/77 , 16 4 Picturesque New Zealand, 1913.djvu/71 , 17 4 Picturesque New Zealand, 1913.djvu/101 , 18 4 Picturesque New Zealand, 1913.djvu/62 , 19 4 Picturesque New Zealand, 1913.djvu/53 , 20 4 Picturesque New Zealand, 1913.djvu/236 , 21 4 Picturesque New Zealand, 1913.djvu/243 , 22 4 Picturesque New Zealand, 1913.djvu/257 , 23 4 Picturesque New Zealand, 1913.djvu/299 , 24 4 Picturesque New Zealand, 1913.djvu/355 , 25 4 Picturesque New Zealand, 1913.djvu/409

out 2010: 1 7 T.O. 21M-LGM25C-1 , 2 4 Report of Colonel Warren, Fort Gilleland, September 18, 1836, to R. K. CALL, Governor of Florida , 3 4 Triangles of life, and other stories.djvu/130 , 4 4 1965 FBI monograph on Nation of Islam.djvu/61 , 5 4 Dictionary of National Biography, 1885-1900 , 6 3 The Right to Privacy , 7 3 Decline and Fall of the Roman Empire vol 1 (1897).djvu/15 , 8 3 Decline and Fall of the Roman Empire vol 1 (1897).djvu/14 , 9 3 Decline and Fall of the Roman Empire vol 1 (1897).djvu/13 , 10 3 Decline and Fall of the Roman Empire vol 1 (1897).djvu/12 , 11 3 Decline and Fall of the Roman Empire vol 1 (1897).djvu/11 , 12 3 A short history of social life in England.djvu/421 , 13 3 Works of Sir John Suckling.djvu/10 , 14 3 1909historyofdec04gibbuoft.djvu/12 , 15 3 1909historyofdec04gibbuoft.djvu/7 , 16 3 Works of Sir John Suckling.djvu/9 , 17 3 Triangles of life, and other stories.djvu/100 , 18 3 Triangles of life, and other stories.djvu/101 , 19 3 Triangles of life, and other stories.djvu/132 , 20 3 Queen Elizabeth II's Remarks to the people of the United States , 21 3 Triangles of life, and other stories.djvu/79 , 22 3 Triangles of life, and other stories.djvu/126 , 23 3 Devonshire Characters and Strange Events.djvu/942 , 24 3 Devonshire Characters and Strange Events.djvu/941 , 25 3 Devonshire Characters and Strange Events.djvu/940

nov 2010: 1 5 Stevenson - Treasure Island.djvu/23 , 2 5 Stevenson - Treasure Island.djvu/22 , 3 5 Stevenson - Treasure Island.djvu/17 , 4 5 Stevenson - Treasure Island.djvu/8 , 5 4 Stevenson - Treasure Island.djvu/18 , 6 4 Stevenson - Treasure Island.djvu/19 , 7 4 Stevenson - Treasure Island.djvu/20 , 8 4 Stevenson - Treasure Island.djvu/24 , 9 4 A Thousand-Mile Walk To The Gulf.djvu/279 , 10 4 Warner Bros. Coraline Corsets , 11 4 A Book of Nursery Rhymes.djvu/9 , 12 4 WarnerBrosCoralineCorsets page12.png , 13 3 The Silverado Squatters/In the Valley , 14 3 The Silverado Squatters/With the Children of Israel/Chapter 1 , 15 3 The theory of electrons and the propagation of light , 16 3 Stevenson - Treasure Island.djvu/21 , 17 3 Stevenson - Treasure Island.djvu/49 , 18 3 Stevenson - Treasure Island.djvu/48 , 19 3 Stevenson - Treasure Island.djvu/47 , 20 3 Stevenson - Treasure Island.djvu/46 , 21 3 Stevenson - Treasure Island.djvu/45 , 22 3 Stevenson - Treasure Island.djvu/44 , 23 3 Stevenson - Treasure Island.djvu/43 , 24 3 Stevenson - Treasure Island.djvu/40 , 25 3 Stevenson - Treasure Island.djvu/39

dez 2010: 1 5 Florian - The Fables, 1888.djvu/89 , 2 5 Florian - The Fables, 1888.djvu/87 , 3 5 Florian - The Fables, 1888.djvu/86 , 4 5 Florian - The Fables, 1888.djvu/16 , 5 5 Florian - The Fables, 1888.djvu , 6 4 The Velveteen Rabbit.djvu/15 , 7 4 Florian - The Fables, 1888.djvu/85 , 8 4 Florian - The Fables, 1888.djvu/72 , 9 4 Florian - The Fables, 1888.djvu/57 , 10 4 Florian - The Fables, 1888.djvu/125 , 11 4 Florian - The Fables, 1888.djvu/124 , 12 4 Florian - The Fables, 1888.djvu/93 , 13 4 Florian - The Fables, 1888.djvu/83 , 14 4 Florian - The Fables, 1888.djvu/80 , 15 4 Florian - The Fables, 1888.djvu/78 , 16 4 Florian - The Fables, 1888.djvu/75 , 17 4 Florian - The Fables, 1888.djvu/73 , 18 4 Florian - The Fables, 1888.djvu/71 , 19 4 Florian - The Fables, 1888.djvu/68 , 20 4 Florian - The Fables, 1888.djvu/58 , 21 4 Florian - The Fables, 1888.djvu/48 , 22 4 Florian - The Fables, 1888.djvu/36 , 23 4 Florian - The Fables, 1888.djvu/127 , 24 4 Views in Suffolk, Norfolk, and Northamptonshire.djvu , 25 4 Stevenson - Treasure Island.djvu/13

jan 2011: 1 6 The Harvard Classics Vol. 51; Lectures.djvu/347 , 2 5 Sandbox.djvu/1 , 3 5 The Harvard Classics Vol. 51; Lectures.djvu/276 , 4 5 The Harvard Classics Vol. 51; Lectures.djvu/264 , 5 4 Remarks by the President at a Memorial Service for Victims of the Shootings in Tucson, Arizona , 6 4 The Harvard Classics Vol. 51; Lectures.djvu/426 , 7 4 The Harvard Classics Vol. 51; Lectures.djvu/422 , 8 4 The Harvard Classics Vol. 51; Lectures.djvu/417 , 9 4 The Harvard Classics Vol. 51; Lectures.djvu/389 , 10 4 The Harvard Classics Vol. 51; Lectures.djvu/383 , 11 4 The Harvard Classics Vol. 51; Lectures.djvu/381 , 12 4 The Harvard Classics Vol. 51; Lectures.djvu/362 , 13 4 The Harvard Classics Vol. 51; Lectures.djvu/357 , 14 4 The Harvard Classics Vol. 51; Lectures.djvu/348 , 15 4 The Harvard Classics Vol. 51; Lectures.djvu/346 , 16 4 The Harvard Classics Vol. 51; Lectures.djvu/345 , 17 4 The Harvard Classics Vol. 51; Lectures.djvu/344 , 18 4 The Harvard Classics Vol. 51; Lectures.djvu/343 , 19 4 The Harvard Classics Vol. 51; Lectures.djvu/342 , 20 4 The Harvard Classics Vol. 51; Lectures.djvu/324 , 21 4 The Harvard Classics Vol. 51; Lectures.djvu/319 , 22 4 The Harvard Classics Vol. 51; Lectures.djvu/317 , 23 4 The Harvard Classics Vol. 51; Lectures.djvu/314 , 24 4 The Harvard Classics Vol. 51; Lectures.djvu/291 , 25 4 The Harvard Classics Vol. 51; Lectures.djvu/290

fev 2011: 1 6 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/25 , 2 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/26 , 3 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/27 , 4 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/28 , 5 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/56 , 6 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/55 , 7 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/52 , 8 5 Ornithological Biography/Volume 1/Wild Turkey , 9 5 Ornithological Biography/Volume 1 , 10 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/44 , 11 5 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/29 , 12 4 The Gateless Gate , 13 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/222 , 14 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/176 , 15 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/153 , 16 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/150 , 17 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/149 , 18 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/209 , 19 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/129 , 20 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/126 , 21 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/125 , 22 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/108 , 23 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/107 , 24 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/106 , 25 4 Ornithological biography, or an account of the habits of the birds of the United States of America, volume 1.djvu/105

mar 2011: 1 7 United Nations Security Council Resolution 1973 , 2 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/120 , 3 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/56 , 4 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/54 , 5 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/173 , 6 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/169 , 7 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/149 , 8 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/145 , 9 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/34 , 10 5 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/44 , 11 4 The Romance of Isabel, Lady Burton.djvu , 12 4 Royalnavyhistory01clow.djvu , 13 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/223 , 14 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/221 , 15 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/222 , 16 4 United Nations Security Council Resolution 1970 , 17 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/159 , 18 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/158 , 19 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/157 , 20 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/156 , 21 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/155 , 22 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/154 , 23 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/167 , 24 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/148 , 25 4 The Art of Bookbinding, Zaehnsdorf, 1890.djvu/151

abr 2011: 1 5 Metamorphoses/Pyramus and Thisbe , 2 4 Earle, Does Price Fixing Destroy Liberty, 1920, 005.jpg , 3 4 Female Prose Writers of America.djvu/193 , 4 4 Female Prose Writers of America.djvu/91 , 5 4 Howells, Stops of Various Quills, 1895 059.jpg , 6 4 Female Prose Writers of America.djvu/46 , 7 4 Female Prose Writers of America.djvu , 8 4 Summa Theologiae , 9 3 A Dissertation on the Marriage of a Man with his Sister-in-Law , 10 3 Blaise Pascal/Discourse on the Passion of Love , 11 3 Blaise Pascal/The Art of Persuasion , 12 3 Blaise Pascal/Conversation on Epictetus and Montaigne , 13 3 Blaise Pascal/On the Conversion of the Sinner , 14 3 Blaise Pascal/Discourses on the Condition of the Great , 15 3 Blaise Pascal/Prayer, to Ask of God the Proper Use of Sickness , 16 3 Blaise Pascal/Epitaph of M. Pascal, Pere , 17 3 Blaise Pascal/Comparison Between Christians of Early Times and Those of To-Day , 18 3 Earle, Does Price Fixing Destroy Liberty, 1920, 001.jpg , 19 3 Female Prose Writers of America.djvu/265 , 20 3 Female Prose Writers of America.djvu/384 , 21 3 Female Prose Writers of America.djvu/349 , 22 3 Female Prose Writers of America.djvu/208 , 23 3 Female Prose Writers of America.djvu/266 , 24 3 Horse shoes and horse shoeing.djvu/508 , 25 3 Horse shoes and horse shoeing.djvu/507

mai 2011: 1 5 Remarks by the President on Osama bin Laden , 2 5 The fairy tales of science.djvu/19 , 3 4 Hockey, Canada's Royal Winter Game.djvu/70 , 4 4 Hockey, Canada's Royal Winter Game.djvu/3 , 5 4 A Survival of Torture , 6 4 The fairy tales of science.djvu/27 , 7 4 The fairy tales of science.djvu , 8 3 Popular Science Monthly/Volume 45/July 1894/Savagery and Survivals , 9 3 David Russell McAnally , 10 3 The People of the State of California vs. Lawrence Ferlinghetti , 11 3 Hockey, Canada's Royal Winter Game.djvu/115 , 12 3 United States Statutes at Large/Volume 40/65th Congress , 13 3 Hockey, Canada's Royal Winter Game.djvu/103 , 14 3 Hockey, Canada's Royal Winter Game.djvu/102 , 15 3 Hockey, Canada's Royal Winter Game.djvu/2 , 16 3 Hockey, Canada's Royal Winter Game.djvu/45 , 17 3 Hockey, Canada's Royal Winter Game.djvu/37 , 18 3 Hockey, Canada's Royal Winter Game.djvu/36 , 19 3 Hockey, Canada's Royal Winter Game.djvu/25 , 20 3 Hockey, Canada's Royal Winter Game.djvu/23 , 21 3 Hockey, Canada's Royal Winter Game.djvu/10 , 22 3 Hockey, Canada's Royal Winter Game.djvu/20 , 23 3 Hockey, Canada's Royal Winter Game.djvu/19 , 24 3 Hockey, Canada's Royal Winter Game.djvu/17 , 25 3 Hockey, Canada's Royal Winter Game.djvu

jun 2011: 1 7 The Life of Michael Angelo.djvu , 2 6 The Life of Michael Angelo.djvu/11 , 3 5 The Life of Michael Angelo.djvu/244 , 4 5 The Life of Michael Angelo.djvu/29 , 5 5 The Life of Michael Angelo.djvu/43 , 6 5 The Life of Michael Angelo.djvu/99 , 7 5 The Life of Michael Angelo.djvu/122 , 8 5 The Life of Michael Angelo.djvu/121 , 9 5 The Life of Michael Angelo.djvu/19 , 10 5 Is There a Santa Claus? (New York Sun) , 11 4 Korean Air Flight 801 investigation (final report) , 12 4 The Life of Michael Angelo.djvu/251 , 13 4 The Life of Michael Angelo.djvu/243 , 14 4 The Life of Michael Angelo.djvu/157 , 15 4 The Day's Work/.007 , 16 4 Memorial of the Cherokees , 17 4 The Life of Michael Angelo.djvu/90 , 18 4 The Life of Michael Angelo.djvu/88 , 19 4 The Life of Michael Angelo.djvu/87 , 20 4 The Life of Michael Angelo.djvu/48 , 21 4 The Life of Michael Angelo.djvu/150 , 22 4 The Life of Michael Angelo.djvu/27 , 23 4 The Life of Michael Angelo.djvu/237 , 24 4 The Life of Michael Angelo.djvu/177 , 25 4 The Life of Michael Angelo.djvu/171

jul 2011: 1 6 Picturesque New Guinea.djvu/31 , 2 6 Picturesque Nepal.djvu/167 , 3 6 Picturesque Nepal.djvu , 4 5 Picturesque New Guinea.djvu/355 , 5 5 Picturesque Nepal.djvu/315 , 6 5 Picturesque Nepal.djvu/314 , 7 5 Picturesque Nepal.djvu/313 , 8 5 Picturesque Nepal.djvu/161 , 9 5 Picturesque Nepal.djvu/156 , 10 5 Picturesque Nepal.djvu/135 , 11 5 Picturesque Nepal.djvu/129 , 12 5 Picturesque Nepal.djvu/113 , 13 5 Picturesque Nepal.djvu/93 , 14 5 Picturesque Nepal.djvu/88 , 15 5 Picturesque Nepal.djvu/83 , 16 5 Picturesque Nepal.djvu/44 , 17 4 Dorothy Mullock , 18 4 \"The Nonsense of It,\" a printed pamphlet arguing for woman suffrage.djvu , 19 4 Narrative of an Official Visit to Guatemala.djvu/474 , 20 4 Picturesque New Guinea.djvu/383 , 21 4 The Oxford book of Italian verse.djvu , 22 4 Picturesque New Guinea.djvu/384 , 23 4 An argosy of fables.djvu/7 , 24 4 Picturesque New Guinea.djvu/102 , 25 4 Picturesque New Guinea.djvu/89

ago 2011: 1 3 A Bit of Sunshine , 2 3 Western Europe in the Middle Ages.djvu/27 , 3 3 Description of Terrain Included in Case File for Congressional Medal of Honor to be Awarded to Joe R. Hooper, Staff... - NARA - 305379.jpg , 4 3 A treasury of war poetry, British and American poems of the world war, 1914-1919.djvu/160 , 5 3 Memoirs of Sherlock Holmes 1894 Burt.djvu/205 , 6 3 \"Prayer of Millions...suffering Europe.\", ca. 1917 - ca. 1917 - NARA - 512590.jpg , 7 3 Adjustment Team.djvu/4 , 8 3 Adjustment Team.djvu/2 , 9 3 Hamilton Men I Have Painted 033.jpg , 10 3 Pictures From Italy.djvu/132 , 11 3 The World's Famous Orations Volume 6.djvu/137 , 12 3 Suggestions on the Arrangement and Characteristics of Parish Churches.djvu/27 , 13 3 The World's Famous Orations/Volume 6/A Plea for Irish Legislative Independence , 14 3 The World's Famous Orations Volume 6.djvu/116 , 15 3 Suggestions on the Arrangement and Characteristics of Parish Churches.djvu/14 , 16 3 Suggestions on the Arrangement and Characteristics of Parish Churches.djvu/13 , 17 3 Suggestions on the Arrangement and Characteristics of Parish Churches.djvu/12 , 18 3 Suggestions on the Arrangement and Characteristics of Parish Churches.djvu/11 , 19 3 Suggestions on the Arrangement and Characteristics of Parish Churches.djvu , 20 3 Charles Phillips , 21 3 The World's Famous Orations Volume 6.djvu/66 , 22 3 The World's Famous Orations Volume 6.djvu/119 , 23 3 The World's Famous Orations/Volume 6/On Conciliation with America , 24 3 Message of President Martin Van Buren nominating Joel R. Poinsett to be Secretary of War, 03-07-1837 - NARA - 306300.jpg , 25 3 The World's Famous Orations Volume 6.djvu/9

set 2011: 1 5 Ninety-three.djvu/45 , 2 5 Ninety-three.djvu/42 , 3 5 Ninety-three.djvu , 4 4 Ninety-three.djvu/69 , 5 4 Ninety-three.djvu/58 , 6 4 Ninety-three.djvu/55 , 7 4 Ninety-three.djvu/48 , 8 4 Ninety-three.djvu/53 , 9 4 Ninety-three.djvu/22 , 10 4 Ninety-three.djvu/37 , 11 4 Ninety-three.djvu/35 , 12 4 EB1911 - Volume 20.djvu/275 , 13 3 Ninety-three.djvu/273 , 14 3 Ninety-three.djvu/124 , 15 3 Atharva-Veda samhita.djvu/11 , 16 3 Ron Paul's 1987 Resignation Letter to the RNC , 17 3 Ninety-three.djvu/104 , 18 3 Ninety-three.djvu/92 , 19 3 Ninety-three.djvu/91 , 20 3 Ninety-three.djvu/90 , 21 3 Ninety-three.djvu/89 , 22 3 Ninety-three.djvu/88 , 23 3 Collected poems of Rupert Brooke.djvu/12 , 24 3 Collected poems of Rupert Brooke.djvu/11 , 25 3 Collected poems of Rupert Brooke.djvu/7

