Estatísticas da Wikispecial mediawiki

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
Dec 20180% -18% +1%-13%  +16%      0%
Nov 2018+1% -10% +2%   +16%      0%
Oct 2018+1% +27% +1%   +5%      0%
Sep 20180% -19% +1%   +54%      0%
Aug 2018+1% +8% +1%   +17%      0%
Jul 2018+1% +11% +1%   -13%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
Dec 2018366891341443 k2022,3 21 k      8,9 k
Nov 20183659251641242 k2322,2 18 k      8,9 k
Oct 20183634261821742 k1322,1 15 k      8,8 k
Sep 20183608171431441 k822 15 k      8,8 k
Aug 20183591301761641 k1221,7 9,5 k      8,8 k
Jul 20183561251631041 k921,7 8,1 k      8,8 k
Jun 20183536211471340 k1821,7 9,3 k      8,7 k
May 20183515341791240 k821,7 8,1 k      8,6 k
Apr 2018348123158640 k821,6 7,7 k      8,6 k
Mar 2018345834197939 k1721,6 8,1 k      8,5 k
Feb 2018342435164639 k821,7 6,5 k      8,4 k
Jan 20183389331651239 k721,6 11 k      8,4 k
Dec 20173356361601238 k1021,4 13 k      8,3 k
Nov 2017332020142838 k821,3 8,3 k      8,3 k
Oct 2017330034150938 k821,2 11 k      8,2 k
Sep 2017326623162838 k921 6,6 k      8,2 k
Aug 2017324323175737 k821 6,6 k      8,1 k
Jul 20173220241461137 k821 9,2 k      8,1 k
Jun 2017319626146937 k1420,9 8,1 k      8,0 k
May 2017317025170936 k720,9 7,3 k      7,9 k
Apr 20173145321601236 k1020,8 8,7 k      7,9 k
Mar 2017311325152836 k720,7 9,0 k      7,8 k
Feb 2017308841203836 k1220,6 13 k      7,7 k
Jan 20173047401891135 k1020,5 13 k      7,7 k
Dec 20163007241671235 k1720,3 12 k      7,5 k
Nov 20162983331491035 k720,2 6,9 k      7,5 k
Oct 2016295038153934 k920,2 7,3 k      7,4 k
Sep 2016291233180834 k1020,1 7,8 k      7,4 k
Aug 2016287923153734 k1220,1 7,8 k      7,2 k
Jul 20162856231571133 k1220,1 8,9 k      7,2 k
Jun 2016283335161633 k820 6,4 k      7,1 k
May 20162798301751133 k1520 18 k      7,1 k
Apr 2016276827153632 k819,7 8,1 k      7,0 k
Mar 2016274129168932 k1019,6 8,3 k      7,0 k
Feb 2016271239168532 k1219,5 11 k      6,9 k
Jan 20162673391831231 k1319,4 15 k      6,8 k
Dec 20152634331441531 k2019,1 16 k      6,8 k
Nov 2015260131141730 k1619 8,8 k      6,7 k
Oct 2015257021150830 k719 5,9 k      6,7 k
Sep 2015254918130830 k1219 9,2 k      6,6 k
Aug 2015253135154629 k918,9 10 k      6,6 k
Jul 20152496341671129 k918,7 10 k      6,5 k
Jun 2015246237156629 k918,5 7,8 k      6,4 k
May 2015242533162829 k1218,4 6,8 k      6,3 k
Apr 20152392311551028 k2318,4 13 k      6,1 k
Mar 20152361311811227 k1518,4627913 k60 Mb6,6 M22 k10 k5,8 k43 k6,1 k
Feb 2015233029158927 k1218,262249,0 k57 Mb6,4 M20 k9,8 k5,7 k41 k6,0 k
Jan 2015230133151927 k4118,1616615 k56 Mb6,2 M19 k9,8 k5,6 k40 k6,0 k
Dec 20142268301461225 k4218,4617714 k55 Mb6,1 M19 k9,8 k5,4 k40 k5,9 k
Nov 2014223829158624 k6718,9635513 k53 Mb6,0 M18 k9,2 k5,4 k38 k5,9 k
Oct 20142209341801022 k5420635014 k52 Mb5,8 M18 k8,9 k5,3 k37 k5,8 k
Sep 20142175231451320 k12621639124 k50 Mb5,6 M18 k8,9 k5,1 k36 k5,7 k