out 2011: 1 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/328 , 2 4 English Caricaturists and Graphic Humourists of the Nineteenth Century , 3 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/225 , 4 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/204 , 5 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/166 , 6 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/144 , 7 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/79 , 8 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/47 , 9 4 English Caricaturists and Graphic Humourists of the nineteenth century.djvu , 10 4 Dictionary of National Biography volume 04.djvu/26 , 11 4 John André , 12 3 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/353 , 13 3 Roman History of Ammianus Marcellinus.djvu , 14 3 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/327 , 15 3 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/323 , 16 3 Agreement with the Comanche, Kiowa and Apache, 1892 , 17 3 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/365 , 18 3 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/273 , 19 3 Fourteen sonnets and poems.djvu/24 , 20 3 British Railways and the War , 21 3 The Monody of Major Andre , 22 3 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/305 , 23 3 Territories forming part of the Commonwealth , 24 3 AnnexB Members of the Commonwealth.pdf/1 , 25 3 English Caricaturists and Graphic Humourists of the nineteenth century.djvu/207

nov 2011: 1 3 Manual of the New Zealand Flora.djvu/106 , 2 3 Historia Verdadera del Mexico profundo.djvu , 3 3 Physical Characters of the Human Races , 4 3 Poems & poèmes/The Weeping Venus , 5 3 Poems & poèmes.djvu/13 , 6 3 Poems & poèmes.djvu/18 , 7 3 Franklin D. Roosevelt to Winston Churchill - NARA - 194785.jpg , 8 3 Franklin D. Roosevelt to Lord Lothian - NARA - 194800.jpg , 9 3 Franklin D. Roosevelt to Winston Churchill (September 11, 1939) , 10 3 Sumner Welles to Franklin D. Roosevelt - NARA - 194791.jpg , 11 3 Franklin D. Roosevelt to Winston Churchill - NARA - 194790.jpg , 12 3 Franklin D. Roosevelt to Winston Churchill - NARA - 194787.jpg , 13 3 Adolf Berle to Franklin D. Roosevelt - NARA - 194786.jpg , 14 3 Franklin D. Roosevelt to Winston Churchill - NARA - 194785.jpg , 15 3 Edwin M. Watson to Franklin D. Roosevelt - NARA - 194784.jpg , 16 3 Roman History of Ammianus Marcellinus.djvu/379 , 17 3 The International Jew - Volume 1.djvu/99 , 18 3 The progress of our knowledge of the flora of North America , 19 3 Physiology of the Passions , 20 3 Scrymgeour, Henry (DNB00) , 21 3 A Brief History of Modern Philosophy.djvu , 22 2 Daany Beédxe.djvu , 23 2 Popular Science Monthly/Volume 46/December 1894/Helmholtz's Tribute to Heinrich Hertz , 24 2 Poems: Second Series/I went to Heaven , 25 2 Executive Orders 7262-8027.djvu/10

dez 2011: 1 6 Yule Logs.djvu/93 , 2 5 Yule Logs.djvu/151 , 3 5 Charles Robert Darwin , 4 4 Mexico, California and Arizona - 1900.djvu/13 , 5 4 Yule Logs.djvu/405 , 6 4 Yule Logs , 7 3 National Security Action Memorandum No. 103 Deployment of U.S. Military Forces - NARA - 193496.jpg , 8 3 Franklin D. Roosevelt to Paul Reynaud - NARA - 194806.jpg , 9 3 The Land Question.djvu/13 , 10 3 The Land Question.djvu/9 , 11 3 The Land Question.djvu/8 , 12 3 The Land Question.djvu/7 , 13 3 The Land Question.djvu/5 , 14 3 The Land Question.djvu/23 , 15 3 Immediate Experience and Mediation.djvu/16 , 16 3 Yule Logs.djvu/309 , 17 3 Homer - Iliad, translation Pope, 1909.djvu/11 , 18 3 Winston Churchill to Franklin D. Roosevelt - NARA - 194815.jpg , 19 3 Mexico, California and Arizona - 1900.djvu/23 , 20 3 Mexico, California and Arizona - 1900.djvu/19 , 21 3 Mexico, California and Arizona - 1900.djvu/12 , 22 3 Mexico, California and Arizona - 1900.djvu/11 , 23 3 Yule Logs.djvu/278 , 24 3 Yule Logs.djvu/276 , 25 3 Yule Logs.djvu/274

jan 2012: 1 5 A Desk Book on the Etiquette of Social Stationary.djvu/66 , 2 5 A Desk Book on the Etiquette of Social Stationary.djvu/49 , 3 5 A Desk-Book of Errors in English.djvu , 4 4 Sonnets from the Crimea/The Ackerman Steppe , 5 4 A Desk-Book of Errors in English.djvu/133 , 6 4 A Desk-Book of Errors in English.djvu/57 , 7 4 Cricket, by WG Grace.djvu/188 , 8 4 Cricket, by WG Grace.djvu/9 , 9 4 Cricket, by WG Grace.djvu/2 , 10 4 A Desk-Book of Errors in English.djvu/41 , 11 4 A Desk-Book of Errors in English.djvu/75 , 12 4 A Desk Book on the Etiquette of Social Stationary.djvu/50 , 13 4 Mexico, California and Arizona - 1900.djvu/124 , 14 4 Mexico, California and Arizona - 1900.djvu/77 , 15 4 A Desk-Book of Errors in English.djvu/27 , 16 3 Sonnets from the Crimea , 17 3 Sonnets from the Crimea/The Ruins of Balaclava , 18 3 Sonnets from the Crimea/On Juda's Cliff , 19 3 Sonnets from the Crimea/(Mirza) , 20 3 Sonnets from the Crimea/The Pass Across the Abyss in the Tschufut-Kale , 21 3 Sonnets from the Crimea/Tschatir Dagh (The Pilgrim) , 22 3 Sonnets from the Crimea/Tschatir Dagh (Mirza) , 23 3 Sonnets from the Crimea/Alushta by Night , 24 3 Sonnets from the Crimea/Alushta by Day , 25 3 Sonnets from the Crimea/Baydary

fev 2012: 1 6 Natural History, Mollusca.djvu , 2 4 \"WARNING - ALIENS - ARMY SERVICE FORCES\". (Provost Marshall General) - NARA - 516037.jpg , 3 4 Natural History, Mollusca.djvu/318 , 4 4 Natural History, Mollusca.djvu/270 , 5 4 Natural History, Mollusca.djvu/227 , 6 4 Natural History, Mollusca.djvu/222 , 7 4 Natural History, Mollusca.djvu/206 , 8 4 Natural History, Mollusca.djvu/209 , 9 4 Natural History, Mollusca.djvu/204 , 10 4 Natural History, Mollusca.djvu/340 , 11 4 Mexico as it was and as it is.djvu , 12 4 Treaty on Stability, Coordination and Governance in the Economic and Monetary Union (final draft) , 13 4 Natural History, Mollusca.djvu/176 , 14 4 Natural History, Mollusca.djvu/10 , 15 4 Natural History, Mollusca.djvu/9 , 16 3 Mexico as it was and as it is.djvu/300 , 17 3 Mexico as it was and as it is.djvu/297 , 18 3 Mexico as it was and as it is.djvu/296 , 19 3 Mexico as it was and as it is.djvu/281 , 20 3 Mexico as it was and as it is.djvu/280 , 21 3 Mexico as it was and as it is.djvu/267 , 22 3 Three Stories and Ten Poems/Out of Season , 23 3 Life with the Esquimaux - 1864 - Volume 1.djvu/10 , 24 3 Eskimo Life.djvu/251 , 25 3 Eskimo Life.djvu/249

mar 2012: 1 5 Charles A. Ward , 2 5 Mexico as it was and as it is.djvu/343 , 3 5 Sawdust & Spangles.djvu/141 , 4 4 Virginius Dabney (1901-1995) , 5 4 Susan Dabney Smedes , 6 4 Sawdust & Spangles.djvu/35 , 7 4 Sawdust & Spangles.djvu/32 , 8 4 Sawdust & Spangles.djvu/30 , 9 4 Sawdust & Spangles.djvu/103 , 10 4 Sawdust & Spangles.djvu/45 , 11 4 Sawdust & Spangles.djvu , 12 4 Aash Al Maleek , 13 3 Merry Muses of Caledonia.djvu , 14 3 Michael D. Higgins' Inaugural Address , 15 3 Don Quixote (Cervantes, Ormsby) Volume 2.djvu/17 , 16 3 Don Quixote (Cervantes, Ormsby) Volume 2.djvu/16 , 17 3 Don Quixote (Cervantes, Ormsby) Volume 2.djvu/14 , 18 3 Don Quixote (Cervantes, Ormsby) Volume 2.djvu/13 , 19 3 Don Quixote (Cervantes, Ormsby) Volume 2.djvu/12 , 20 3 Don Quixote (Cervantes, Ormsby) Volume 2.djvu/11 , 21 3 Don Quixote (Cervantes, Ormsby) Volume 2.djvu/9 , 22 3 Rajiv Ratna Gandhi , 23 3 Vikram Seth , 24 3 Diary of a Nobody.djvu/138 , 25 3 Song Ik-phil

abr 2012: 1 6 Merry Muses of Caledonia.djvu/41 , 2 5 The Corsair (Byron).djvu/85 , 3 5 Merry Muses of Caledonia.djvu/59 , 4 5 The Corsair (Byron).djvu , 5 4 The Corsair (Byron).djvu/83 , 6 4 The Corsair (Byron).djvu/81 , 7 4 The Corsair (Byron).djvu/80 , 8 4 The Corsair (Byron).djvu/115 , 9 4 The Corsair (Byron).djvu/58 , 10 4 The Corsair (Byron).djvu/57 , 11 4 The Corsair (Byron).djvu/51 , 12 4 The Corsair (Byron).djvu/48 , 13 4 Merry Muses of Caledonia.djvu/109 , 14 4 Merry Muses of Caledonia.djvu/83 , 15 4 Merry Muses of Caledonia.djvu/82 , 16 4 Merry Muses of Caledonia.djvu/121 , 17 4 Merry Muses of Caledonia.djvu/122 , 18 4 Merry Muses of Caledonia.djvu/85 , 19 4 Merry Muses of Caledonia.djvu/71 , 20 4 Merry Muses of Caledonia.djvu/58 , 21 4 Merry Muses of Caledonia.djvu/42 , 22 4 Merry Muses of Caledonia.djvu/40 , 23 4 Merry Muses of Caledonia.djvu/39 , 24 4 Merry Muses of Caledonia.djvu/48 , 25 4 Merry Muses of Caledonia.djvu/22

mai 2012: 1 5 Homes of the London Poor.djvu , 2 4 Homes of the London Poor.djvu/56 , 3 4 Our Common Land (and other short essays).djvu/40 , 4 4 James Smithson , 5 4 William Hunt , 6 4 Louis Alexander Fagan , 7 3 Life of Octavia Hill as told in her letters.djvu/123 , 8 3 Life of Octavia Hill as told in her letters.djvu/74 , 9 3 Life of Octavia Hill as told in her letters.djvu/73 , 10 3 Life of Octavia Hill as told in her letters.djvu/30 , 11 3 Life of Octavia Hill as told in her letters.djvu/29 , 12 3 Life of Octavia Hill as told in her letters.djvu/40 , 13 3 Life of Octavia Hill as told in her letters.djvu/39 , 14 3 Life of Octavia Hill as told in her letters.djvu/38 , 15 3 Life of Octavia Hill as told in her letters.djvu/37 , 16 3 Life of Octavia Hill as told in her letters.djvu/36 , 17 3 Life of Octavia Hill as told in her letters.djvu/35 , 18 3 Life of Octavia Hill as told in her letters.djvu/34 , 19 3 Life of Octavia Hill as told in her letters.djvu/51 , 20 3 Life of Octavia Hill as told in her letters.djvu/49 , 21 3 Life of Octavia Hill as told in her letters.djvu/47 , 22 3 Life of Octavia Hill as told in her letters.djvu/45 , 23 3 Life of Octavia Hill as told in her letters.djvu/44 , 24 3 Life of Octavia Hill as told in her letters.djvu/43 , 25 3 Life of Octavia Hill as told in her letters.djvu/41

jun 2012: 1 5 A dictionary of the Sunda language of Java.djvu/8 , 2 5 A dictionary of the Sunda language of Java.djvu , 3 4 Twilight (Frankau) , 4 4 Twilight.djvu/81 , 5 3 A dictionary of the Sunda language of Java.djvu/124 , 6 3 A dictionary of the Sunda language of Java.djvu/101 , 7 3 How Eupalinos Navigated His Way Through The Mountain , 8 3 Vienna Convention on the Law of Treaties (1969).djvu , 9 3 Henrietta Bedinger Lee , 10 3 A dictionary of the Sunda language of Java.djvu/31 , 11 3 DenisGale annotated notebook complete2.pdf , 12 3 Onthetendencyofspecies.pdf/18 , 13 3 Onthetendencyofspecies.pdf/1 , 14 3 The Ethics of War.pdf , 15 3 The Seven Seas (Kipling, 1896).djvu/201 , 16 3 Kerfol - Wharton.pdf , 17 3 Discovery and Decipherment of the Trilingual Cuneiform Inscriptions.djvu/57 , 18 3 In the Days of the Comet , 19 3 Caroline Matilda Kirkland , 20 3 Atlas of the World Battle Fronts in Semimonthly Phases to August 15 1945 , 21 3 Elementary Chinese - San Tzu Ching (1900).djvu/7 , 22 3 Warwick William Wroth , 23 3 Richard Phené Spiers , 24 3 William Graham Sumner , 25 3 Popular Science Monthly Volume 10.djvu/30

jul 2012: 1 9 A dictionary of the Sunda language of Java.djvu/183 , 2 9 A dictionary of the Sunda language of Java.djvu/14 , 3 8 A dictionary of the Sunda language of Java.djvu/24 , 4 7 A dictionary of the Sunda language of Java.djvu/215 , 5 7 A dictionary of the Sunda language of Java.djvu/194 , 6 7 A dictionary of the Sunda language of Java.djvu/188 , 7 7 A dictionary of the Sunda language of Java.djvu/173 , 8 6 A dictionary of the Sunda language of Java.djvu/258 , 9 6 A dictionary of the Sunda language of Java.djvu/478 , 10 6 A dictionary of the Sunda language of Java.djvu/202 , 11 6 A dictionary of the Sunda language of Java.djvu/201 , 12 6 A dictionary of the Sunda language of Java.djvu/180 , 13 6 A dictionary of the Sunda language of Java.djvu/166 , 14 6 A dictionary of the Sunda language of Java.djvu/82 , 15 6 A dictionary of the Sunda language of Java.djvu/35 , 16 6 A dictionary of the Sunda language of Java.djvu/28 , 17 5 A dictionary of the Sunda language of Java.djvu/364 , 18 5 A dictionary of the Sunda language of Java.djvu/352 , 19 5 A dictionary of the Sunda language of Java.djvu/513 , 20 5 A dictionary of the Sunda language of Java.djvu/562 , 21 5 A dictionary of the Sunda language of Java.djvu/482 , 22 5 A dictionary of the Sunda language of Java.djvu/488 , 23 5 A dictionary of the Sunda language of Java.djvu/237 , 24 5 A dictionary of the Sunda language of Java.djvu/249 , 25 5 A dictionary of the Sunda language of Java.djvu/221

ago 2012: 1 5 US District Court Jury Verdict SRF v Ananda 2002.pdf , 2 5 Climatic Cycles and Tree-Growth - 1919.djvu/113 , 3 5 The Oak.djvu/79 , 4 4 Climatic Cycles and Tree-Growth - 1919.djvu/34 , 5 4 Climatic Cycles and Tree-Growth - 1919.djvu/36 , 6 4 Climatic Cycles and Tree-Growth - 1919.djvu/129 , 7 4 Climatic Cycles and Tree-Growth - 1919.djvu/130 , 8 4 Climatic Cycles and Tree-Growth - 1919.djvu/131 , 9 4 Climatic Cycles and Tree-Growth - 1919.djvu/134 , 10 4 Climatic Cycles and Tree-Growth - 1919.djvu/141 , 11 4 Climatic Cycles and Tree-Growth - 1919.djvu/145 , 12 4 Climatic Cycles and Tree-Growth - 1919.djvu/146 , 13 4 Climatic Cycles and Tree-Growth - 1919.djvu/147 , 14 4 Climatic Cycles and Tree-Growth - 1919.djvu/148 , 15 4 Climatic Cycles and Tree-Growth - 1919.djvu/151 , 16 4 Climatic Cycles and Tree-Growth - 1919.djvu/154 , 17 4 Climatic Cycles and Tree-Growth - 1919.djvu/37 , 18 4 Climatic Cycles and Tree-Growth - 1919.djvu/35 , 19 4 Climatic Cycles and Tree-Growth - 1919.djvu/31 , 20 4 Climatic Cycles and Tree-Growth - 1919.djvu/27 , 21 4 Climatic Cycles and Tree-Growth - 1919.djvu/25 , 22 4 Climatic Cycles and Tree-Growth - 1919.djvu/9 , 23 4 Climatic Cycles and Tree-Growth - 1919.djvu/17 , 24 4 EPIC Oxford report.pdf/16 , 25 4 The Oak.djvu/40

set 2012: 1 7 The European Concert in the Eastern Question.djvu/23 , 2 5 The European Concert in the Eastern Question.djvu/22 , 3 5 The European Concert in the Eastern Question.djvu/21 , 4 4 Completeconfectioner Glasse 1800.djvu/10 , 5 4 The European Concert in the Eastern Question.djvu/25 , 6 4 Our Sister Republic - Mexico.djvu/4 , 7 4 The European Concert in the Eastern Question.djvu/44 , 8 4 The European Concert in the Eastern Question.djvu/24 , 9 4 The European Concert in the Eastern Question.djvu/20 , 10 4 The European Concert in the Eastern Question.djvu/11 , 11 4 The food of the Gods - A Popular Account of Cocoa.djvu/16 , 12 4 The food of the Gods - A Popular Account of Cocoa.djvu/15 , 13 3 2012 Democratic National Convention/Michelle Obama's Address , 14 3 The Holy Bible, containing the Old & New Testament & the Apocrypha.djvu/920 , 15 3 The Bible Against Slavery (Weld, 1838).djvu/3 , 16 3 Principles 3.2.pdf , 17 3 The Government of Iowa 1911.djvu/27 , 18 3 The Government of Iowa 1911.djvu/23 , 19 3 The Government of Iowa 1911.djvu/15 , 20 3 The Government of Iowa 1911.djvu , 21 3 Completeconfectioner Glasse 1800.djvu/11 , 22 3 Completeconfectioner Glasse 1800.djvu/9 , 23 3 Face to Face With the Mexicans.djvu/264 , 24 3 Betelguese, a trip through hell.djvu/103 , 25 3 Betelguese, a trip through hell.djvu/101