Aug 20142152271631317 k2424,3641912 k48 Mb5,4 M17 k8,6 k5,0 k34 k5,6 k
Jul 2014212521161916 k1424,766078,7 k47 Mb5,2 M17 k8,3 k4,8 k33 k5,6 k
Jun 20142104211581115 k1424,8659410 k46 Mb5,1 M16 k7,8 k4,6 k32 k5,5 k
May 20142083341771715 k1524,965848,5 k44 Mb4,9 M17 k7,1 k4,5 k31 k5,3 k
Apr 20142049391871515 k1325,1672210 k42 Mb4,7 M16 k6,8 k4,4 k29 k5,2 k
Mar 20142010472021014 k102567758,8 k40 Mb4,5 M16 k6,4 k4,1 k27 k5,1 k
Feb 20141963401861014 k82567247,4 k39 Mb4,2 M15 k7,3 k3,9 k26 k5,1 k
Jan 20141923311791114 k924,867698,0 k37 Mb4,1 M14 k7,0 k3,7 k25 k5,0 k
Dec 20131892351631213 k824,868248,0 k36 Mb3,9 M14 k6,5 k3,6 k24 k4,9 k
Nov 20131857401891313 k924,669037,3 k35 Mb3,8 M13 k6,2 k3,5 k22 k4,7 k
Oct 20131817211321313 k824,670276,3 k34 Mb3,7 M13 k5,1 k3,2 k21 k4,7 k
Sep 2013179634150513 k724,670906,4 k33 Mb3,6 M12 k4,5 k3,1 k20 k4,5 k
Aug 2013176228138412 k624,571216,0 k31 Mb3,4 M12 k4,3 k2,9 k20 k4,4 k
Jul 2013173444180912 k1024,471807,9 k31 Mb3,4 M11 k4,2 k2,6 k20 k4,3 k
Jun 2013169031129512 k624,473145,6 k29 Mb3,2 M11 k4,0 k2,4 k20 k4,3 k
May 2013165936165812 k724,374226,9 k28 Mb3,1 M11 k3,8 k2,3 k19 k4,2 k
Apr 2013162332152411 k524,174375,9 k27 Mb3,0 M10 k3,6 k2,2 k19 k4,0 k
Mar 2013159129130511 k523,974326,3 k26 Mb2,9 M10,0 k3,2 k2,1 k18 k4,0 k
Feb 2013156223141911 k623,773616,7 k25 Mb2,8 M9,7 k2,9 k1,9 k17 k3,9 k
Jan 20131539241441111 k623,573087,1 k24 Mb2,7 M9,3 k2,7 k1,8 k17 k3,8 k
Dec 2012151522118411 k523,371715,0 k22 Mb2,5 M8,7 k2,4 k1,7 k16 k3,7 k
Nov 201214931797611 k523,168015,0 k21 Mb2,3 M8,2 k2,3 k1,6 k15 k3,7 k
Oct 2012147618126510 k62367395,2 k20 Mb2,2 M7,9 k2,3 k1,6 k15 k3,6 k
Sep 2012145821107410 k422,866814,8 k19 Mb2,1 M7,6 k2,2 k1,5 k14 k3,5 k
Aug 2012143717115310 k622,764915,6 k18 Mb2,0 M7,3 k2,1 k1,4 k14 k3,4 k
Jul 201214202010949,9 k422,563205,1 k17 Mb1,9 M7,1 k2,0 k1,3 k13 k3,4 k
Jun 201214002411079,8 k422,363205,4 k17 Mb1,8 M6,9 k2,0 k1,3 k13 k3,3 k
May 201213762311069,7 k42263116,0 k16 Mb1,8 M6,6 k1,9 k1,3 k13 k3,2 k
Apr 201213532511169,6 k521,762655,4 k16 Mb1,7 M6,4 k1,8 k1,2 k12 k3,1 k
Mar 201213282511479,4 k521,563235,4 k15 Mb1,6 M6,1 k1,7 k1,1 k12 k3,1 k
Feb 201213033012169,3 k621,263415,9 k14 Mb1,6 M5,9 k1,6 k1,1 k11 k3,0 k
Jan 2012127324114129,1 k52163666,5 k13 Mb1,5 M5,3 k1,5 k91811 k3,0 k
Dec 201112491810988,9 k420,663596,5 k13 Mb1,4 M5,0 k1,5 k85310 k2,9 k
Nov 20111231179878,8 k320,263814,9 k13 Mb1,4 M4,7 k1,4 k80912 k2,9 k
Oct 20111214189858,7 k619,863174,8 k12 Mb1,3 M4,4 k1,3 k77811 k2,8 k
Sep 20111196209458,5 k1019,763055,0 k12 Mb1,3 M4,3 k1,3 k72711 k2,8 k
Aug 20111176248548,2 k819,864413,7 k11 Mb1,2 M4,1 k1,2 k68511 k2,7 k
Jul 20111152218238,0 k1519,952933,1 k8,5 Mb924 k3,6 k1,1 k6369,1 k2,7 k
Jun 20111131198937,5 k520,754062,7 k8,2 Mb887 k3,4 k1,1 k6188,9 k2,6 k
May 20111112257737,4 k420,853602,4 k7,8 Mb843 k3,3 k1,1 k6018,4 k2,5 k
Apr 20111087116317,3 k320,854132,0 k7,6 Mb809 k3,1 k1,1 k5818,3 k2,5 k
Mar 20111076218127,2 k320,853763,3 k7,1 Mb779 k2,7 k1,0 k5498,1 k2,5 k
Feb 20111055136527,1 k320,667073,4 k8,5 Mb915 k3,1 k1,0 k4489,1 k2,4 k
Jan 20111042166117,0 k520,468083,3 k8,3 Mb886 k3,0 k9764318,9 k2,4 k
Dec 2010102675336,9 k320,367733,1 k8,0 Mb855 k2,8 k9594078,8 k2,3 k
Nov 20101019156016,8 k420,167003,4 k7,9 Mb823 k2,7 k9164038,6 k2,3 k
Oct 20101004116116,7 k32067152,9 k7,6 Mb796 k2,6 k7853768,3 k2,2 k
Sep 2010993146326,6 k419,867003,2 k7,5 Mb782 k2,6 k7803688,2 k2,2 k
Aug 2010979236816,4 k419,766803,1 k7,3 Mb757 k2,5 k7653588,0 k2,1 k
Jul 2010956156316,3 k219,566813,0 k7,2 Mb744 k2,6 k7453507,9 k2,1 k
Jun 2010941156816,3 k219,366253,0 k7,0 Mb715 k2,5 k7433367,8 k2,0 k
May 2010926135716,2 k319,165753,0 k6,8 Mb699 k2,3 k7393347,7 k2,0 k
Apr 2010913184816,1 k218,965872,7 k6,7 Mb690 k2,3 k7363347,7 k1,9 k
Mar 2010895136516,0 k418,665553,5 k6,6 Mb679 k2,2 k7363337,5 k1,9 k
Feb 20108821463 5,9 k718,463652,1 k6,4 Mb647 k2,2 k7433297,4 k1,9 k
Jan 20108681156 5,7 k218,636181,5 k3,8 Mb362 k1,4 k6563094,3 k1,8 k
Dec 2009857144715,6 k418,636111,7 k3,8 Mb356 k1,5 k6553084,2 k1,8 k
Nov 2009843236615,5 k418,636201,7 k3,6 Mb350 k1,4 k6242984,1 k1,8 k
Oct 2009820206315,4 k518,736091,9 k3,6 Mb348 k1,4 k6272964,1 k1,8 k
Sep 2009800125215,3 k318,943571,8 k4,1 Mb414 k1,5 k7272964,2 k1,7 k
Aug 2009788166815,2 k318,943242,1 k4,1 Mb410 k1,5 k7312954,2 k1,7 k
Jul 2009772156425,1 k418,843282,3 k4,0 Mb404 k1,5 k7293014,1 k1,7 k
Jun 2009757126515,0 k418,943361,7 k4,0 Mb401 k1,5 k7242984,1 k1,7 k
May 2009745176414,8 k31943361,8 k3,9 Mb399 k1,4 k7272974,1 k1,6 k
Apr 200972875714,8 k318,943171,7 k3,8 Mb396 k1,4 k7272974,1 k1,6 k
Mar 2009721197614,7 k418,943362,0 k3,8 Mb386 k1,3 k7092914,0 k1,5 k
Feb 2009702195914,6 k318,943361,7 k3,7 Mb380 k1,3 k7392883,9 k1,5 k
Jan 200968395524,5 k218,843252,0 k3,6 Mb367 k1,3 k7362683,8 k1,4 k
Dec 2008674214944,4 k218,740361,9 k3,3 Mb334 k1,3 k7122623,6 k1,3 k
Nov 2008653175524,4 k318,540521,6 k3,3 Mb336 k1,3 k7122663,7 k1,0 k
Oct 2008636245224,3 k318,540641,8 k3,2 Mb331 k1,3 k7082663,6 k989
Sep 2008612165724,2 k718,441181,7 k3,2 Mb328 k1,2 k6882563,6 k958
Aug 2008596237324,0 k418,941332,2 k3,2 Mb328 k1,2 k6752553,5 k918
Jul 2008573226613,9 k41940281,7 k3,1 Mb307 k1,2 k6752523,5 k829
Jun 2008551115123,7 k319,140591,8 k3,1 Mb303 k1,2 k6422523,4 k793
May 2008540187043,7 k41941092,7 k3,0 Mb300 k1,2 k6412493,3 k763
Apr 2008522236623,5 k418,941321,8 k3,0 Mb293 k1,2 k6662473,3 k738
Mar 2008499116333,4 k41941292,2 k2,8 Mb285 k1,2 k6602443,3 k710
Feb 2008488186623,3 k619,140922,2 k2,7 Mb273 k1,2 k6402353,2 k693
Jan 2008470176913,1 k719,440582,1 k2,6 Mb264 k1,2 k6372363,1 k649
Dec 2007453156632,9 k920,240062,2 k2,5 Mb255 k1,1 k6322313,1 k623
Nov 2007438186032,6 k521,439712,3 k2,4 Mb249 k1,1 k6282263,0 k581