out 2012: 1 5 The American Indian.djvu , 2 4 The American Indian.djvu/290 , 3 4 The American Indian.djvu/253 , 4 4 The American Indian.djvu/500 , 5 4 The American Indian.djvu/501 , 6 4 The American Indian.djvu/202 , 7 4 The American Indian.djvu/189 , 8 4 The American Indian.djvu/165 , 9 4 Life of William Hickling Prescott.djvu/12 , 10 4 The American Indian.djvu/19 , 11 4 The American Indian.djvu/150 , 12 4 The American Indian.djvu/36 , 13 4 Life of William Hickling Prescott.djvu/13 , 14 4 The American Indian.djvu/44 , 15 4 The American Indian.djvu/100 , 16 4 The American Indian.djvu/255 , 17 3 England and the Islands.gif , 18 3 News, West Coast Times, Tuesday January 8, 1889.gif , 19 3 The American Indian.djvu/377 , 20 3 The American Indian.djvu/364 , 21 3 The American Indian.djvu/337 , 22 3 The American Indian.djvu/320 , 23 3 The American Indian.djvu/286 , 24 3 The American Indian.djvu/285 , 25 3 The American Indian.djvu/282

nov 2012: 1 4 Cassells' Carpentry and Joinery.djvu/19 , 2 4 Mike (Wodehouse).djvu/7 , 3 4 Popular Science Monthly/Volume 42/December 1892/Protective Devices and Coloration of Land Snails , 4 4 An argosy of fables.djvu , 5 4 Barack Hussein Obama , 6 3 The Clipper Ship Era.djvu/18 , 7 3 The Clipper Ship Era.djvu/15 , 8 3 The Clipper Ship Era.djvu/23 , 9 3 The Clipper Ship Era.djvu/22 , 10 3 Kennedy, Robert John - A Journey in Khorassan (1890).djvu/63 , 11 3 Kennedy, Robert John - A Journey in Khorassan (1890).djvu/62 , 12 3 Kennedy, Robert John - A Journey in Khorassan (1890).djvu/15 , 13 3 Kennedy, Robert John - A Journey in Khorassan (1890).djvu , 14 3 Marko Kraljević and Alil-Aga , 15 3 Barack Obama's 2012 election victory speech , 16 3 New land mollusks from Madagascar and Mexico.djvu , 17 3 The Negroes at Port Royal: Report of E. L. Pierce, Government Agent, to the Hon. Salmon P. Chase, Secretary of the Treasury , 18 3 The Black Cat November 1916.djvu/1 , 19 3 The Works of Lord Byron (ed. Coleridge, Prothero) - Volume 1.djvu/7 , 20 3 Mike (Wodehouse).djvu/236 , 21 3 Mike (Wodehouse).djvu/128 , 22 3 Mike (Wodehouse).djvu/126 , 23 3 Mike (Wodehouse).djvu/125 , 24 3 Mike (Wodehouse).djvu/124 , 25 3 Mike (Wodehouse).djvu/123

dez 2012: 1 5 The varieties of religious experience, a study in human nature.djvu/118 , 2 5 Vanity Fair 1848.djvu , 3 4 Picture Posters.djvu/9 , 4 4 The varieties of religious experience, a study in human nature.djvu/360 , 5 4 The varieties of religious experience, a study in human nature.djvu/359 , 6 4 The varieties of religious experience, a study in human nature.djvu/27 , 7 4 The varieties of religious experience, a study in human nature.djvu , 8 3 Picture Posters.djvu/8 , 9 3 Picture Posters.djvu/5 , 10 3 Palestine Exploration Fund - Quarterly Statement for 1894.djvu/231 , 11 3 Flying magazine/1931/Look Out, Lindbergh - Here I Come , 12 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/14 , 13 3 Things Seen In Holland (1912).djvu/1 , 14 3 EB1911 - Volume 02.djvu/467 , 15 3 The varieties of religious experience, a study in human nature.djvu/467 , 16 3 The varieties of religious experience, a study in human nature.djvu/329 , 17 3 The varieties of religious experience, a study in human nature.djvu/302 , 18 3 The varieties of religious experience, a study in human nature.djvu/226 , 19 3 The varieties of religious experience, a study in human nature.djvu/225 , 20 3 Railways Act 1921 (ukpga 19210055 en).pdf/70 , 21 3 The varieties of religious experience, a study in human nature.djvu/412 , 22 3 Dictionary of National Biography volume 25.djvu/138 , 23 3 The varieties of religious experience, a study in human nature.djvu/177 , 24 3 The varieties of religious experience, a study in human nature.djvu/158 , 25 3 The Cadet Hand Book and Section Roll

jan 2013: 1 6 Mr. Punch's Book of Sports.djvu/44 , 2 6 Mr. Punch's Book of Sports.djvu/37 , 3 6 Mr. Punch's Book of Sports.djvu/17 , 4 6 Japanese flower arrangement.djvu , 5 6 The Early English Organ Builders and their work.djvu , 6 6 Evolution of the thermometer.djvu/4 , 7 5 Mr. Punch's Book of Sports.djvu/32 , 8 5 Mr. Punch's Book of Sports.djvu/16 , 9 5 Barack Obama's Second Inaugural Address , 10 5 Japanese flower arrangement.djvu/68 , 11 5 How to write a Short Story.djvu , 12 5 English As She Is Spoke , 13 4 Mr. Punch's Book of Sports.djvu/20 , 14 4 Mr. Punch's Book of Sports.djvu/48 , 15 4 Mr. Punch's Book of Sports.djvu/47 , 16 4 Mr. Punch's Book of Sports.djvu/45 , 17 4 Mr. Punch's Book of Sports.djvu/38 , 18 4 Mr. Punch's Book of Sports.djvu/43 , 19 4 Mr. Punch's Book of Sports.djvu/42 , 20 4 Mr. Punch's Book of Sports.djvu/30 , 21 4 Mr. Punch's Book of Sports.djvu/101 , 22 4 Mr. Punch's Book of Sports.djvu/77 , 23 4 Mr. Punch's Book of Sports.djvu/196 , 24 4 Mr. Punch's Book of Sports.djvu/66 , 25 4 Mr. Punch's Book of Sports.djvu/99

fev 2013: 1 5 Vanity Fair 1848.djvu/406 , 2 5 Senator Wyden Remarks at Aaron Swartz Memorial , 3 5 Vanity Fair 1848.djvu/96 , 4 5 Great Expectations.djvu/20 , 5 4 Vanity Fair 1848.djvu/655 , 6 4 Ford manual 1919.djvu/47 , 7 4 Ford manual 1919.djvu/45 , 8 4 Vanity Fair 1848.djvu/582 , 9 4 Vanity Fair 1848.djvu/515 , 10 4 Vanity Fair 1848.djvu/514 , 11 4 Vanity Fair 1848.djvu/513 , 12 4 Vanity Fair 1848.djvu/512 , 13 4 The Acts of the Apostles Translated into English Metre.djvu , 14 4 Vanity Fair 1848.djvu/277 , 15 4 Vanity Fair 1848.djvu/246 , 16 4 Vanity Fair 1848.djvu/236 , 17 4 Vanity Fair 1848.djvu/186 , 18 4 Vanity Fair 1848.djvu/169 , 19 4 Vanity Fair 1848.djvu/164 , 20 4 Vanity Fair 1848.djvu/140 , 21 4 Vanity Fair 1848.djvu/680 , 22 4 Vanity Fair 1848.djvu/100 , 23 4 Vanity Fair 1848.djvu/99 , 24 4 Vanity Fair 1848.djvu/95 , 25 4 Vanity Fair 1848.djvu/226

mar 2013: 1 4 Helen of Troy and Other Poems.djvu/129 , 2 4 Six Months In Mexico.pdf , 3 4 Abraham Lincoln address (1909).djvu , 4 3 2013-01-28-DEI-EEC-to-Holder-re-Aaron-Schwartz-prosecution.pdf , 5 3 Helen of Troy and Other Poems.djvu/135 , 6 3 Helen of Troy and Other Poems.djvu/134 , 7 3 Helen of Troy and Other Poems.djvu/133 , 8 3 Helen of Troy and Other Poems.djvu/132 , 9 3 Helen of Troy and Other Poems.djvu/131 , 10 3 Helen of Troy and Other Poems.djvu/130 , 11 3 Edward de Vere (1550-1604) , 12 3 Helen of Troy and Other Poems.djvu/11 , 13 3 A Reconstruction Letter, Stedman, 1866.djvu/10 , 14 3 The Recluse, Wordsworth, 1888.djvu , 15 3 A lecture on the evils of emigration and transportation.djvu/28 , 16 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/428 , 17 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/475 , 18 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/494 , 19 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/497 , 20 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/500 , 21 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/503 , 22 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/505 , 23 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/524 , 24 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/526 , 25 3 Incidents of travel in Central America, Chiapas and Yucatan.djvu/535

abr 2013: 1 8 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu , 2 6 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/25 , 3 5 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/67 , 4 5 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/30 , 5 5 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/29 , 6 4 A Treasury of South African Poetry.djvu/31 , 7 4 A Treasury of South African Poetry.djvu/37 , 8 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/121 , 9 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/183 , 10 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/86 , 11 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/352 , 12 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/80 , 13 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/387 , 14 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/386 , 15 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/74 , 16 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/73 , 17 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/71 , 18 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/146 , 19 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/70 , 20 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/26 , 21 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/15 , 22 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/13 , 23 4 The Romance of Nature; or, The Flower-Seasons Illustrated.djvu/7 , 24 3 The Yellow Wall Paper.djvu/2 , 25 3 The Yellow Wall Paper.djvu/1

mai 2013: 1 8 Natural History, Birds.djvu , 2 5 Natural History, Birds.djvu/44 , 3 5 Natural History, Birds.djvu/30 , 4 5 Natural History, Birds.djvu/26 , 5 5 Natural History, Birds.djvu/23 , 6 5 Natural History, Birds.djvu/9 , 7 5 The Yellow Wall Paper.djvu , 8 4 The story of the three bears 1839.pdf/45 , 9 4 The story of the three bears 1839.pdf/29 , 10 4 The story of the three bears 1839.pdf/22 , 11 4 The story of the three bears 1839.pdf/26 , 12 4 The story of the three bears 1839.pdf/23 , 13 4 Natural History, Birds.djvu/318 , 14 4 Natural History, Birds.djvu/276 , 15 4 Natural History, Birds.djvu/255 , 16 4 Natural History, Birds.djvu/229 , 17 4 Natural History, Birds.djvu/216 , 18 4 Natural History, Birds.djvu/180 , 19 4 Natural History, Birds.djvu/162 , 20 4 Natural History, Birds.djvu/160 , 21 4 Natural History, Birds.djvu/155 , 22 4 Natural History, Birds.djvu/133 , 23 4 Natural History, Birds.djvu/108 , 24 4 Natural History, Birds.djvu/106 , 25 4 Natural History, Birds.djvu/105

jun 2013: 1 5 Balthasar Hübmaier.djvu , 2 4 Balthasar Hübmaier.djvu/369 , 3 4 Balthasar Hübmaier.djvu/368 , 4 4 Balthasar Hübmaier.djvu/159 , 5 4 Balthasar Hübmaier.djvu/135 , 6 4 Balthasar Hübmaier.djvu/87 , 7 4 The Works of the Rev. Jonathan Swift, Volume 13.djvu/342 , 8 4 Balthasar Hübmaier.djvu/81 , 9 4 Balthasar Hübmaier.djvu/71 , 10 4 Balthasar Hübmaier.djvu/51 , 11 4 The Holy Bible, containing the Old & New Testament & the Apocrypha (Volume 3).djvu , 12 4 The Indian Biographical Dictionary.djvu/63 , 13 4 Jules Verne , 14 3 United States v. Windsor , 15 3 The Canterville Ghost.djvu/107 , 16 3 The Canterville Ghost.djvu/77 , 17 3 Balthasar Hübmaier.djvu/394 , 18 3 Balthasar Hübmaier.djvu/393 , 19 3 Balthasar Hübmaier.djvu/392 , 20 3 Balthasar Hübmaier.djvu/391 , 21 3 Balthasar Hübmaier.djvu/390 , 22 3 Balthasar Hübmaier.djvu/389 , 23 3 Balthasar Hübmaier.djvu/388 , 24 3 Balthasar Hübmaier.djvu/387 , 25 3 Balthasar Hübmaier.djvu/386

jul 2013: 1 7 Maury's New Elements of Geography, 1907.djvu , 2 6 Maury's New Elements of Geography, 1907.djvu/10 , 3 6 Maury's New Elements of Geography, 1907.djvu/6 , 4 5 Maury's New Elements of Geography, 1907.djvu/124 , 5 5 Maury's New Elements of Geography, 1907.djvu/67 , 6 5 SLQ OM81-130 Eleanor Elizabeth Bourne Papers p4.jpg , 7 5 SLQ OM81-130 Eleanor Elizabeth Bourne Papers p1.jpg , 8 5 Maury's New Elements of Geography, 1907.djvu/9 , 9 4 Maury's New Elements of Geography, 1907.djvu/123 , 10 4 Maury's New Elements of Geography, 1907.djvu/122 , 11 4 Maury's New Elements of Geography, 1907.djvu/97 , 12 4 Maury's New Elements of Geography, 1907.djvu/70 , 13 4 Maury's New Elements of Geography, 1907.djvu/69 , 14 4 Maury's New Elements of Geography, 1907.djvu/68 , 15 4 De re metallica (1912).djvu/43 , 16 4 Maury's New Elements of Geography, 1907.djvu/75 , 17 4 Letter from Maurice George Delpratt to Nell - December 1918 - p2.jpeg , 18 4 Letter from Maurice George Delpratt to Nell - December 1918 - p3.jpeg , 19 4 SLQ OM81-130 Eleanor Elizabeth Bourne Papers p6.jpg , 20 4 SLQ OM81-130 Eleanor Elizabeth Bourne Papers p5.jpg , 21 4 SLQ OM81-130 Eleanor Elizabeth Bourne Papers p3.jpg , 22 4 Maury's New Elements of Geography, 1907.djvu/129 , 23 4 Maury's New Elements of Geography, 1907.djvu/142 , 24 4 Maury's New Elements of Geography, 1907.djvu/141 , 25 4 Australian enquiry book of household and general information.djvu

ago 2013: 1 7 Diaries of Court Ladies of Old Japan.djvu , 2 5 Marriage as a Trade.djvu/101 , 3 4 Diaries of Court Ladies of Old Japan.djvu/248 , 4 4 Diaries of Court Ladies of Old Japan.djvu/110 , 5 4 Diaries of Court Ladies of Old Japan.djvu/62 , 6 4 Diaries of Court Ladies of Old Japan/Introduction , 7 4 Diaries of Court Ladies of Old Japan.djvu/142 , 8 4 Diaries of Court Ladies of Old Japan.djvu/141 , 9 4 Diaries of Court Ladies of Old Japan.djvu/140 , 10 4 Diaries of Court Ladies of Old Japan , 11 4 Ports of the world - Canton (1920).djvu/30 , 12 4 Ports of the world - Canton (1920).djvu/27 , 13 4 Ports of the world - Canton (1920).djvu/26 , 14 4 Ports of the world - Canton (1920).djvu/25 , 15 4 Marriage as a Trade.djvu , 16 4 Armistice Day.djvu/469 , 17 4 Armistice Day.djvu/15 , 18 3 Hansard (UK) - Vol 566 No. 40 August 29th 2013.pdf/1 , 19 3 Du Faur - The Conquest of Mount Cook.djvu/9 , 20 3 Du Faur - The Conquest of Mount Cook.djvu/5 , 21 3 Piers Ploughman (Wright) , 22 3 Inside Canton.djvu/61 , 23 3 On the forfeiture of property by married women.djvu/20 , 24 3 Diaries of Court Ladies of Old Japan.djvu/250 , 25 3 Diaries of Court Ladies of Old Japan.djvu/238

set 2013: 1 5 Native Flowers of New Zealand.djvu/17 , 2 5 Native Flowers of New Zealand.djvu/19 , 3 5 Native Flowers of New Zealand.djvu/10 , 4 5 Notes on New Zealand (1892).pdf/7 , 5 5 Notes on New Zealand (1892).pdf , 6 5 First Voyage Round the World.djvu/343 , 7 4 Native Flowers of New Zealand.djvu/31 , 8 4 Native Flowers of New Zealand.djvu/187 , 9 4 Notes on New Zealand (1892).pdf/75 , 10 4 Native Flowers of New Zealand.djvu/207 , 11 4 Native Flowers of New Zealand.djvu/151 , 12 4 Native Flowers of New Zealand.djvu/23 , 13 4 Native Flowers of New Zealand.djvu/25 , 14 4 Native Flowers of New Zealand.djvu/12 , 15 4 Native Flowers of New Zealand.djvu/9 , 16 4 Native Flowers of New Zealand.djvu , 17 4 Notes on New Zealand (1892).pdf/13 , 18 4 Monier Monier-Williams , 19 4 First Voyage Round the World.djvu/305 , 20 4 Ian Charlton.ogg , 21 4 The history of yachting.djvu/420 , 22 4 The history of yachting.djvu/23 , 23 4 The history of yachting.djvu/275 , 24 4 The history of yachting.djvu/271 , 25 4 Arthur Hamilton Clark

out 2013: 1 4 Book Of Halloween(1919).djvu/9 , 2 4 Stabilizing the dollar, Fisher, 1920.djvu/174 , 3 4 Stabilizing the dollar, Fisher, 1920.djvu/173 , 4 4 Stabilizing the dollar, Fisher, 1920.djvu/166 , 5 4 Stabilizing the dollar, Fisher, 1920.djvu/163 , 6 4 Stabilizing the dollar, Fisher, 1920.djvu/159 , 7 4 Stabilizing the dollar, Fisher, 1920.djvu/127 , 8 4 Stabilizing the dollar, Fisher, 1920.djvu/122 , 9 4 Stabilizing the dollar, Fisher, 1920.djvu/120 , 10 4 Stabilizing the dollar, Fisher, 1920.djvu/119 , 11 4 Stabilizing the dollar, Fisher, 1920.djvu/117 , 12 4 Stabilizing the dollar, Fisher, 1920.djvu/177 , 13 4 Stabilizing the dollar, Fisher, 1920.djvu/208 , 14 4 Stabilizing the dollar, Fisher, 1920.djvu/199 , 15 4 Stabilizing the dollar, Fisher, 1920.djvu/193 , 16 4 Panama-past-present-Bishop.djvu/272 , 17 4 Panama-past-present-Bishop.djvu/135 , 18 4 Panama-past-present-Bishop.djvu/34 , 19 4 The Legend of Sleepy Hollow (1864) , 20 4 Australian enquiry book of household and general information.djvu/290 , 21 4 Stabilizing the dollar, Fisher, 1920.djvu/205 , 22 4 Stabilizing the dollar, Fisher, 1920.djvu/96 , 23 4 Armistice Day.djvu , 24 3 De re metallica (1912).djvu/154 , 25 3 Hakluytus Posthumus or Purchas His Pilgrimes Volume 12.djvu/38