Oct 2007420296852,5 k1021,840202,8 k2,3 Mb240 k1,1 k6132103,1 k553
Sep 2007391165342,2 k523,540113,7 k2,2 Mb233 k1,1 k5722082,9 k513
Aug 2007375236162,0 k523,440422,5 k2,0 Mb229 k9715421962,8 k432
Jul 2007352155641,9 k324,139972,7 k1,9 Mb219 k9595471892,6 k377
Jun 2007337135431,8 k324,138942,0 k1,8 Mb199 k8475341742,5 k317
May 2007324156021,7 k324,141462,2 k1,8 Mb201 k9285711662,4 k279
Apr 2007309226021,6 k32439762,1 k1,6 Mb182 k7275801622,3 k251
Mar 2007287195121,5 k32438032,1 k1,5 Mb171 k7255411592,2 k232
Feb 2007268164221,4 k324,134432,0 k1,4 Mb150 k7045181562,0 k216
Jan 200725294521,3 k324,334631,9 k1,3 Mb146 k6964951512,0 k194
Dec 200624382931,2 k224,435652,0 k1,3 Mb142 k7074891542,0 k188
Nov 2006235194421,2 k223,735441,9 k1,3 Mb140 k7114621531,8 k184
Oct 200621672711,1 k223,235201,3 k1,2 Mb138 k6944831531,8 k123
Sep 2006209122911,1 k123,134231,3 k1,1 Mb129 k6194661451,7 k112
Aug 2006197143221,0 k122,734421,7 k1,1 Mb127 k6014581421,7 k104
Jul 2006183113111,0 k221,834421,5 k1,1 Mb123 k5814551401,6 k94
Jun 200617210361959121,332981,4 k991 kb111 k6304391321,4 k88
May 200616211351918220,833911,5 k940 kb106 k6144161231,3 k83
Apr 200615116352862220,434132,2 k881 kb100 k5884121231,2 k75
Mar 2006135726 794119,341121,2 k963 kb108 k5735351211,3 k63
Feb 2006128918 766118,44049879937 kb103 k5995451111,2 k60
Jan 2006119825273621842081,3 k886 kb98 k605542991,1 k55
Dec 200511182116631183861983765 kb84 k5924906587950
Nov 2005103816 627117,54103748711 kb78 k5614756163644
Oct 20059561716071016,841961,1 k684 kb75 k5454665659242
Sep 200589413 309 29,54454632601 kb66 k5334214251837
Aug 20058510311298128,544921,5 k565 kb63 k4823974149234
Jul 200575818 254127,55336896470 kb51 k4203432344227
Jun 200567210 238 25,65151444419 kb49 k4263201341124
May 200565210 231 24,54995360402 kb47 k4113211238222
Apr 200563 101220124,14950578391 kb46 k3973151239120
Mar 200563614 196124,14982404377 kb44 k3893131237217
Feb 20055729 174 24,85237310368 kb42 k3573071234615
Jan 200555 4 170 23,65134207354 kb41 k3483031232914
Dec 20045528 156 24,35085303350 kb41 k3482931232914
Nov 200453916 147123,84884506309 kb36 k3292891230711
Oct 2004443101106 28,24877522293 kb34 k3112851228810
Sep 200441481100 24,74731602277 kb32 k3062751129810
Aug 20043729 86 21,74657270264 kb30 k3052631028910
Jul 20043568 81 19,75126223291 kb30 k333220102868
Jun 20042915 70 19,65077148226 kb26 k268143101326
May 20042837 63 19,45042171209 kb25 k26812381216
Apr 2004251020 58 18,24498386183 kb21 k25511571036
Mar 200415310 46 14,53624183146 kb13 k14824 906
Feb 200412   40 12,1374240109 kb12 k13919 815
Jan 20041215 36 12,3365790100 kb12 k13216 704
Dec 20031125 33 10,734528188 kb11 k8316 464
Nov 2003935 27 10,133697777 kb9,2 k8015 434
Oct 2003623 25 7,834525173 kb8,9 k7813 423
Sep 20034 1 23 6,335211659 kb7,3 k3911 392
Aug 2003422 23 5,637384557 kb6,5 k399 382
Jul 20032   9 9,33911840 kb4,5 k143 242
Jun 20032   8 9,54000537 kb3,9 k123 212
May 20032 1 7 10,140001337 kb3,9 k123 212
Apr 20032   6 9,73529 28 kb3,1 k122 222
Mar 200321  6 9,735291228 kb3,1 k122 222
Feb 20031   5 9,240401026 kb2,9 k111 222
Jan 20031   4 93767325 kb2,7 k6  192
Dec 20021   3 113840820 kb2,7 k6  192
Nov 20021   3 8,336091615 kb1,9 k3  141
Oct 20021   1 92030 4,8 kb3811  21
Sep 20021   1 92030 4,8 kb3811  21
Aug 20021   1 92030 4,8 kb3811  21
Jul 20021   1 9203034,8 kb3811  21
Jun 20021        2,2 kb     1
May 20021        2,2 kb     1
Apr 20021       32,2 kb     1
Mar 20021        1,2 kb     1
Feb 20021        1,2 kb     1
Jan 20021        1,2 kb     1
Dec 200111      31,2 kb     1
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  1000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000 
Dec 20183821861348142146114311141431951   221  366137110855424124 4422 
Nov 2018414212164104511271 4321118321452   331  39617013692561910214422 
Oct 2018576252182115551761 4421157412393   431  438165131101693415215422 
Sep 20184452081438149145  3321144361363   331  44017913191542092 5521 
Aug 201846623417611650166  332 132411751   221  43318013395602391 442  
Jul 201842421516391411021 4421125342092   221  40816312388561361 6421 
Jun 20184172041478751135  44211244624931  331  4171801289456166  5521 
May 201851525917910350123  442 1363927821  221  600216164128692161 5421 
Apr 2018470225158904361  4321135392182   221  4721821229046114  6422 
Mar 20184882591971245692  432 149482172   221  577203159100631441 6431 
Feb 2018444227164995362  432 160462271   221  514197148110701861 5431 
Jan 201848622916510763124  4421163562391   221  5041991491137321101 4331 
Dec 201745423116011154125  5431128422571   331  46818613996491671 55321
Nov 2017390185142893884  3321143402682   221  42416513189471263 5422 
Oct 2017439211150914191  5431158481981   221  45417011983481371 6441 
Sep 201740421916297458   442 1333819102   221  4591961429763135  4321 
Aug 20174192391751074371  4421145512561   321  46218714810454155  4431 
Jul 20173842021469846114  4421130382193   221  43217012587501971 6521 
Jun 2017388203146885393  5511143472382   221  431198150114642181 5421 
May 20175372511701025291  32111675925103   221  45018514110157174  4332 
Apr 20173802001609335122  3311119451951   221  38618714410756206  4421 
Mar 2017454219152934381  3311188572693   421  45318714892551441 3331 
Feb 201752526520313851811 33212045424146   221  456198140101591741 3332 
Jan 2017493261189117471141 331116161231231  321  4592041571105518103133321
Oct 2018576252182115551761 4421157412393   431  438165131101693415215422 
Jul 201842421516391411021 4421125342092   221  40816312388561361 6421 
Apr 2018470225158904361  4321135392182   221  4721821229046114  6422 
Jan 201848622916510763124  4421163562391   221  5041991491137321101 4331 