nov 2013: 1 4 Wireless Networking in the Developing World , 2 3 Young Folks History Of Mexico.pdf/440 , 3 3 Dictionary of Slang, Jargon & Cant (1889) by Barrere & Leland.djvu/29 , 4 3 Dictionary of Slang, Jargon & Cant (1889) by Barrere & Leland.djvu , 5 3 Gitanjali/Introduction , 6 3 Breaking the Hindenburg Line.djvu/33 , 7 3 The Works of the Rev. Jonathan Swift, Volume 8.djvu/413 , 8 3 Breaking the Hindenburg Line.djvu/21 , 9 3 UKSI19810859.pdf/62 , 10 3 Doctor Syn - A Smuggler Tale of the Romney Marsh.djvu/9 , 11 3 Doctor Syn - A Smuggler Tale of the Romney Marsh.djvu/8 , 12 3 Young Folks History Of Mexico.pdf/397 , 13 3 Doctor Syn - A Smuggler Tale of the Romney Marsh.djvu/15 , 14 3 Young India Pamphlet, September 1919.djvu/2 , 15 3 Young India Pamphlet, September 1919.djvu/1 , 16 3 A page of American history (1905).djvu , 17 3 Mahatma Gandhi, his life, writings and speeches.djvu , 18 3 Du Faur - The Conquest of Mount Cook.djvu/282 , 19 3 Australian enquiry book of household and general information.djvu/174 , 20 3 Maurice George DelPratt correspondence - 10 September 1915 - 2811510v000r002.jpg , 21 3 Tolkappiyam/An introduction to Tolkappiyam , 22 3 Tolkappiyam/prologue , 23 3 The New Forest - its history and its scenery.djvu/144 , 24 3 The New Forest - its history and its scenery.djvu/137 , 25 3 William Forbes Spear

dez 2013: 1 6 How to Play Chess (Rogers).djvu/39 , 2 5 How to Play Chess (Rogers).djvu/117 , 3 5 How to Play Chess (Rogers).djvu/122 , 4 5 How to Play Chess (Rogers).djvu/120 , 5 5 How to Play Chess (Rogers).djvu/118 , 6 5 How to Play Chess (Rogers).djvu/131 , 7 5 How to Play Chess (Rogers).djvu/128 , 8 5 Christmascarol1843.djvu , 9 5 A Christmas Carol.djvu , 10 5 How to Play Chess (Rogers).djvu/94 , 11 5 How to Play Chess (Rogers).djvu/93 , 12 5 How to Play Chess (Rogers).djvu/87 , 13 5 How to Play Chess (Rogers).djvu/21 , 14 5 How to Play Chess (Rogers).djvu/19 , 15 5 How to Play Chess (Rogers).djvu , 16 5 Mexico of the Mexicans.djvu/11 , 17 4 Observations on the present financial embarassments.djvu , 18 4 How to Play Chess (Rogers).djvu/139 , 19 4 How to Play Chess (Rogers).djvu/156 , 20 4 How to Play Chess (Rogers).djvu/154 , 21 4 How to Play Chess (Rogers).djvu/152 , 22 4 How to Play Chess (Rogers).djvu/150 , 23 4 How to Play Chess (Rogers).djvu/140 , 24 4 How to Play Chess (Rogers).djvu/148 , 25 4 How to Play Chess (Rogers).djvu/146

jan 2014: 1 6 On the Pollution of the Rivers of the Kingdom.djvu/17 , 2 5 The Pinafore Picture Book.djvu/48 , 3 5 The Coffee Publichouse.djvu/15 , 4 5 The Ethics of Urban Leaseholds.djvu , 5 5 Canterbury Papers.djvu/30 , 6 5 On the Pollution of the Rivers of the Kingdom.djvu/22 , 7 5 On the Pollution of the Rivers of the Kingdom.djvu/58 , 8 5 On the Pollution of the Rivers of the Kingdom.djvu/14 , 9 5 On the Pollution of the Rivers of the Kingdom.djvu/13 , 10 4 Correspondence between the Warden of St Columba's College and the Primate of Armagh.djvu/17 , 11 4 Our Neighbor-Mexico.djvu/298 , 12 4 Correspondence between the Warden of St Columba's College and the Primate of Armagh.djvu/7 , 13 4 The first report, etc., of the Lichfield Society.djvu/29 , 14 4 The Coffee Publichouse.djvu/40 , 15 4 The first report, etc., of the Lichfield Society.djvu/5 , 16 4 The first report, etc., of the Lichfield Society.djvu/33 , 17 4 The Coffee Publichouse.djvu/14 , 18 4 Nurses for the sick.djvu , 19 4 Mr J. S. Mill on Personal Representation.djvu , 20 4 Notes on the Present and Future of the Archaeological Collections of the University of Oxford.djvu , 21 4 A Critical and Exegetical Commentary on Haggai, Zechariah, Malachi and Jonah.djvu/50 , 22 4 Canterbury Papers.djvu/40 , 23 4 Some New Philosophical Views.djvu/7 , 24 4 Canterbury Papers.djvu/29 , 25 4 Sketches of the History of the Church of Scotland.djvu/8

fev 2014: 1 12 Tales of John Oliver Hobbes.djvu/13 , 2 5 Tales of John Oliver Hobbes.djvu/363 , 3 4 Abner E. Woodruff , 4 4 Tales of John Oliver Hobbes.djvu/5 , 5 4 Tales of John Oliver Hobbes.djvu/332 , 6 4 Tales of John Oliver Hobbes.djvu/313 , 7 4 The Story of Peter Pan.djvu/18 , 8 4 Tales of John Oliver Hobbes.djvu/170 , 9 4 Tales of John Oliver Hobbes.djvu/168 , 10 4 Tales of John Oliver Hobbes.djvu/379 , 11 4 Tales of John Oliver Hobbes.djvu/371 , 12 4 Tales of John Oliver Hobbes.djvu/464 , 13 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/124 , 14 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/123 , 15 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/122 , 16 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/121 , 17 4 Tales of John Oliver Hobbes.djvu/458 , 18 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/89 , 19 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/79 , 20 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/78 , 21 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/64 , 22 4 1909. Is Shakespeare Dead? From My Autobiography.djvu/49 , 23 4 The Voyage Out.djvu/112 , 24 4 The Voyage Out.djvu/68 , 25 4 The Voyage Out.djvu/130

mar 2014: 1 6 Character of Renaissance Architecture.djvu/13 , 2 6 Character of Renaissance Architecture.djvu , 3 5 Taras Shevchenko , 4 5 Character of Renaissance Architecture.djvu/58 , 5 5 The Fate of Fenella (1892).djvu , 6 5 Heralds of God.djvu , 7 5 Embroidery and Fancy Work.djvu/228 , 8 5 Embroidery and Fancy Work.djvu/226 , 9 5 Embroidery and Fancy Work.djvu/218 , 10 5 Embroidery and Fancy Work.djvu/217 , 11 5 Embroidery and Fancy Work.djvu/215 , 12 5 Embroidery and Fancy Work.djvu/214 , 13 5 Embroidery and Fancy Work.djvu/213 , 14 5 Embroidery and Fancy Work.djvu/212 , 15 5 Embroidery and Fancy Work.djvu/211 , 16 5 Embroidery and Fancy Work.djvu/203 , 17 5 Embroidery and Fancy Work.djvu/196 , 18 5 Embroidery and Fancy Work.djvu/38 , 19 5 Embroidery and Fancy Work.djvu/37 , 20 5 Constitution of Ukraine , 21 5 Twelve Years a Slave , 22 5 The Indian Biographical Dictionary (1915) , 23 4 Character of Renaissance Architecture.djvu/129 , 24 4 Character of Renaissance Architecture.djvu/123 , 25 4 Character of Renaissance Architecture.djvu/121

abr 2014: 1 5 Pieces People Ask For.djvu/27 , 2 5 Pieces People Ask For.djvu/26 , 3 5 Pieces People Ask For.djvu/25 , 4 5 Pieces People Ask For.djvu/23 , 5 5 Pieces People Ask For.djvu/9 , 6 5 Pieces People Ask For.djvu , 7 4 Pieces People Ask For.djvu/178 , 8 4 Pieces People Ask For.djvu/63 , 9 4 Pieces People Ask For.djvu/60 , 10 4 Pieces People Ask For.djvu/56 , 11 4 Mexico, Aztec, Spanish and Republican, Vol 2.djvu/142 , 12 4 Pieces People Ask For.djvu/141 , 13 4 Pieces People Ask For.djvu/48 , 14 4 Pieces People Ask For.djvu/40 , 15 4 Pieces People Ask For.djvu/39 , 16 4 Pieces People Ask For.djvu/38 , 17 4 Pieces People Ask For.djvu/245 , 18 4 Pieces People Ask For.djvu/28 , 19 4 Pieces People Ask For.djvu/24 , 20 4 Pieces People Ask For.djvu/12 , 21 4 Pieces People Ask For.djvu/11 , 22 4 Pieces People Ask For.djvu/10 , 23 4 Pieces People Ask For.djvu/22 , 24 4 Pieces People Ask For.djvu/21 , 25 4 Pieces People Ask For.djvu/20

mai 2014: 1 7 Love among the chickens (1909).djvu , 2 4 Houses and House-Life of the American Aborigines.djvu/37 , 3 4 Woman Triumphant.djvu/183 , 4 4 Ermine Cowles Case , 5 4 Lake Ngami.djvu/504 , 6 4 Love among the chickens (1909).djvu/15 , 7 4 Lake Ngami.djvu/87 , 8 4 Lake Ngami.djvu/97 , 9 4 Lake Ngami.djvu/526 , 10 4 Lake Ngami.djvu/527 , 11 4 Lake Ngami.djvu/32 , 12 4 Lake Ngami.djvu/27 , 13 4 Lake Ngami.djvu/25 , 14 4 Lake Ngami.djvu/15 , 15 4 Lake Ngami.djvu , 16 3 The Rambler in Mexico.djvu/200 , 17 3 James Bryce American Commonwealth vol 1.djvu/8 , 18 3 Reflections on the Motive Power of Heat.djvu , 19 3 Savagetribesofformosa1926.djvu/2 , 20 3 Savagetribesofformosa1926.djvu/1 , 21 3 Aboriginesofvictoria01.djvu/83 , 22 3 Completepoetical1848sout.djvu , 23 3 Curiosities of Olden Times.djvu/11 , 24 3 Nye's History of the USA.djvu/109 , 25 3 Aboriginesofvictoria01.djvu/72

jun 2014: 1 6 My 1102 days of wwii.djvu , 2 5 The Botany of the Antarctic Voyage.djvu/42 , 3 4 Secrets of Crewe House.djvu/1 , 4 4 Secrets of Crewe House.djvu , 5 4 My 1102 days of wwii.djvu/31 , 6 4 My 1102 Days of W.W. II , 7 4 My 1102 days of wwii.djvu/3 , 8 4 The Botany of the Antarctic Voyage.djvu/59 , 9 4 The Botany of the Antarctic Voyage.djvu/28 , 10 4 The Botany of the Antarctic Voyage.djvu/25 , 11 4 Nye's History of the USA , 12 4 Savagetribesofformosa1926.djvu/17 , 13 4 Woman Triumphant.djvu , 14 4 Nye's History of the USA.djvu/16 , 15 4 Nye's History of the USA.djvu/15 , 16 4 Nye's History of the USA.djvu/14 , 17 4 Nye's History of the USA.djvu/13 , 18 3 Secrets of Crewe House.djvu/7 , 19 3 Charles Granville Bruce , 20 3 The Rover Boys on the Great Lakes.djvu/284 , 21 3 Twenty Years in the Himalaya/Nepal and Sikhim , 22 3 Twenty Years in the Himalaya/Preface , 23 3 The Rover Boys on the Great Lakes.djvu/275 , 24 3 The Rover Boys on the Great Lakes.djvu/274 , 25 3 The Rover Boys on the Great Lakes.djvu/273

jul 2014: 1 5 Eugenio Cruz Vargas , 2 5 Secrets of Crewe House.djvu/330 , 3 5 Secrets of Crewe House.djvu/329 , 4 4 Forth Bridge (1890).djvu/1 , 5 4 Pedro Nolasco Cruz Vergara , 6 4 Great Speeches of the War.djvu , 7 4 Secrets of Crewe House.djvu/332 , 8 4 Secrets of Crewe House.djvu/331 , 9 4 Secrets of Crewe House.djvu/260 , 10 4 Secrets of Crewe House.djvu/259 , 11 4 Secrets of Crewe House.djvu/193 , 12 4 Secrets of Crewe House.djvu/185 , 13 4 Secrets of Crewe House.djvu/30 , 14 4 Secrets of Crewe House.djvu/24 , 15 3 Forth Bridge (1890).djvu/7 , 16 3 The Chinese Boy and Girl.djvu/94 , 17 3 The Chinese Boy and Girl.djvu/95 , 18 3 The Chinese Boy and Girl.djvu/91 , 19 3 The Chinese Boy and Girl.djvu/90 , 20 3 The Chinese Boy and Girl.djvu/92 , 21 3 Forth Bridge (1890).djvu/5 , 22 3 Forth Bridge (1890).djvu , 23 3 Sermon at the Church Congress 1902.djvu/11 , 24 3 Sermon at the Church Congress 1902.djvu/5 , 25 3 Dinabandhu Mitra

ago 2014: 1 5 A Lady's Cruise in a French Man-of-War.djvu , 2 4 An Appeal in Favor of that Class of Americans Called Africans.djvu/191 , 3 4 A Lady's Cruise in a French Man-of-War.djvu/317 , 4 4 A La California.djvu , 5 4 A Lady's Cruise in a French Man-of-War.djvu/373 , 6 4 A Lady's Cruise in a French Man-of-War.djvu/369 , 7 4 A Lady's Cruise in a French Man-of-War.djvu/354 , 8 4 A Lady's Cruise in a French Man-of-War.djvu/318 , 9 4 A Lady's Cruise in a French Man-of-War.djvu/113 , 10 4 A Lady's Cruise in a French Man-of-War.djvu/151 , 11 4 A Lady's Cruise in a French Man-of-War.djvu/35 , 12 4 A Lady's Cruise in a French Man-of-War.djvu/25 , 13 4 A Lady's Cruise in a French Man-of-War.djvu/22 , 14 4 A Lady's Cruise in a French Man-of-War.djvu/21 , 15 4 A Lady's Cruise in a French Man-of-War.djvu/399 , 16 3 Repository of Arts, Series 1, Volume 01, 1809, January-June.djvu , 17 3 A La California.djvu/234 , 18 3 Atrocious Outrage on the Last Native Tasmanian (Grey River Argus reprint).djvu/1 , 19 3 An Appeal in Favor of that Class of Americans Called Africans.djvu/245 , 20 3 An Appeal in Favor of that Class of Americans Called Africans.djvu/232 , 21 3 A La California.djvu/211 , 22 3 A La California.djvu/159 , 23 3 Encyclopædia Britannica, Ninth Edition/Atella , 24 3 An Appeal in Favor of that Class of Americans Called Africans.djvu/204 , 25 3 Francis Whittemore Cragin

set 2014: 1 5 Mount Seir, Sinai and Western Palestine.djvu/96 , 2 5 A La California.djvu , 3 5 Assistant Secretary Abbot to Secretary Walcott on Goddard's Proposal (December 16 1916).jpg , 4 4 The Gall Wasp Genus Cynips.pdf/491 , 5 4 Mount Seir, Sinai and Western Palestine.djvu/238 , 6 4 Mount Seir, Sinai and Western Palestine.djvu/92 , 7 4 Mount Seir, Sinai and Western Palestine.djvu/62 , 8 4 Mount Seir, Sinai and Western Palestine.djvu/5 , 9 4 Mount Seir, Sinai and Western Palestine.djvu/29 , 10 4 Mount Seir, Sinai and Western Palestine.djvu/27 , 11 4 Mount Seir, Sinai and Western Palestine.djvu/25 , 12 4 Mount Seir, Sinai and Western Palestine.djvu/24 , 13 4 Mount Seir, Sinai and Western Palestine.djvu/23 , 14 4 Mount Seir, Sinai and Western Palestine.djvu/21 , 15 4 Mount Seir, Sinai and Western Palestine.djvu/20 , 16 4 Mount Seir, Sinai and Western Palestine.djvu , 17 4 Repository of Arts, Series 1, Volume 01, 1809, January-June.djvu/66 , 18 3 The New International Encyclopædia 1st ed. v. 02.djvu , 19 3 Transactions of the Natural History Society of Northumberland, Durham, and Newcastle-upon-Tyne (1867).djvu , 20 3 Memoirs of a Trait in the Character of George III.djvu , 21 3 Physical Geography of the Sea and its Meteorology.djvu/28 , 22 3 Collected Physical Papers.djvu/38 , 23 3 Charlotte Teller - The Cage (1907).djvu/11 , 24 3 The Botanist's Guide Through the Counties of Northumberland and Durham (Vol 1).djvu/194 , 25 3 Nature and Origin of the Noun Genders of the Indo-European Languages.djvu/38

out 2014: 1 6 The Development of Navies During the Last Half-Century.djvu/17 , 2 6 The Development of Navies During the Last Half-Century.djvu/16 , 3 6 Who's for the Game? , 4 5 Jimmy Wales Speaks at Closing Ceremony of Wikimania 2014 , 5 5 The Development of Navies During the Last Half-Century , 6 5 The Development of Navies During the Last Half-Century.djvu/343 , 7 5 The Development of Navies During the Last Half-Century.djvu/320 , 8 5 The Development of Navies During the Last Half-Century.djvu/294 , 9 5 The Development of Navies During the Last Half-Century.djvu/233 , 10 5 The Development of Navies During the Last Half-Century.djvu/213 , 11 5 The Development of Navies During the Last Half-Century.djvu/208 , 12 5 The Development of Navies During the Last Half-Century.djvu/176 , 13 5 The Development of Navies During the Last Half-Century.djvu/21 , 14 5 The Development of Navies During the Last Half-Century.djvu/351 , 15 5 The Development of Navies During the Last Half-Century.djvu/18 , 16 5 The Development of Navies During the Last Half-Century.djvu/15 , 17 5 The Development of Navies During the Last Half-Century.djvu , 18 4 The Development of Navies During the Last Half-Century.djvu/345 , 19 4 The Development of Navies During the Last Half-Century.djvu/344 , 20 4 The Development of Navies During the Last Half-Century.djvu/342 , 21 4 The Development of Navies During the Last Half-Century.djvu/330 , 22 4 The Development of Navies During the Last Half-Century.djvu/255 , 23 4 The Development of Navies During the Last Half-Century.djvu/217 , 24 4 The Development of Navies During the Last Half-Century.djvu/216 , 25 4 The Development of Navies During the Last Half-Century.djvu/215