Oct 2017439211150914191  5431158481981   221  45417011983481371 6441 
Jul 20173842021469846114  4421130382193   221  43217012587501971 6521 
Apr 20173802001609335122  3311119451951   221  38618714410756206  4421 
Jan 2017493261189117471141 331116161231231  321  4592041571105518103133321
Oct 2016439222153954394  211 170371222   221  38216912286501651 5431 
Jul 20164052021579449116  3321180542271   221  402172129975318121 3331 
Apr 2016429215153894062  44211616540152   221  4481821328846138  6631 
Jan 2016568257183108491242144212477541164   211  44917914610259228215531 
Oct 2015439210150913781  553 23774462110   321  4321691308152141  5541 
Jul 2015403213167114561121 993225987411251  4311 562237173121773491 86421
Apr 2015413203155103521041 22112689647256   32222650261170110682281166421
Jan 2015445214151904494215421271824216811 11   5962461569956208315421 
Oct 2014449241180123521042163112999355213   11   56424217912056219415431 
Jul 201453522916110460931 642133110967248   22   664261179102501853 4321 
Apr 2014515262187126671521 33213951478640132  22   722295215138713212312221 
Jan 201448424217911753112  442 4351428035131  11   63725418011456158213211 
Oct 20134302021329349132  332 277105633013   22   5732561769955147  221  
Jul 20134352251801176491  66312629452216   21   6793542711821326022  221  
Apr 201344421815284344   772130411558243   2    584226156933683  221  
Jan 20133861981449238112  66312708248166        4881991236727841 221  
Oct 201239118212671345   32112308653214   22   4501609751303   22   
Jul 201238016310964374   22112567848175        4271458547171   22   
Apr 2012394168111703062  551127793472151       465196133743262  22   
Jan 20123601621146931121  54113399847236   22   474193120612883  331  
Oct 20113771389857265   22113089852195   11   4071398545172   11   
Jul 201130512082492232  22  2388447212        38213786461631  11   
Apr 20112551026335161   21  2457531101        2829560278         
Jan 2011259906142131   22112629147186        2739352265         
Oct 2010242886134101   22112387132101        25475371992        
Jul 2010243906336111   33112437745185        24180472210    11   
Apr 201026383482071   221 25391461451       22471391551   11   
Jan 20102468656297   11  2207535151        2105732184221 11   
Oct 2009264896334121   11  2296539152        2176139174111 11   
Jul 200926110564391121  11  28210857195        2376335186    11   
Apr 200925097572771   11  2709741162        24870361782        
Jan 20092718855291321  11  27283461741       2497343206         
Oct 2008258955235142   11  27010052225        25381401981        
Jul 20082481116631131   11  27710864249        2807840204         
Apr 2008224946627122   22  2849660315        2497647249         
Jan 20082371096936191   11  2689453213        2488253281231       
Oct 200722411068362051  11  2609861235        244955024102        