nov 2014: 1 4 A history of Hungarian literature.djvu/44 , 2 4 The Tsar's Window.djvu/9 , 3 4 The Tsar's Window.djvu/8 , 4 4 The Tsar's Window.djvu/11 , 5 4 The Tsar's Window.djvu , 6 4 The complete poetical works of Percy Bysshe Shelley, including materials never before printed in any edition of the poems.djvu/784 , 7 4 The Story of Mexico.djvu/347 , 8 4 The Story of Mexico.djvu/335 , 9 4 The Story of Mexico.djvu/325 , 10 4 The Story of Mexico.djvu/321 , 11 4 The Story of Mexico.djvu/301 , 12 4 The Story of Mexico.djvu/271 , 13 4 The Story of Mexico.djvu/237 , 14 4 The Story of Mexico.djvu/233 , 15 4 The Story of Mexico.djvu/219 , 16 4 The Story of Mexico.djvu/201 , 17 4 The Story of Mexico.djvu/145 , 18 4 Aboriginesofvictoria01.djvu/536 , 19 4 The Tsar's Window , 20 3 EB1911 - Volume 03.djvu/418 , 21 3 Stephen MacKenna , 22 3 CONJUGIAL LOVE.djvu , 23 3 Simplified grammar of the Hungarian language.djvu/13 , 24 3 The rise and fall of the Emperor Maximilian.djvu/265 , 25 3 Émile de Kératry

dez 2014: 1 5 Athletics and Manly Sport (1890).djvu/211 , 2 5 America's National Game (1911).djvu/184 , 3 5 America's National Game (1911).djvu/84 , 4 5 America's National Game (1911).djvu , 5 4 Athletics and Manly Sport (1890).djvu/216 , 6 4 America's National Game (1911).djvu/484 , 7 4 America's National Game (1911).djvu/47 , 8 4 Asoka - the Buddhist Emperor of India.djvu , 9 4 America's National Game (1911).djvu/92 , 10 4 America's National Game (1911).djvu/88 , 11 4 America's National Game (1911).djvu/66 , 12 4 The evolution of worlds - Lowell.djvu/292 , 13 4 A Letter from Santa Claus , 14 3 A short history of astronomy(1898).djvu/434 , 15 3 EB1911 - Volume 01.djvu/187 , 16 3 Athletics and Manly Sport (1890).djvu/191 , 17 3 Athletics and Manly Sport (1890).djvu/190 , 18 3 Athletics and Manly Sport (1890).djvu/189 , 19 3 Athletics and Manly Sport (1890).djvu/188 , 20 3 Athletics and Manly Sport (1890).djvu/233 , 21 3 Athletics and Manly Sport (1890).djvu/234 , 22 3 Athletics and Manly Sport (1890).djvu/226 , 23 3 Athletics and Manly Sport (1890).djvu/224 , 24 3 Athletics and Manly Sport (1890).djvu/223 , 25 3 Athletics and Manly Sport (1890).djvu/221

jan 2015: 1 7 The Under-Ground Railroad.djvu , 2 6 Life Story of an Otter.djvu/23 , 3 5 The Tales of a Traveller.djvu/13 , 4 5 Our Sister Republic - Mexico.djvu , 5 4 Rajmohan's Wife.djvu/1 , 6 4 The Under-Ground Railroad.djvu/23 , 7 4 The Under-Ground Railroad.djvu/1 , 8 4 Barack Obama's Seventh State of the Union Address , 9 4 Goliad Declaration of Independence.djvu , 10 4 The Tales of a Traveller.djvu/97 , 11 4 The Tales of a Traveller.djvu/89 , 12 4 The Tales of a Traveller.djvu/72 , 13 4 The Tales of a Traveller.djvu/30 , 14 4 The Tales of a Traveller.djvu/27 , 15 4 The Tales of a Traveller.djvu/20 , 16 4 Child-life in Japan and Japanese child stories (Ayrton, Matilida Chaplin. , 1901).djvu , 17 4 Life Story of an Otter.djvu/223 , 18 4 Life Story of an Otter.djvu , 19 3 Problem (Emerson) , 20 3 Rosemary and Pansies.djvu/31 , 21 3 Old and New London, vol. 1.djvu , 22 3 The Under-Ground Railroad.djvu/162 , 23 3 The Under-Ground Railroad.djvu/161 , 24 3 The Under-Ground Railroad.djvu/131 , 25 3 The Under-Ground Railroad.djvu/67

fev 2015: 1 5 Kopal-Kundala.djvu/98 , 2 5 Kopal-Kundala.djvu/7 , 3 5 Islam, Turkey, and Armenia, and How They Happened.djvu/15 , 4 4 The New Method of Inoculating for the Small-Pox , 5 4 Eddington A. Space Time and Gravitation. 1920.djvu , 6 4 Kopal-Kundala.djvu/82 , 7 4 Kopal-Kundala.djvu/227 , 8 4 Kopal-Kundala.djvu/219 , 9 4 Kopal-Kundala.djvu/217 , 10 4 Kopal-Kundala.djvu/214 , 11 4 Kopal-Kundala.djvu/213 , 12 4 Kopal-Kundala.djvu/207 , 13 4 Kopal-Kundala.djvu/202 , 14 4 Kopal-Kundala.djvu/198 , 15 4 Kopal-Kundala.djvu/200 , 16 4 Kopal-Kundala.djvu/199 , 17 4 Kopal-Kundala.djvu/188 , 18 4 Kopal-Kundala.djvu/183 , 19 4 Kopal-Kundala.djvu/181 , 20 4 Kopal-Kundala.djvu/178 , 21 4 Kopal-Kundala.djvu/177 , 22 4 Kopal-Kundala.djvu/173 , 23 4 Kopal-Kundala.djvu/159 , 24 4 Kopal-Kundala.djvu/154 , 25 4 Kopal-Kundala.djvu/150

mar 2015: 1 7 Great Neapolitan Earthquake of 1857.djvu/52 , 2 6 Popular Science Monthly Volume 29.djvu/540 , 3 6 Great Neapolitan Earthquake of 1857.djvu/533 , 4 6 Great Neapolitan Earthquake of 1857.djvu/109 , 5 6 Great Neapolitan Earthquake of 1857.djvu/103 , 6 6 Great Neapolitan Earthquake of 1857.djvu/73 , 7 5 Investigation of the Ferguson Police Department.djvu/2 , 8 5 Great Neapolitan Earthquake of 1857.djvu/535 , 9 5 Great Neapolitan Earthquake of 1857.djvu/532 , 10 5 Great Neapolitan Earthquake of 1857.djvu/163 , 11 5 Great Neapolitan Earthquake of 1857.djvu/162 , 12 5 Great Neapolitan Earthquake of 1857.djvu/149 , 13 5 Great Neapolitan Earthquake of 1857.djvu/108 , 14 5 Great Neapolitan Earthquake of 1857.djvu/107 , 15 5 Great Neapolitan Earthquake of 1857.djvu/105 , 16 5 Great Neapolitan Earthquake of 1857.djvu/104 , 17 5 Great Neapolitan Earthquake of 1857.djvu/102 , 18 5 Great Neapolitan Earthquake of 1857.djvu/101 , 19 5 Great Neapolitan Earthquake of 1857.djvu/54 , 20 5 Great Neapolitan Earthquake of 1857.djvu/34 , 21 5 Great Neapolitan Earthquake of 1857.djvu/29 , 22 4 Harrie Irving Hancock , 23 4 President Obama Delivers Remarks on the 50th Anniversary of the Selma Marches , 24 4 Henry Rosher James , 25 4 Investigation of the Ferguson Police Department.djvu/50

abr 2015: 1 6 Queen Mab (Shelley).djvu/32 , 2 6 Queen Mab (Shelley).djvu/48 , 3 5 Queen Mab (Shelley).djvu/145 , 4 5 Queen Mab (Shelley).djvu/144 , 5 5 Queen Mab (Shelley).djvu/143 , 6 5 Queen Mab (Shelley).djvu/142 , 7 5 Queen Mab (Shelley).djvu/139 , 8 5 Queen Mab (Shelley).djvu/138 , 9 5 Queen Mab (Shelley).djvu/107 , 10 5 Queen Mab (Shelley).djvu/31 , 11 5 Queen Mab (Shelley).djvu/137 , 12 5 Queen Mab (Shelley).djvu/28 , 13 5 Queen Mab (Shelley).djvu/20 , 14 5 Queen Mab (Shelley).djvu/34 , 15 5 Queen Mab (Shelley).djvu/112 , 16 5 Queen Mab (Shelley).djvu/9 , 17 4 The Black Heralds , 18 4 John Harvey Lovell , 19 4 Ancient Ballads and Legends of Hindustan.djvu/143 , 20 4 Ancient Ballads and Legends of Hindustan.djvu/145 , 21 4 Ancient Ballads and Legends of Hindustan.djvu/146 , 22 4 Ancient Ballads and Legends of Hindustan.djvu/147 , 23 4 Ancient Ballads and Legends of Hindustan.djvu/148 , 24 4 Ancient Ballads and Legends of Hindustan.djvu/149 , 25 4 Ancient Ballads and Legends of Hindustan.djvu/150

mai 2015: 1 7 Provincial geographies of India (Volume 4).djvu/48 , 2 7 Provincial geographies of India (Volume 4).djvu/40 , 3 6 Provincial geographies of India (Volume 4).djvu/29 , 4 6 Journal of a Voyage to Greenland, in the Year 1821.djvu/114 , 5 6 Journal of a Voyage to Greenland, in the Year 1821.djvu/86 , 6 5 Provincial geographies of India (Volume 4).djvu/145 , 7 5 Provincial geographies of India (Volume 4).djvu/62 , 8 5 Provincial geographies of India (Volume 4).djvu/52 , 9 5 Provincial geographies of India (Volume 4).djvu/44 , 10 5 Provincial geographies of India (Volume 4).djvu/42 , 11 5 Provincial geographies of India (Volume 4).djvu/13 , 12 5 Provincial geographies of India (Volume 4).djvu/22 , 13 5 Provincial geographies of India (Volume 4).djvu/46 , 14 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/272 , 15 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/270 , 16 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/269 , 17 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/268 , 18 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/265 , 19 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/230 , 20 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/227 , 21 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/224 , 22 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/219 , 23 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/103 , 24 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/88 , 25 5 Journal of a Voyage to Greenland, in the Year 1821.djvu/82

jun 2015: 1 5 Descent of Man 1875.djvu/479 , 2 5 Descent of Man 1875.djvu/389 , 3 5 Descent of Man 1875.djvu/381 , 4 5 Descent of Man 1875.djvu/377 , 5 5 Descent of Man 1875.djvu/516 , 6 5 Descent of Man 1875.djvu/349 , 7 5 Descent of Man 1875.djvu/566 , 8 5 Descent of Man 1875.djvu/393 , 9 5 Descent of Man 1875.djvu/350 , 10 4 The Philadelphia Times/1879/Lottery Agents Arrested , 11 4 The Native Religions of Mexico and Peru , 12 4 Descent of Man 1875.djvu/541 , 13 4 Descent of Man 1875.djvu/507 , 14 4 Descent of Man 1875.djvu/469 , 15 4 Descent of Man 1875.djvu/455 , 16 4 Descent of Man 1875.djvu/453 , 17 4 Descent of Man 1875.djvu/451 , 18 4 Descent of Man 1875.djvu/413 , 19 4 Descent of Man 1875.djvu/395 , 20 4 Descent of Man 1875.djvu/528 , 21 4 Descent of Man 1875.djvu/420 , 22 4 Descent of Man 1875.djvu/404 , 23 4 Descent of Man 1875.djvu/402 , 24 4 Descent of Man 1875.djvu/400 , 25 4 Descent of Man 1875.djvu/394

jul 2015: 1 5 Zhuang Zi - translation Giles 1889.djvu/68 , 2 4 Jewish Encyclopedia Volume 1.pdf , 3 4 The Amateur Cracksman/A Costume Piece , 4 4 Cihm12428.djvu/37 , 5 4 Zhuang Zi - translation Giles 1889.djvu/470 , 6 4 Zhuang Zi - translation Giles 1889.djvu/459 , 7 4 Zhuang Zi - translation Giles 1889.djvu/449 , 8 4 Zhuang Zi - translation Giles 1889.djvu/358 , 9 4 Zhuang Zi - translation Giles 1889.djvu/357 , 10 4 Zhuang Zi - translation Giles 1889.djvu/306 , 11 4 Zhuang Zi - translation Giles 1889.djvu/302 , 12 4 Zhuang Zi - translation Giles 1889.djvu/292 , 13 4 Zhuang Zi - translation Giles 1889.djvu/283 , 14 4 Zhuang Zi - translation Giles 1889.djvu/270 , 15 4 Zhuang Zi - translation Giles 1889.djvu/229 , 16 4 Zhuang Zi - translation Giles 1889.djvu/179 , 17 4 Zhuang Zi - translation Giles 1889.djvu/174 , 18 4 Zhuang Zi - translation Giles 1889.djvu/173 , 19 4 Zhuang Zi - translation Giles 1889.djvu/84 , 20 4 Zhuang Zi - translation Giles 1889.djvu/21 , 21 3 José Maria de Eça de Queirós , 22 3 HKFactSheet Tourism 082011.pdf , 23 3 HKFactSheet DistrictAdministration 042015.pdf , 24 3 HKFactSheet CreativeIndustries 122014.pdf , 25 3 Congressional Record Volume 81 Part 3.djvu

ago 2015: 1 7 Parsons How to Know the Ferns 7th ed.djvu/158 , 2 6 Parsons How to Know the Ferns 7th ed.djvu/134 , 3 6 Parsons How to Know the Ferns 7th ed.djvu/133 , 4 6 Parsons How to Know the Ferns 7th ed.djvu/126 , 5 6 Parsons How to Know the Ferns 7th ed.djvu/101 , 6 6 Parsons How to Know the Ferns 7th ed.djvu/80 , 7 5 Parsons How to Know the Ferns 7th ed.djvu/182 , 8 5 Parsons How to Know the Ferns 7th ed.djvu/176 , 9 5 Parsons How to Know the Ferns 7th ed.djvu/174 , 10 5 Parsons How to Know the Ferns 7th ed.djvu/164 , 11 5 Parsons How to Know the Ferns 7th ed.djvu/161 , 12 5 Parsons How to Know the Ferns 7th ed.djvu/156 , 13 5 Parsons How to Know the Ferns 7th ed.djvu/152 , 14 5 Parsons How to Know the Ferns 7th ed.djvu/149 , 15 5 Parsons How to Know the Ferns 7th ed.djvu/142 , 16 5 Parsons How to Know the Ferns 7th ed.djvu/141 , 17 5 Parsons How to Know the Ferns 7th ed.djvu/140 , 18 5 Parsons How to Know the Ferns 7th ed.djvu/138 , 19 5 Parsons How to Know the Ferns 7th ed.djvu/136 , 20 5 Parsons How to Know the Ferns 7th ed.djvu/125 , 21 5 Parsons How to Know the Ferns 7th ed.djvu/123 , 22 5 Parsons How to Know the Ferns 7th ed.djvu/100 , 23 5 Parsons How to Know the Ferns 7th ed.djvu/89 , 24 5 Parsons How to Know the Ferns 7th ed.djvu/86 , 25 5 Parsons How to Know the Ferns 7th ed.djvu/82

set 2015: 1 5 My Climbs in the Alps and Caucasus (1908).djvu/12 , 2 5 My Climbs in the Alps and Caucasus (1908).djvu/11 , 3 5 Law Enforcement Officers Killed and Assaulted, 2002.djvu/18 , 4 4 Chitra - Rabindranath Tagore.djvu , 5 4 My Climbs in the Alps and Caucasus (1908).djvu/2 , 6 4 My Climbs in the Alps and Caucasus (1908).djvu , 7 4 Frank Richard Stockton , 8 4 Florence Nightingale , 9 3 A history of the gunpowder plot-The conspiracy and its agents (1904).djvu/13 , 10 3 The story of geographical discovery.djvu , 11 3 Cassell's Illustrated History of England vol 1.djvu/208 , 12 3 Cassell's Illustrated History of England vol 1.djvu/206 , 13 3 Cassell's Illustrated History of England vol 1.djvu/204 , 14 3 Cassell's Illustrated History of England vol 1.djvu/202 , 15 3 Cassell's Illustrated History of England vol 1.djvu/198 , 16 3 Cassell's Illustrated History of England vol 1.djvu/197 , 17 3 The Red Man and the White Man in North America.djvu/643 , 18 3 We Stand with Ahmed - and We Hope He'll Join Us for Astronomy Night , 19 3 2015-09-16 White House Press Briefing on student Ahmed Mohamed , 20 3 Bianca, or, The Young Spanish Maiden (Toru Dutt).djvu/3 , 21 3 The Black Arrow - Stevenson, 1888.djvu/323 , 22 3 Stevenson - The Wrecker (1892).djvu , 23 3 The Real Thing (New York & London, Macmillan & Co., 1893).djvu/291 , 24 3 Dickens - Edwin Drood (Chapman and Hall, 1870).djvu/22 , 25 3 The Real Thing (New York & London, Macmillan & Co., 1893).djvu/101

out 2015: 1 5 Somerville On the Magnetizing Power of the More Refrangible Solar Rays.djvu/1 , 2 5 Somerville Mechanism of the heavens.djvu/14 , 3 5 Somerville Mechanism of the heavens.djvu/33 , 4 5 Somerville Mechanism of the heavens.djvu/29 , 5 5 Somerville Mechanism of the heavens.djvu/21 , 6 5 Moll Flanders (1906 edition).djvu , 7 4 William Blake (Chesterton).djvu/51 , 8 4 Somerville On the Magnetizing Power of the More Refrangible Solar Rays.djvu/6 , 9 4 Somerville Mechanism of the heavens.djvu/28 , 10 4 Somerville On the Magnetizing Power of the More Refrangible Solar Rays.djvu/4 , 11 4 Somerville Mechanism of the heavens.djvu/32 , 12 4 Somerville Mechanism of the heavens.djvu/20 , 13 4 Somerville Mechanism of the heavens.djvu/30 , 14 4 Somerville Mechanism of the heavens.djvu/24 , 15 4 Somerville Mechanism of the heavens.djvu/12 , 16 4 Somerville Mechanism of the heavens.djvu/27 , 17 4 Somerville Mechanism of the heavens.djvu/25 , 18 4 Somerville Mechanism of the heavens.djvu/17 , 19 4 As others saw Him.djvu/22 , 20 4 Poems by Robert Louis Stevenson, Hitherto unpublished, 1921.djvu/14 , 21 4 Moll Flanders (1906 edition).djvu/192 , 22 4 Moll Flanders (1906 edition).djvu/311 , 23 4 Moll Flanders (1906 edition).djvu/377 , 24 4 Moll Flanders (1906 edition).djvu/440 , 25 4 Moll Flanders (1906 edition).djvu/143