Jul 20071907456301442  43  1996533179        224805327112        
Apr 2007201866034132   11  2076542205        180563723102        
Jan 2007176614525821      1907032142        15256361782        
Oct 200614448271151       129432392        12543221041        
Jul 200614955312071       1425126121        912620104         
Apr 2006161603520821      109341662        592014832        
Jan 200611437251162       106291441        54188411        
Oct 20059933178211      5313321        3211541         
Jul 2005843018105       34642         184111    1    
Apr 2005561810221       2643          16652          
Jan 20054394         101           2111          
Oct 2004471610421       1652          31            
Jul 2004331386        101           21            
Apr 2004592620104       20541         4             
Jan 2004119531       5            1             
Oct 200343311       3                          
Jul 20035                                     
Apr 2003           1                          
Jan 20032          31                         
Oct 2002                                      
Jul 20021                                     
Apr 20021                                     
Jan 2002                                      

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
117,670100.0%659,181100.0%
36,29335.6%642,48497.5%
103,66720.8%627,28295.2%
321,82410.3%595,23090.3%
1007904.5%537,17481.5%
3163201.8%456,02069.2%
10001110.6%341,71451.8%
3162240.1%206,19031.3%
1000030.0%89,38513.6%
3162310.0%57,9228.8%

 

50 autores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
ShirayukiUC1 057,9222,70393,4682,139May 04, 201224311,909118--
KghblnUC4 09,558334,9005Oct 08, 2009337088---
Liuxinyu970226UC5 08,6053418,02457Dec 22, 2013183465515--
OmotechoUC7+27,61280914,6471,223Jun 08, 2014166625---
Wrecked 'im? Damn near killed 'im!UC9-16,97899--Feb 19, 201321405---
WargoUC10 06,6636416,202177Jan 17, 200840003881--
KrinkleUC12 06,213143,66627Feb 19, 20103236137---
ChrumpsUC13+15,406218,35532Oct 24, 200644501,45710--
AKlapper (WMF)UC15 04,973951,53719Jan 10, 2013218047---
Jdforrester (WMF)UC19 03,789162,0692May 22, 201224131081--
Yaron KorenUC20 03,645175,89732May 06, 2007425696---
Wladek92UC24+13,3373656,2391,069Feb 20, 2014177417---
Mainframe98UC25-12,998114,4465Oct 17, 20151170991--
EduaddadUC28 02,566624,92582Mar 10, 20161025431--
Saederup92UC31+172,3616264,5921,027Dec 30, 2017365688167--
LegoktmUC35-12,25521,0117Jun 10, 20083855119---
Greg (WMF)UC36-12,22210122-Feb 19, 201321403703--
Quiddity (WMF)UC37 02,198131,1774Sep 27, 20131920682--
Ciencia Al PoderUC39-12,183264,82918Jun 15, 2007421626---
Hamilton AbreuUC42-12,020349,89142Nov 14, 2009333333---
MaxSemUC43-11,93121,686-Jun 08, 2006458844---
ClumpUC44+51,8961631,671184Mar 02, 20151399113--
ZFilipin (WMF)UC47-21,7808121-Oct 02, 20122280612--
JdlrobsonUC57 01,61120326-Feb 29, 20122496951--