nov 2015: 1 4 Trans-Pacific Partnership Agreement , 2 3 Gospel of Buddha.djvu/33 , 3 3 History of Barrington, Rhode Island (Bicknell).djvu/23 , 4 3 An Index of Prohibited Books (1840).djvu , 5 3 Essays in miniature.djvu/148 , 6 3 Anecdotes and character of Senesino (from ''The Westminster Magazine'' 1777) , 7 3 History of Barrington, Rhode Island (Bicknell).djvu/9 , 8 3 History of Barrington, Rhode Island (Bicknell).djvu , 9 3 Woman — Her Charm and Power.djvu , 10 3 In a winter city, by Ouida.djvu , 11 3 Held in Bondage.djvu , 12 3 John Pendleton Kennedy , 13 3 Life among the Apaches.djvu/203 , 14 3 Life among the Apaches.djvu/304 , 15 3 Gospel of Buddha.djvu , 16 3 EB1911 - Volume 26.djvu , 17 3 Macfadden's Fasting, Hydropathy and Exercise.djvu/16 , 18 3 Douglas E. Fetters , 19 3 Biagi - The Centaurians.djvu , 20 3 The Story and Song of Black Roderick.djvu , 21 3 The Works of the Rev. Jonathan Swift, Volume 6.djvu/66 , 22 3 Frank Richard Stockton , 23 3 George Stephens (1813-1895) , 24 3 Roman Manchester (1900) by Charles Roeder.djvu/111 , 25 3 Roman Manchester (1900) by Charles Roeder.djvu/75

dez 2015: 1 7 Various Forces of Matter.djvu/60 , 2 7 Various Forces of Matter.djvu/58 , 3 6 Various Forces of Matter.djvu/97 , 4 6 Various Forces of Matter.djvu/49 , 5 6 Various Forces of Matter.djvu/64 , 6 6 Various Forces of Matter.djvu/63 , 7 6 Various Forces of Matter.djvu/25 , 8 6 A Voyage in Space (1913).djvu/267 , 9 6 A Voyage in Space (1913).djvu/253 , 10 6 The chemical history of a candle.djvu/92 , 11 6 The chemical history of a candle.djvu/15 , 12 5 Various Forces of Matter.djvu/130 , 13 5 Various Forces of Matter.djvu/125 , 14 5 Various Forces of Matter.djvu/180 , 15 5 Various Forces of Matter.djvu/122 , 16 5 Various Forces of Matter.djvu/169 , 17 5 Various Forces of Matter.djvu/164 , 18 5 Various Forces of Matter.djvu/157 , 19 5 Various Forces of Matter.djvu/156 , 20 5 Various Forces of Matter.djvu/147 , 21 5 Various Forces of Matter.djvu/67 , 22 5 Various Forces of Matter.djvu/61 , 23 5 Various Forces of Matter.djvu/37 , 24 5 Various Forces of Matter.djvu/36 , 25 5 Various Forces of Matter.djvu/35

jan 2016: 1 5 Barack Obama's Eighth State of the Union Address , 2 5 The Comic English Grammar.djvu/85 , 3 5 The Comic English Grammar.djvu/83 , 4 5 The Comic English Grammar.djvu/55 , 5 5 The Comic English Grammar.djvu/52 , 6 5 The Comic English Grammar.djvu/47 , 7 5 The Comic English Grammar.djvu/46 , 8 5 The Comic English Grammar.djvu/33 , 9 5 The Comic English Grammar.djvu/27 , 10 5 The Comic English Grammar.djvu/19 , 11 5 The Comic English Grammar.djvu/13 , 12 5 The Comic English Grammar.djvu/10 , 13 5 The Comic English Grammar.djvu/9 , 14 5 The Comic English Grammar.djvu/16 , 15 5 The Comic English Grammar.djvu/11 , 16 5 The Comic English Grammar.djvu/12 , 17 5 Wikimedia UK gov review rpt v5.djvu/32 , 18 5 The Kiss and its History.djvu , 19 4 Fountains Abbey.djvu/80 , 20 4 Fountains Abbey.djvu/77 , 21 4 Fountains Abbey.djvu/104 , 22 4 Fountains Abbey.djvu/61 , 23 4 Fountains Abbey.djvu/57 , 24 4 Fountains Abbey.djvu/76 , 25 4 The Comic English Grammar.djvu/141

fev 2016: 1 5 Hunger (Hamsun).djvu/17 , 2 4 Radio-active substances.djvu/9 , 3 4 Panchatantra.djvu/184 , 4 4 The madman, his parables and poems , 5 4 The madman, his parables and poems.djvu , 6 4 Panchatantra.djvu/50 , 7 4 Panchatantra.djvu/49 , 8 4 Hunger (Hamsun).djvu/273 , 9 4 Hunger (Hamsun).djvu/266 , 10 4 Hunger (Hamsun).djvu/265 , 11 4 Hunger (Hamsun).djvu/262 , 12 4 Hunger (Hamsun).djvu/197 , 13 4 Hunger (Hamsun).djvu/195 , 14 4 Hunger (Hamsun).djvu/194 , 15 4 Hunger (Hamsun).djvu/193 , 16 4 Hunger (Hamsun).djvu/244 , 17 4 Hunger (Hamsun).djvu/133 , 18 4 Hunger (Hamsun).djvu/120 , 19 4 Hunger (Hamsun).djvu/30 , 20 4 Hunger (Hamsun).djvu/28 , 21 4 Hunger (Hamsun).djvu/18 , 22 4 Hunger (Hamsun).djvu , 23 4 Panchatantra.djvu/42 , 24 4 Panchatantra.djvu/2 , 25 4 Kahlil Gibran

mar 2016: 1 4 The Name Lucifer.djvu , 2 4 Wives of the prime ministers, 1844-1906.djvu/229 , 3 4 Wives of the prime ministers, 1844-1906.djvu/228 , 4 4 Wives of the prime ministers, 1844-1906.djvu/227 , 5 4 Wives of the prime ministers, 1844-1906.djvu/238 , 6 4 Wives of the prime ministers, 1844-1906.djvu/186 , 7 4 Wives of the prime ministers, 1844-1906.djvu/185 , 8 4 The Cricket Field (1854).djvu/134 , 9 4 Radio-active substances.djvu/49 , 10 4 Wives of the prime ministers, 1844-1906.djvu , 11 4 Public Records Scotland Act 1809 (Ukpga 18090042 en).pdf/1 , 12 4 Popular Science Monthly Volume 17.djvu/9 , 13 3 Sir Thomas Browne's works, volume 3 (1835).djvu/509 , 14 3 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu , 15 3 Darwin Journal of Researches.djvu/442 , 16 3 An Easter Sermon , 17 3 Vyavasthá-Darpana.djvu , 18 3 Lettersconcerni01conggoog.djvu/145 , 19 3 A. V. W. Jackson , 20 3 The Name Lucifer.djvu/4 , 21 3 The Name Lucifer.djvu/3 , 22 3 Maurice Gustave Hansen , 23 3 Wives of the prime ministers, 1844-1906.djvu/290 , 24 3 Wives of the prime ministers, 1844-1906.djvu/289 , 25 3 Wives of the prime ministers, 1844-1906.djvu/247

abr 2016: 1 6 Poets of John Company.djvu/135 , 2 6 Poets of John Company.djvu/134 , 3 6 Poems, Alan Seeger, 1916.djvu/11 , 4 6 Poems, Alan Seeger, 1916.djvu/153 , 5 5 Poets of John Company.djvu/152 , 6 5 Poets of John Company.djvu/149 , 7 5 Poets of John Company.djvu/148 , 8 5 Poets of John Company.djvu/147 , 9 5 Poets of John Company.djvu/145 , 10 5 Poets of John Company.djvu/144 , 11 5 Poets of John Company.djvu/142 , 12 5 Poets of John Company.djvu/141 , 13 5 Poets of John Company.djvu/139 , 14 5 Poets of John Company.djvu/138 , 15 5 Poets of John Company.djvu/137 , 16 5 Poets of John Company.djvu/136 , 17 5 Poets of John Company.djvu/133 , 18 5 Poets of John Company.djvu/132 , 19 5 Poets of John Company.djvu/11 , 20 5 Poets of John Company.djvu/9 , 21 5 Poets of John Company.djvu/67 , 22 5 Poems, Alan Seeger, 1916.djvu/10 , 23 5 Poems, Alan Seeger, 1916.djvu/9 , 24 5 Poems, Alan Seeger, 1916.djvu/8 , 25 5 Poems, Alan Seeger, 1916.djvu/25

mai 2016: 1 6 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/209 , 2 6 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/208 , 3 6 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/169 , 4 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/3 , 5 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/125 , 6 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/173 , 7 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/141 , 8 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/138 , 9 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/128 , 10 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/160 , 11 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/140 , 12 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/159 , 13 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/139 , 14 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/71 , 15 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/70 , 16 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/69 , 17 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/99 , 18 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/54 , 19 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/32 , 20 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/85 , 21 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/228 , 22 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/227 , 23 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/222 , 24 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/5 , 25 5 Report of a Tour Through the Bengal Provinces of Patna, Gaya, Mongir and Bhagalpur; The Santal Parganas, Manbhum, Singhbhum and Birbhum; Bankura, Raniganj, Bardwan and Hughli in 1872-73.djvu/75

jun 2016: 1 6 Isvar Chandra Vidyasagar, a story of his life and work.djvu/77 , 2 5 Isvar Chandra Vidyasagar, a story of his life and work.djvu/443 , 3 5 Isvar Chandra Vidyasagar, a story of his life and work.djvu/114 , 4 5 Isvar Chandra Vidyasagar, a story of his life and work.djvu/46 , 5 5 Isvar Chandra Vidyasagar, a story of his life and work.djvu/4 , 6 5 Isvar Chandra Vidyasagar, a story of his life and work.djvu/40 , 7 5 Isvar Chandra Vidyasagar, a story of his life and work.djvu/39 , 8 4 Bible (Douay Rheims NT, 1582).djvu , 9 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/312 , 10 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/691 , 11 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/269 , 12 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/251 , 13 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/614 , 14 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/313 , 15 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/248 , 16 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/179 , 17 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/178 , 18 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/264 , 19 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/442 , 20 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/150 , 21 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/148 , 22 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/137 , 23 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/106 , 24 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/102 , 25 4 Isvar Chandra Vidyasagar, a story of his life and work.djvu/98

jul 2016: 1 6 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/19 , 2 5 A-Kentucky-Woman-Dec1892-NationalBulletin.jpg , 3 5 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/16 , 4 5 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/17 , 5 5 How to Keep Bees.djvu/39 , 6 5 How to Keep Bees.djvu , 7 4 Mayan legends , 8 4 Costumes of the Canary Islands , 9 4 Sixteen years of an artist's life in Morocco, Spain and the Canary Islands.djvu/9 , 10 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/26 , 11 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/22 , 12 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/21 , 13 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/20 , 14 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/137 , 15 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/88 , 16 4 The Production of Security.pdf/4 , 17 4 The Production of Security.pdf/2 , 18 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/18 , 19 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/58 , 20 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/10 , 21 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/9 , 22 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/15 , 23 4 The Report of the Iraq Inquiry - Executive Summary.pdf/25 , 24 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/47 , 25 4 How to Keep Bees.djvu/275

ago 2016: 1 4 The Mythology of the Aryan Nations.djvu/39 , 2 4 The Mythology of the Aryan Nations.djvu/5 , 3 4 John Morrison Davidson , 4 4 Whalley 1822 A vindication of the University of Edinburgh .djvu/3 , 5 4 Whalley 1822 A vindication of the University of Edinburgh .djvu/14 , 6 4 Whalley 1822 A vindication of the University of Edinburgh .djvu/32 , 7 4 Whalley 1822 A vindication of the University of Edinburgh .djvu/29 , 8 4 Whalley 1822 A vindication of the University of Edinburgh .djvu/28 , 9 4 The Fauna of British India, including Ceylon and Burma (Birds Vol 1).djvu/54 , 10 4 Cassell's Illustrated History of England vol 2.djvu/327 , 11 3 Cassell's Illustrated History of England vol 2.djvu/339 , 12 3 Cassell's Illustrated History of England vol 2.djvu/407 , 13 3 Cassell's Illustrated History of England vol 2.djvu/295 , 14 3 Post - Uncle Abner (Appleton, 1918).djvu/118 , 15 3 Cassell's Illustrated History of England vol 2.djvu/286 , 16 3 Cassell's Illustrated History of England vol 2.djvu/283 , 17 3 Cassell's Illustrated History of England vol 2.djvu/282 , 18 3 Cassell's Illustrated History of England vol 2.djvu/281 , 19 3 Cassell's Illustrated History of England vol 2.djvu/277 , 20 3 Cassell's Illustrated History of England vol 2.djvu/275 , 21 3 The Autobiography of Maharshi Devendranath Tagore.djvu/8 , 22 3 Cassell's Illustrated History of England vol 2.djvu/265 , 23 3 Cassell's Illustrated History of England vol 3.djvu/40 , 24 3 Manabendranath Roy , 25 3 Ramaprasad Chanda

set 2016: 1 5 Plutarch - Moralia, translator Holland, 1911.djvu , 2 5 Strange Case of Dr Jekyll and Mr Hyde , 3 4 MrsTittlemouse.djvu , 4 4 Cecilyparsleysnu00pott.djvu , 5 4 Taleofjemimapudd00pottiala.djvu , 6 4 Taleoftimmytipto00bea 4uf.djvu , 7 4 Beatrix Potter - The Tailor of Gloucester.djvu , 8 4 Peter Rabbit 1901.djvu/23 , 9 4 Plutarch - Moralia, translator Holland, 1911.djvu/18 , 10 4 Plutarch - Moralia, translator Holland, 1911.djvu/59 , 11 4 The Tale of Pigling Bland.pdf , 12 4 Constitution of Afghanistan , 13 3 GingerAndPickles.djvu/64 , 14 3 GingerAndPickles.djvu/62 , 15 3 GingerAndPickles.djvu/58 , 16 3 GingerAndPickles.djvu/56 , 17 3 GingerAndPickles.djvu/55 , 18 3 GingerAndPickles.djvu/51 , 19 3 GingerAndPickles.djvu/49 , 20 3 GingerAndPickles.djvu/46 , 21 3 GingerAndPickles.djvu/44 , 22 3 GingerAndPickles.djvu/43 , 23 3 GingerAndPickles.djvu/41 , 24 3 GingerAndPickles.djvu/37 , 25 3 GingerAndPickles.djvu/34

out 2016: 1 5 My Life and Loves.djvu/46 , 2 5 Cassell's Illustrated History of England vol 3.djvu , 3 4 Historyofpersiaf00watsrich.djvu/9 , 4 4 My Life and Loves.djvu/382 , 5 4 My Life and Loves.djvu/182 , 6 4 My Life and Loves.djvu/166 , 7 4 My Life and Loves.djvu/164 , 8 4 My Life and Loves.djvu/163 , 9 4 My Life and Loves.djvu/162 , 10 4 My Life and Loves.djvu/159 , 11 4 My Life and Loves.djvu/143 , 12 4 My Life and Loves.djvu/135 , 13 4 My Life and Loves.djvu/126 , 14 4 The practical designer, for women's, misses', juniors' & children's cloaks & suits, shirt waist suits and dresses.djvu/263 , 15 4 My Life and Loves.djvu/101 , 16 4 My Life and Loves.djvu/100 , 17 4 My Life and Loves.djvu/96 , 18 4 My Life and Loves.djvu/95 , 19 4 My Life and Loves.djvu/50 , 20 4 My Life and Loves.djvu/48 , 21 4 My Life and Loves.djvu/37 , 22 4 My Life and Loves.djvu/36 , 23 4 My Life and Loves.djvu/35 , 24 4 My Life and Loves.djvu/383 , 25 4 My Life and Loves.djvu/9

nov 2016: 1 5 Privacy and Harassment on the Internet , 2 4 Mexico, picturesque, political, progressive.djvu/7 , 3 4 Mexico, picturesque, political, progressive.djvu/4 , 4 4 Australian enquiry book of household and general information.djvu/244 , 5 4 Australian enquiry book of household and general information.djvu/243 , 6 4 Cassell's Illustrated History of England vol 2.djvu/640 , 7 4 Cassell's Illustrated History of England vol 2.djvu , 8 3 Pictures of life in Mexico Vol 1.djvu/27 , 9 3 Pictures of life in Mexico Vol 1.djvu/26 , 10 3 Pictures of life in Mexico Vol 1.djvu/31 , 11 3 Pictures of life in Mexico Vol 1.djvu/33 , 12 3 Pictures of life in Mexico Vol 1.djvu/49 , 13 3 Pictures of life in Mexico Vol 1.djvu/5 , 14 3 Pictures of life in Mexico Vol 1.djvu/16 , 15 3 Pictures of life in Mexico Vol 1.djvu/17 , 16 3 Pictures of life in Mexico Vol 1.djvu/12 , 17 3 Lee's General Orders № 75 , 18 3 Georg Ferdinand Ludwig Philipp Cantor , 19 3 Canada-Margriet-hospital-extraterritorial.png , 20 3 Cantortransfinite.djvu , 21 3 Teleny, or The Reverse of the Medal, t. I.djvu/16 , 22 3 Cassell's Illustrated History of England vol 4.djvu/596 , 23 3 Mexico, picturesque, political, progressive.djvu/95 , 24 3 Mexico, picturesque, political, progressive.djvu/80 , 25 3 The New International Encyclopædia 1st ed. v. 05.djvu/136

dez 2016: 1 7 Boys Life of Mark Twain.djvu/313 , 2 6 Boys Life of Mark Twain.djvu/152 , 3 6 Boys Life of Mark Twain.djvu/36 , 4 6 Boys Life of Mark Twain.djvu/27 , 5 6 Boys Life of Mark Twain.djvu/23 , 6 5 The Bishop's Secret , 7 5 God and His Book.djvu/5 , 8 5 God and His Book.djvu/13 , 9 5 Boys Life of Mark Twain.djvu/317 , 10 5 Boys Life of Mark Twain.djvu/162 , 11 5 Boys Life of Mark Twain.djvu/81 , 12 5 Boys Life of Mark Twain.djvu/78 , 13 5 Boys Life of Mark Twain.djvu/199 , 14 5 Boys Life of Mark Twain.djvu/44 , 15 5 Boys Life of Mark Twain.djvu/31 , 16 5 Boys Life of Mark Twain.djvu , 17 5 Witchcraft In Christian Countries.pdf , 18 4 The Golden Hamster Manual.djvu/6 , 19 4 Boys Life of Booker T. Washington.djvu/47 , 20 4 Boys Life of Booker T. Washington.djvu/39 , 21 4 Boys Life of Booker T. Washington.djvu/90 , 22 4 Boys Life of Booker T. Washington.djvu/108 , 23 4 Boys Life of Booker T. Washington.djvu/157 , 24 4 The Golden Hamster Manual.djvu , 25 4 Boys Life of Booker T. Washington.djvu/13

jan 2017: 1 10 Donald Trump's Inaugural Address , 2 8 The Post Office of Fifty Years Ago.djvu/88 , 3 6 The Post Office of Fifty Years Ago.djvu/148 , 4 6 The Post Office of Fifty Years Ago.djvu/114 , 5 6 The Post Office of Fifty Years Ago.djvu/85 , 6 6 The Post Office of Fifty Years Ago.djvu/52 , 7 6 The Post Office of Fifty Years Ago.djvu/32 , 8 5 Executive Order 13769 , 9 5 The Pilgrim's Progress, the Holy War, Grace Abounding Chunk1.djvu/9 , 10 5 The Post Office of Fifty Years Ago.djvu/163 , 11 5 The Post Office of Fifty Years Ago.djvu/162 , 12 5 The Post Office of Fifty Years Ago.djvu/147 , 13 5 The Post Office of Fifty Years Ago.djvu/132 , 14 5 The Post Office of Fifty Years Ago.djvu/131 , 15 5 The Post Office of Fifty Years Ago.djvu/127 , 16 5 The Post Office of Fifty Years Ago.djvu/121 , 17 5 The Post Office of Fifty Years Ago.djvu/101 , 18 5 The Post Office of Fifty Years Ago.djvu/100 , 19 5 The Post Office of Fifty Years Ago.djvu/95 , 20 5 The Post Office of Fifty Years Ago.djvu/91 , 21 5 The Post Office of Fifty Years Ago.djvu/90 , 22 5 The Post Office of Fifty Years Ago.djvu/58 , 23 5 The Post Office of Fifty Years Ago.djvu/57 , 24 5 The Post Office of Fifty Years Ago.djvu/56 , 25 5 The Post Office of Fifty Years Ago.djvu/55

fev 2017: 1 6 Henry David Thoreau , 2 5 Ragged Trousered Philanthropists.djvu/63 , 3 5 Ragged Trousered Philanthropists.djvu , 4 5 Executive Order 13769 , 5 5 Cowie's Printer's pocket-book and manual.djvu/78 , 6 4 Ragged Trousered Philanthropists.djvu/134 , 7 4 Ragged Trousered Philanthropists.djvu/87 , 8 4 Ragged Trousered Philanthropists.djvu/86 , 9 4 Ragged Trousered Philanthropists.djvu/84 , 10 4 Ragged Trousered Philanthropists.djvu/83 , 11 4 Ragged Trousered Philanthropists.djvu/82 , 12 4 Ragged Trousered Philanthropists.djvu/81 , 13 4 Ragged Trousered Philanthropists.djvu/80 , 14 4 Ragged Trousered Philanthropists.djvu/79 , 15 4 Ragged Trousered Philanthropists.djvu/78 , 16 4 Ragged Trousered Philanthropists.djvu/61 , 17 4 Ragged Trousered Philanthropists.djvu/60 , 18 4 Ragged Trousered Philanthropists.djvu/59 , 19 4 Ragged Trousered Philanthropists.djvu/58 , 20 4 Ragged Trousered Philanthropists.djvu/57 , 21 4 Ragged Trousered Philanthropists.djvu/56 , 22 4 Ragged Trousered Philanthropists.djvu/55 , 23 4 Ragged Trousered Philanthropists.djvu/53 , 24 4 Ragged Trousered Philanthropists.djvu/47 , 25 4 Ragged Trousered Philanthropists.djvu/46

mar 2017: 1 7 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/14 , 2 7 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/2 , 3 7 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/13 , 4 7 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/12 , 5 7 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/11 , 6 7 Women Wanted.djvu , 7 6 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/19 , 8 6 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/6 , 9 6 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/7 , 10 6 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/10 , 11 6 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/9 , 12 6 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/17 , 13 6 Women Wanted.djvu/8 , 14 5 Indian Copyright Act 1957.djvu/10 , 15 5 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/16 , 16 5 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/1 , 17 5 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/3 , 18 5 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/15 , 19 5 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/8 , 20 5 Women Wanted.djvu/63 , 21 5 Geographical Indications of Goods (Registration and Protection) Act, 1999.djvu/18 , 22 5 Women Wanted.djvu/15 , 23 5 DeSitterGravitation.djvu/16 , 24 5 DeSitterGravitation.djvu/15 , 25 4 The Moor of Venice.djvu/50

abr 2017: 1 8 The Book of Scottish Song.djvu/36 , 2 7 The Book of Scottish Song.djvu/149 , 3 7 The Book of Scottish Song.djvu/124 , 4 7 The Book of Scottish Song.djvu/49 , 5 7 The Book of Scottish Song.djvu/25 , 6 6 The Book of Scottish Song.djvu/613 , 7 6 The Book of Scottish Song.djvu/271 , 8 6 The Book of Scottish Song.djvu/254 , 9 6 The Book of Scottish Song.djvu/180 , 10 6 The Book of Scottish Song.djvu/179 , 11 6 The Book of Scottish Song.djvu/166 , 12 6 The Book of Scottish Song.djvu/165 , 13 6 The Book of Scottish Song.djvu/163 , 14 6 The Book of Scottish Song.djvu/161 , 15 6 The Book of Scottish Song.djvu/160 , 16 6 The Book of Scottish Song.djvu/153 , 17 6 The Book of Scottish Song.djvu/148 , 18 6 The Book of Scottish Song.djvu/142 , 19 6 The Book of Scottish Song.djvu/101 , 20 6 The Book of Scottish Song.djvu/107 , 21 6 The Book of Scottish Song.djvu/98 , 22 6 The Book of Scottish Song.djvu/97 , 23 6 The Book of Scottish Song.djvu/130 , 24 6 The Book of Scottish Song.djvu/87 , 25 6 The Book of Scottish Song.djvu/126

mai 2017: 1 5 The Boy Travellers in the Russian Empire.djvu/46 , 2 4 The Boy Travellers in the Russian Empire.djvu/240 , 3 4 The Boy Travellers in the Russian Empire.djvu/53 , 4 4 The Boy Travellers in the Russian Empire.djvu/486 , 5 4 The Boy Travellers in the Russian Empire.djvu/13 , 6 4 The Boy Travellers in the Russian Empire.djvu/14 , 7 4 The Boy Travellers in the Russian Empire.djvu/15 , 8 4 The Boy Travellers in the Russian Empire.djvu/16 , 9 4 The Boy Travellers in the Russian Empire.djvu/319 , 10 4 The Boy Travellers in the Russian Empire.djvu/205 , 11 4 The Boy Travellers in the Russian Empire.djvu/10 , 12 4 Tourist's Maritime Provinces.djvu/157 , 13 4 Tourist's Maritime Provinces.djvu/1 , 14 4 Tourist's Maritime Provinces.djvu , 15 4 The Book of Scottish Song.djvu/182 , 16 4 The Book of Scottish Song.djvu/197 , 17 4 Edinburgh (Stevenson) , 18 3 The Boy Travellers in the Russian Empire.djvu/396 , 19 3 The Boy Travellers in the Russian Empire.djvu/472 , 20 3 Outlines of the women's franchise movement in New Zealand.djvu/107 , 21 3 Demosthenes (Brodribb).djvu/149 , 22 3 Outlines of the women's franchise movement in New Zealand.djvu/22 , 23 3 Outlines of the women's franchise movement in New Zealand.djvu/5 , 24 3 Women's suffrage: a short history of a great movement , 25 3 The Boy Travellers in the Russian Empire.djvu/182

jun 2017: 1 7 Thoreau - His Home, Friends and Books (1902).djvu , 2 6 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/60 , 3 5 The Story of Nell Gwyn.djvu/208 , 4 5 The Story of Nell Gwyn.djvu/146 , 5 5 The Story of Nell Gwyn.djvu/158 , 6 5 The Story of Nell Gwyn.djvu/97 , 7 5 The Story of Nell Gwyn.djvu/95 , 8 5 The Story of Nell Gwyn.djvu/93 , 9 5 The Story of Nell Gwyn.djvu/86 , 10 5 The Story of Nell Gwyn.djvu/84 , 11 5 The Story of Nell Gwyn.djvu/83 , 12 5 The Story of Nell Gwyn.djvu/76 , 13 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/181 , 14 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/180 , 15 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/151 , 16 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/82 , 17 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/74 , 18 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/72 , 19 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/70 , 20 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/69 , 21 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/61 , 22 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/58 , 23 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/54 , 24 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/53 , 25 5 Elizabeth Barrett Browning (Ingram, 5th ed.).djvu/52

jul 2017: 1 5 The Maine Woods (1864).djvu/299 , 2 5 The Maine Woods (1864).djvu/340 , 3 5 The Maine Woods (1864).djvu/339 , 4 5 The Maine Woods (1864).djvu/338 , 5 4 Tom Swift and His Photo Telephone.djvu/96 , 6 4 A literal translation of the Saxon Chronicle.djvu , 7 4 The Maine Woods (1864).djvu/333 , 8 4 The Maine Woods (1864).djvu/332 , 9 4 The Maine Woods (1864).djvu/331 , 10 4 The Maine Woods (1864).djvu/298 , 11 4 The Maine Woods (1864).djvu/243 , 12 4 The Maine Woods (1864).djvu/206 , 13 4 The Maine Woods (1864).djvu/237 , 14 4 The Maine Woods (1864).djvu/135 , 15 4 The Maine Woods (1864).djvu/129 , 16 4 The Maine Woods (1864).djvu/202 , 17 4 The Maine Woods (1864).djvu/159 , 18 4 The Maine Woods (1864).djvu/154 , 19 4 Plomer Dictionary of the Booksellers and Printers 1907.djvu/181 , 20 4 Plomer Dictionary of the Booksellers and Printers 1907.djvu/172 , 21 4 Plomer Dictionary of the Booksellers and Printers 1907.djvu/154 , 22 4 Plomer Dictionary of the Booksellers and Printers 1907.djvu/151 , 23 4 Plomer Dictionary of the Booksellers and Printers 1907.djvu/149 , 24 4 Plomer Dictionary of the Booksellers and Printers 1907.djvu/148 , 25 4 Plomer Dictionary of the Booksellers and Printers 1907.djvu/146

ago 2017: 1 5 The English Housekeeper , 2 5 The Melanesians Studies in their Anthropology and Folklore.djvu , 3 4 The Melanesians Studies in their Anthropology and Folklore.djvu/374 , 4 4 The Melanesians Studies in their Anthropology and Folklore.djvu/346 , 5 4 The Melanesians Studies in their Anthropology and Folklore.djvu/308 , 6 4 The Melanesians Studies in their Anthropology and Folklore.djvu/63 , 7 4 The Melanesians Studies in their Anthropology and Folklore.djvu/60 , 8 4 The Melanesians Studies in their Anthropology and Folklore.djvu/58 , 9 4 The Melanesians Studies in their Anthropology and Folklore.djvu/55 , 10 4 Tom Swift and His Photo Telephone.djvu/142 , 11 4 The Melanesians Studies in their Anthropology and Folklore.djvu/242 , 12 4 The Melanesians Studies in their Anthropology and Folklore.djvu/238 , 13 4 The Melanesians Studies in their Anthropology and Folklore.djvu/236 , 14 4 The Melanesians Studies in their Anthropology and Folklore.djvu/234 , 15 4 The Melanesians Studies in their Anthropology and Folklore.djvu/232 , 16 4 The Melanesians Studies in their Anthropology and Folklore.djvu/230 , 17 4 The Melanesians Studies in their Anthropology and Folklore.djvu/228 , 18 4 The Melanesians Studies in their Anthropology and Folklore.djvu/226 , 19 4 The Melanesians Studies in their Anthropology and Folklore.djvu/224 , 20 4 The Melanesians Studies in their Anthropology and Folklore.djvu/216 , 21 4 The Melanesians Studies in their Anthropology and Folklore.djvu/218 , 22 4 The Melanesians Studies in their Anthropology and Folklore.djvu/220 , 23 4 The Melanesians Studies in their Anthropology and Folklore.djvu/222 , 24 4 The Melanesians Studies in their Anthropology and Folklore.djvu/42 , 25 4 The Melanesians Studies in their Anthropology and Folklore.djvu/360

set 2017: 1 5 My Bondage and My Freedom (1855).djvu/423 , 2 5 My Bondage and My Freedom (1855).djvu/424 , 3 5 My Bondage and My Freedom (1855).djvu/446 , 4 5 My Bondage and My Freedom (1855).djvu/444 , 5 5 My Bondage and My Freedom (1855).djvu/477 , 6 5 My Bondage and My Freedom (1855).djvu/419 , 7 5 My Bondage and My Freedom (1855).djvu/388 , 8 5 My Bondage and My Freedom (1855).djvu/386 , 9 5 My Bondage and My Freedom (1855).djvu/173 , 10 5 My Bondage and My Freedom (1855).djvu/229 , 11 5 My Bondage and My Freedom (1855).djvu/190 , 12 5 My Bondage and My Freedom (1855).djvu/87 , 13 5 My Bondage and My Freedom (1855).djvu/51 , 14 5 My Bondage and My Freedom (1855).djvu , 15 4 President Trump's Remarks to the 72nd Session of the UN General Assembly , 16 4 My Bondage and My Freedom (1855).djvu/402 , 17 4 My Bondage and My Freedom (1855).djvu/436 , 18 4 My Bondage and My Freedom (1855).djvu/422 , 19 4 My Bondage and My Freedom (1855).djvu/425 , 20 4 My Bondage and My Freedom (1855).djvu/404 , 21 4 My Bondage and My Freedom (1855).djvu/434 , 22 4 My Bondage and My Freedom (1855).djvu/430 , 23 4 My Bondage and My Freedom (1855).djvu/445 , 24 4 My Bondage and My Freedom (1855).djvu/479 , 25 4 My Bondage and My Freedom (1855).djvu/474

out 2017: 1 5 Guy Boothby--A Bid for Fortune.djvu/127 , 2 5 Guy Boothby--A Bid for Fortune.djvu/280 , 3 5 Guy Boothby--A Bid for Fortune.djvu/273 , 4 4 Guy Boothby--A Bid for Fortune.djvu/268 , 5 4 Guy Boothby--A Bid for Fortune.djvu/263 , 6 4 Guy Boothby--A Bid for Fortune.djvu/287 , 7 4 Guy Boothby--A Bid for Fortune.djvu/306 , 8 4 Guy Boothby--A Bid for Fortune.djvu/242 , 9 4 Guy Boothby--A Bid for Fortune.djvu/265 , 10 4 Guy Boothby--A Bid for Fortune.djvu/229 , 11 4 Guy Boothby--A Bid for Fortune.djvu/274 , 12 4 Guy Boothby--A Bid for Fortune.djvu/125 , 13 4 Guy Boothby--A Bid for Fortune.djvu/124 , 14 4 Guy Boothby--A Bid for Fortune.djvu/122 , 15 4 Guy Boothby--A Bid for Fortune.djvu/120 , 16 4 Guy Boothby--A Bid for Fortune.djvu/275 , 17 4 Guy Boothby--A Bid for Fortune.djvu/258 , 18 4 Guy Boothby--A Bid for Fortune.djvu/101 , 19 4 Guy Boothby--A Bid for Fortune.djvu/100 , 20 4 Guy Boothby--A Bid for Fortune.djvu/98 , 21 4 Guy Boothby--A Bid for Fortune.djvu/97 , 22 4 Guy Boothby--A Bid for Fortune.djvu/85 , 23 4 Guy Boothby--A Bid for Fortune.djvu/209 , 24 4 Guy Boothby--A Bid for Fortune.djvu/186 , 25 4 Guy Boothby--A Bid for Fortune.djvu/299

nov 2017: 1 6 March of the Volunteers , 2 5 Exodus , 3 4 Lionel David Barnett , 4 4 Blackwood's Magazine volume 043.djvu/212 , 5 4 AASHO USRN 1969-06-24.pdf , 6 4 Genesis , 7 3 A Life , 8 3 Venkata Ranga Rao , 9 3 Ferrier's Works Volume 3 \"Philosophical Remains\" (1883 ed.).djvu , 10 3 (1848) Observations on Church and State- JF Ferrier.pdf , 11 3 A Manual of Gardening for Bengal and Upper India - 3rd edition.djvu , 12 3 List of inscriptions on tombs or monuments in Bengal.pdf , 13 3 Madame Rolland (Blind 1886).djvu/69 , 14 3 Report of Joint Board on Interstate Highways.pdf/2 , 15 3 The Mahabharata/Book 2: Sabha Parva/Section XXI , 16 3 A Statistical Account of Bengal Vol 1 GoogleBooksID 9WEOAAAAQAAJ.pdf , 17 3 Didache Hoole.djvu/5 , 18 3 A Statistical Account of Bengal Vol 1.djvu/15 , 19 3 A Statistical Account of Bengal Vol 1.djvu/14 , 20 3 A Statistical Account of Bengal/Volume 1/Preface , 21 3 Charles Willard Diffin , 22 3 Convocation Addresses of the Universities of Bombay and Madras/Part 2/The Rev. R. Halley, M.A. , 23 3 Convocation Addresses of the Universities of Bombay and Madras/Part 2/E. B. Powell, Esq., M.A. , 24 3 Collier's New Encyclopedia v. 01.djvu/110 , 25 3 Frank Gelett Burgess

dez 2017: 1 4 Messiah - An Oratorio - As it is Perform’d at the Theatre-Royal in Covent-Garden.djvu/6 , 2 4 The Oldest Known Writing in Siamese: The Inscription of Phra Ram Khamhæng of Sukhothai, 1293 A.D. , 3 4 The man who knew too much.djvu/129 , 4 4 The man who knew too much.djvu/128 , 5 4 The man who knew too much.djvu/197 , 6 4 The man who knew too much.djvu/196 , 7 4 The man who knew too much.djvu/191 , 8 4 The man who knew too much.djvu/185 , 9 4 The man who knew too much.djvu/172 , 10 4 The man who knew too much.djvu/306 , 11 4 The man who knew too much.djvu/254 , 12 4 The man who knew too much.djvu/238 , 13 4 The man who knew too much.djvu/303 , 14 4 The man who knew too much.djvu/301 , 15 4 The man who knew too much.djvu/260 , 16 4 The man who knew too much.djvu/215 , 17 4 The man who knew too much.djvu/213 , 18 4 The man who knew too much.djvu/210 , 19 3 Messiah - An Oratorio - As it is Perform’d at the Theatre-Royal in Covent-Garden.djvu/16 , 20 3 Messiah - An Oratorio - As it is Perform’d at the Theatre-Royal in Covent-Garden.djvu/10 , 21 3 Messiah - An Oratorio - As it is Perform’d at the Theatre-Royal in Covent-Garden.djvu/9 , 22 3 Messiah - An Oratorio - As it is Perform’d at the Theatre-Royal in Covent-Garden.djvu/1 , 23 3 Messiah - An Oratorio - As it is Perform’d at the Theatre-Royal in Covent-Garden.djvu , 24 3 Vizagapatam.djvu , 25 3 Roger Sherman

jan 2018: 1 6 Language of the Eye.djvu/118 , 2 6 Language of the Eye.djvu , 3 5 Donald Trump's State of the Union Address 2018 , 4 5 The Milestones and the Old Post Road.djvu , 5 5 Simpson-transcript-redacted.pdf/4 , 6 5 Language of the Eye.djvu/134 , 7 5 Language of the Eye.djvu/59 , 8 4 Treatise on Cultivation of the Potato.djvu , 9 4 The Sclavonic Provinces of the Ottoman Empire.djvu/5 , 10 4 House-Intel-Glenn-Simpson-Transcript.pdf , 11 4 Simpson-transcript-redacted.pdf , 12 4 Language of the Eye.djvu/144 , 13 4 Language of the Eye.djvu/141 , 14 4 Language of the Eye.djvu/106 , 15 4 Language of the Eye.djvu/146 , 16 4 Language of the Eye.djvu/140 , 17 4 Language of the Eye.djvu/105 , 18 4 Language of the Eye.djvu/142 , 19 4 Language of the Eye.djvu/139 , 20 4 Language of the Eye.djvu/104 , 21 4 Language of the Eye.djvu/100 , 22 4 Language of the Eye.djvu/135 , 23 4 Language of the Eye.djvu/132 , 24 4 Language of the Eye.djvu/131 , 25 4 Language of the Eye.djvu/128

fev 2018: 1 6 Cyclopedia of Painting , 2 6 Cyclopedia of Painting-Armstrong, George D (1908).djvu , 3 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/338 , 4 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/335 , 5 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/337 , 6 5 Donald F. McGahn , 7 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/91 , 8 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/330 , 9 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/311 , 10 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/309 , 11 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/78 , 12 5 Cyclopedia of Painting-Armstrong, George D (1908).djvu/445 , 13 4 Correcting the Record - The Russia Investigations.pdf/10 , 14 4 Internet Research Agency Indictment Feb 2018 with text.pdf/35 , 15 4 Internet Research Agency Indictment Feb 2018 with text.pdf/33 , 16 4 Internet Research Agency Indictment Feb 2018 with text.pdf/19 , 17 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/418 , 18 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/387 , 19 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/376 , 20 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/372 , 21 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/366 , 22 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/344 , 23 4 Rice email 180212.pdf/1 , 24 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/375 , 25 4 Cyclopedia of Painting-Armstrong, George D (1908).djvu/398

mar 2018: 1 7 Vindication Women's Rights (Wollstonecraft).djvu/11 , 2 6 Vindication Women's Rights (Wollstonecraft).djvu/22 , 3 6 Vindication Women's Rights (Wollstonecraft).djvu/21 , 4 5 Vindication Women's Rights (Wollstonecraft).djvu/24 , 5 5 Vindication Women's Rights (Wollstonecraft).djvu/12 , 6 5 Vindication Women's Rights (Wollstonecraft).djvu , 7 4 Vindication Women's Rights (Wollstonecraft).djvu/209 , 8 4 Boissonnas, Un Vaincu, English, 1875.djvu , 9 4 Vindication Women's Rights (Wollstonecraft).djvu/77 , 10 4 Vindication Women's Rights (Wollstonecraft).djvu/67 , 11 4 Vindication Women's Rights (Wollstonecraft).djvu/66 , 12 4 Vindication Women's Rights (Wollstonecraft).djvu/59 , 13 4 Vindication Women's Rights (Wollstonecraft).djvu/56 , 14 4 Vindication Women's Rights (Wollstonecraft).djvu/48 , 15 4 Vindication Women's Rights (Wollstonecraft).djvu/46 , 16 4 Vindication Women's Rights (Wollstonecraft).djvu/45 , 17 4 Vindication Women's Rights (Wollstonecraft).djvu/25 , 18 4 Vindication Women's Rights (Wollstonecraft).djvu/34 , 19 4 Vindication Women's Rights (Wollstonecraft).djvu/18 , 20 4 Vindication Women's Rights (Wollstonecraft).djvu/19 , 21 3 Vindication Women's Rights (Wollstonecraft).djvu/249 , 22 3 H.M. The Patrioteer.djvu , 23 3 Statement by Prime Minister Shinzo Abe , 24 3 Vindication Women's Rights (Wollstonecraft).djvu/280 , 25 3 Juvenile Forget Me Not 1837.pdf

abr 2018: 1 5 Modern poets and poetry of Spain.djvu/64 , 2 5 Modern poets and poetry of Spain.djvu/15 , 3 4 The Sikh Religion, its gurus, sacred writings and authors Vol 1.djvu/24 , 4 4 The Sikh Religion, its gurus, sacred writings and authors Vol 1.djvu/23 , 5 4 The Sikh Religion, its gurus, sacred writings and authors Vol 1.djvu/22 , 6 4 The Sikh Religion, its gurus, sacred writings and authors Vol 1.djvu/19 , 7 4 Thoreau: As remembered by a young friend , 8 4 The Kingdom of Man - Ralph Vary Chamberlin 1938.djvu/5 , 9 4 Why I Do Not Believe in God , 10 4 The Blue Peter , 11 4 Modern poets and poetry of Spain.djvu/130 , 12 4 Modern poets and poetry of Spain.djvu/140 , 13 4 Modern poets and poetry of Spain.djvu/105 , 14 4 Modern poets and poetry of Spain.djvu/136 , 15 4 Modern poets and poetry of Spain.djvu/102 , 16 4 Modern poets and poetry of Spain.djvu/79 , 17 4 Modern poets and poetry of Spain.djvu/78 , 18 4 Modern poets and poetry of Spain.djvu/76 , 19 4 Modern poets and poetry of Spain.djvu/89 , 20 4 Modern poets and poetry of Spain.djvu/154 , 21 4 Modern poets and poetry of Spain.djvu/153 , 22 4 Modern poets and poetry of Spain.djvu/151 , 23 4 Modern poets and poetry of Spain.djvu/150 , 24 4 Modern poets and poetry of Spain.djvu/149 , 25 4 Modern poets and poetry of Spain.djvu/370

mai 2018: 1 5 Siberia and the Exile System Vol 1.djvu , 2 5 A Motor-Flight Through France.djvu/1 , 3 5 France and the Levant peace conference 1920.djvu , 4 4 Siberia and the Exile System Vol 1.djvu/177 , 5 4 The Sikh Religion, its gurus, sacred writings and authors Vol 1.djvu/126 , 6 4 Bringing Wikimedians into the Conversation at Libraries.pdf , 7 4 Siberia and the Exile System Vol 1.djvu/63 , 8 4 Siberia and the Exile System , 9 4 Siberia and the Exile System Vol 1.djvu/28 , 10 4 Siberia and the Exile System Vol 1.djvu/47 , 11 4 Siberia and the Exile System Vol 1.djvu/123 , 12 4 Siberia and the Exile System Vol 1.djvu/13 , 13 4 Siberia and the Exile System Vol 1.djvu/10 , 14 4 Siberia and the Exile System Vol 1.djvu/17 , 15 4 A Motor-Flight Through France.djvu/307 , 16 4 A Motor-Flight Through France.djvu/301 , 17 4 A Motor-Flight Through France.djvu/295 , 18 4 A Motor-Flight Through France.djvu/291 , 19 4 A Motor-Flight Through France.djvu/271 , 20 4 A Motor-Flight Through France.djvu/261 , 21 4 A Motor-Flight Through France.djvu/257 , 22 4 A Motor-Flight Through France.djvu/251 , 23 4 A Motor-Flight Through France.djvu/245 , 24 4 A Motor-Flight Through France.djvu/239 , 25 4 A Motor-Flight Through France.djvu/233

jun 2018: 1 7 Lives of Poets-Laureate.djvu , 2 5 Lives of Poets-Laureate.djvu/244 , 3 5 Lives of Poets-Laureate.djvu/241 , 4 4 Lives of Poets-Laureate.djvu/351 , 5 4 Lives of Poets-Laureate.djvu/331 , 6 4 Lives of Poets-Laureate.djvu/247 , 7 4 Lives of Poets-Laureate.djvu/243 , 8 4 Lives of Poets-Laureate.djvu/242 , 9 4 Lives of Poets-Laureate.djvu/176 , 10 4 Lives of Poets-Laureate.djvu/157 , 11 4 Lives of Poets-Laureate.djvu/138 , 12 4 Lives of Poets-Laureate.djvu/128 , 13 4 Lives of Poets-Laureate.djvu/349 , 14 4 10 Rules for Radicals.djvu/2 , 15 4 An Anglo-Chinese vocabulary of the Ningpo dialect.djvu/7 , 16 4 Lives of Poets-Laureate.djvu/440 , 17 4 Lives of Poets-Laureate.djvu/432 , 18 4 Lives of Poets-Laureate.djvu/405 , 19 4 Lives of Poets-Laureate.djvu/390 , 20 4 Lives of Poets-Laureate.djvu/287 , 21 4 Lives of Poets-Laureate.djvu/288 , 22 4 Lives of Poets-Laureate.djvu/441 , 23 4 Lives of Poets-Laureate.djvu/127 , 24 4 Lives of Poets-Laureate.djvu/125 , 25 4 Lives of Poets-Laureate.djvu/119

jul 2018: 1 4 The oath of Hippocrates.djvu , 2 4 The War and the Future.djvu/8 , 3 4 Senate Select Committee on Intelligence - Intelligence Community Assessment (July 3, 2018) , 4 4 SSCI ICA ASSESSMENT FINALJULY3.pdf , 5 4 Wuthering Heights and Agnes Grey (1st edition), Volume 2 (Wuthering Heights, Volume 2).djvu , 6 4 Wuthering Heights and Agnes Grey (1st edition), Volume 1 (Wuthering Heights, Volume 1).djvu , 7 3 Panmunjom Declaration , 8 3 Ayelet Shaked , 9 3 Basic Law: Israel as the Nation-State of the Jewish People (Proposal) , 10 3 Convocation Addresses of the Universities of Bombay and Madras.djvu/228 , 11 3 HKGovGazette Vol 39 No 57.pdf , 12 3 Elementary lectures on electric discharges, waves and impulses, and other transients (Steinmetz 1911).djvu/1 , 13 3 Remarks by President Trump and President Niinistö of the Republic of Finland at Working Break , 14 3 Travel diary from the Rivonia Trial (State v. Nelson Mandela and Others).pdf , 15 3 Letter of Constantine to Eusebius on the preparation of the copies of the Scriptures , 16 3 Second Letter of Constantine to Macarius , 17 3 Letter of Constantine to Macarius , 18 3 Russian National Charged in Conspiracy to Act as an Agent of the Russian Federation Within the United States , 19 3 Origin of the High Terrace Deposits of the Monongahela River.pdf/10 , 20 3 Origin of the High Terrace Deposits of the Monongahela River.pdf/6 , 21 3 The War and the Future.djvu/2 , 22 3 The War and the Future.djvu/21 , 23 3 The War and the Future.djvu/20 , 24 3 The War and the Future.djvu/19 , 25 3 The War and the Future.djvu/13

ago 2018: 1 9 Teachers' Learning in a Changing World , 2 7 Sukavich Rangsitpol , 3 5 Education Policy, Re-engineering of administrative systems , 4 5 The Sikhs (Gordon).djvu/286 , 5 5 The Sikhs (Gordon).djvu/19 , 6 4 What Can I Do^ - NARA - 534471.jpg , 7 4 Statement by Minister of Education, Singapore at 31st Southeast Asian Ministers of Education Council , 8 4 The Sikhs (Gordon).djvu/225 , 9 4 The Sikhs (Gordon).djvu/224 , 10 4 The Sikhs (Gordon).djvu/58 , 11 4 The Sikhs (Gordon).djvu/283 , 12 4 The Sikhs (Gordon).djvu/280 , 13 4 The Sikhs (Gordon).djvu/277 , 14 4 The Sikhs (Gordon).djvu/274 , 15 4 The Sikhs (Gordon).djvu/271 , 16 4 The Sikhs (Gordon).djvu/263 , 17 4 The Sikhs (Gordon).djvu/260 , 18 4 The Sikhs (Gordon).djvu/223 , 19 4 The Sikhs (Gordon).djvu/220 , 20 4 The Sikhs (Gordon).djvu/219 , 21 4 The Sikhs (Gordon).djvu/155 , 22 4 The Sikhs (Gordon).djvu/97 , 23 4 The Sikhs (Gordon).djvu/65 , 24 4 The Sikhs (Gordon).djvu/44 , 25 4 The Sikhs (Gordon).djvu/30

set 2018: 1 6 Natural History, Reptiles , 2 6 Natural History, Reptiles.djvu/8 , 3 6 Natural History, Reptiles.djvu/7 , 4 6 Natural History, Reptiles.djvu , 5 5 Natural History, Reptiles.djvu/117 , 6 5 Natural History, Reptiles.djvu/115 , 7 5 Natural History, Reptiles.djvu/107 , 8 5 Natural History, Reptiles.djvu/101 , 9 5 Natural History, Reptiles.djvu/73 , 10 5 Natural History, Reptiles.djvu/66 , 11 5 Natural History, Reptiles.djvu/9 , 12 5 Natural History, Reptiles.djvu/5 , 13 4 The grammar of Dionysios Thrax , 14 4 Hazlitt, Political Essays (1819).djvu/443 , 15 4 Bird Haunts and Nature Memories - Thomas Coward (Warne, 1922).pdf/189 , 16 4 Bird Haunts and Nature Memories - Thomas Coward (Warne, 1922).pdf/185 , 17 4 Bird Haunts and Nature Memories - Thomas Coward (Warne, 1922).pdf/163 , 18 4 Natural History, Reptiles.djvu/141 , 19 4 Natural History, Reptiles.djvu/133 , 20 4 Natural History, Reptiles.djvu/131 , 21 4 Natural History, Reptiles.djvu/130 , 22 4 Natural History, Reptiles.djvu/128 , 23 4 Natural History, Reptiles.djvu/124 , 24 4 Natural History, Reptiles.djvu/120 , 25 4 Natural History, Reptiles.djvu/104

out 2018: 1 5 Weird Tales volume 31 number 02.djvu/131 , 2 5 Weird Tales volume 31 number 02.djvu/21 , 3 5 Weird Tales volume 31 number 02.djvu/5 , 4 4 The Ganas or Republics of Ancient India , 5 4 Weird Tales volume 31 number 02.djvu/132 , 6 4 Weird Tales volume 31 number 02.djvu/130 , 7 4 Weird Tales volume 31 number 02.djvu/129 , 8 4 Weird Tales volume 31 number 02.djvu/127 , 9 4 Weird Tales volume 31 number 02.djvu/24 , 10 4 Weird Tales volume 31 number 02.djvu/23 , 11 4 Weird Tales volume 31 number 02.djvu/22 , 12 4 Weird Tales volume 31 number 02.djvu/28 , 13 4 Weird Tales volume 31 number 02.djvu/26 , 14 4 Weird Tales volume 31 number 02.djvu/126 , 15 4 Weird Tales volume 31 number 02.djvu/25 , 16 4 Weird Tales volume 31 number 02.djvu/121 , 17 4 Weird Tales volume 31 number 02.djvu/9 , 18 4 The Migration of Birds - Thomas A Coward - 1912.pdf/121 , 19 4 Marietta, or the Two Students , 20 4 Natural History, Fishes.djvu/266 , 21 4 Natural History, Fishes.djvu/289 , 22 4 Natural History, Fishes.djvu/219 , 23 4 Natural History, Fishes.djvu/258 , 24 4 Natural History, Fishes.djvu/89 , 25 4 Natural History, Fishes.djvu/85

nov 2018: 1 5 Mr. Punch's history of the Great War, Graves, 1919.djvu/84 , 2 5 The War and the Future (Masefield, 1918) , 3 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/280 , 4 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/279 , 5 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/277 , 6 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/275 , 7 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/272 , 8 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/271 , 9 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/270 , 10 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/267 , 11 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/231 , 12 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/283 , 13 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/211 , 14 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/266 , 15 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/198 , 16 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/197 , 17 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/276 , 18 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/187 , 19 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/285 , 20 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/286 , 21 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/288 , 22 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/292 , 23 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/293 , 24 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/297 , 25 4 Mr. Punch's history of the Great War, Graves, 1919.djvu/299

dez 2018: 1 5 Tales of Today.djvu , 2 4 Confederate Military History - 1899 - Volume 9.djvu , 3 4 The Adventures of Ann , 4 4 Tales of Today.djvu/232 , 5 4 Tales of Today.djvu/168 , 6 4 Tales of Today.djvu/59 , 7 4 Tales of Today.djvu/56 , 8 4 Tales of Today.djvu/53 , 9 4 Tales of Today.djvu/46 , 10 4 Tales of Today.djvu/24 , 11 4 Tales of Today.djvu/207 , 12 4 Tales of Today.djvu/18 , 13 4 Tales of Today.djvu/17 , 14 4 Explanatory notes of a pack of Cavalier playing cards.djvu/7 , 15 4 The Fortunes of Perkin Warbeck , 16 4 The Yellow Book - 01.djvu/5 , 17 3 The History of Ink.djvu/13 , 18 3 Friendship, love & marriage (1910) Thoreau.djvu/19 , 19 3 Friendship, love & marriage (1910) Thoreau.djvu/18 , 20 3 Polar Exploration , 21 3 The Constitution of the Czechoslovak Republic , 22 3 Gothic Stories.djvu/50 , 23 3 Gothic Stories.djvu/36 , 24 3 Gothic Stories.djvu/59 , 25 3 Gothic Stories.djvu/60

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 03:45 (final run)

Dump file enwikisource-20190101-stub-meta-history.xml.gz (edits only), size 484 Mb as gz -> 4.0 Gb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-12:35 after 48 min, 17 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.