SSastry (WMF)UC59 01,5307257-May 31, 20122404961--
Amire80UC63 01,45542,91010Mar 04, 2008395338---
YurikUC64 01,43411,0791Nov 14, 2005479489---
SSethi (WMF)UC65 01,4241329326Oct 19, 2016802482--
TacsipacsiUC66+21,421251,70768Mar 18, 2014174841--
Smalyshev (WMF)UC68-11,40225044Nov 29, 20141492115---
Tgr (WMF)UC69 01,399886412Nov 24, 2013186284---
EduardogobiUC70+31,393475,37448Jul 18, 20151261382--
Momo50WMUC72 01,386102,759133Dec 20, 2014147126---
Alexandr EfremovUC78 01,26722,1532Feb 16, 2011287472---
CKoerner (WMF)UC85+21,219207278Jan 29, 201610661524--
MarkAHershbergerUC89 01,18712,291-Nov 23, 2009332462---
SamanthaNguyenUC90 01,170542244Apr 08, 2014172771---
NikerabbitUC91 01,16441,2443Oct 25, 20054814381--
BDavis (WMF)UC92+21,16412464-Jul 30, 2013197939---
Pginer-WMFUC93+21,1611217211Apr 11, 2012245432---
CronolioUC96 01,13681,6448Apr 17, 201825739---
JAufrecht (WMF)UC97 01,124753-Apr 07, 20151363146---
JebladUC98+41,113444,149414Apr 13, 20083913301--
KrenairUC102-11,08111,2831Feb 09, 201225164---
SabbutUC106+151,0441781,846544May 19, 20103147122--
DTankersley (WMF)UC107+41,044691351Jan 19, 20161076552--
Rfarrand (WMF)UC117 091515120-Jul 24, 2013198570---
BawolffUC119-189721,8491May 05, 2006462241---
Peachey88UC122 086011,278-Feb 07, 2009361324---
WaldirUC123 08573818-Dec 02, 2008368019---

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
MacofeUC221,042May 04, 20141701Aug 29, 2017488
Fabsouza1UC310,421Mar 28, 20112834Jun 05, 2016938
IoannisKydonisUC67,682Dec 17, 20151109Feb 02, 20161062
Nemo bisUC87,567Feb 03, 20093617Nov 25, 201835
GuillomUC116,261Jan 20, 20064727Nov 30, 2016760
Qgil-WMFUC145,396Mar 29, 20112833Oct 16, 201875
IAlexUC164,331Dec 21, 20064392Aug 01, 20141612
KaganerUC174,199Aug 22, 20054878Nov 14, 201846
SPage (WMF)UC183,986Jul 19, 20122355Dec 03, 20151123
HappyDogUC213,569Mar 28, 20045390May 07, 2018237
Jeroen De DauwUC223,518Jul 19, 20093451Sep 04, 2018117
LeucosticteUC233,517Jun 22, 20122382Dec 17, 20141474
GWickeUC262,685Jan 13, 20103273Sep 21, 2017465
Jack PhoenixUC272,572Feb 05, 20074346Sep 08, 2018113
RobLa-WMFUC292,461Aug 02, 20103072Oct 27, 2016794
Steven (WMF)UC302,455Feb 03, 20112887Sep 23, 20141559
TacticaUC322,355Apr 02, 20161002Jan 05, 2018359
Vodnokon4eUC332,339Nov 10, 20141511Jul 27, 2018156
SumanahUC342,277Feb 24, 20112866Feb 25, 20161039
TfincUC382,186Mar 07, 20093585May 13, 2016961

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 88.430 edições foram feitas por usuários anônimos, de um total de 961.629 edições ( 9e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
FuzzyBotUC1149,861Feb 12, 20122513Dec 31, 2018-2,60991
Extension matrix botUC248,159Feb 19, 20103236Oct 16, 2013190171-
AnankeBotUC32,639Jul 18, 20112722Jul 20, 2015125912-
MyBotUC42,609Dec 30, 20093287Jun 16, 20151293--
AnalyticslogbotUC51,642Dec 11, 20122210Dec 22, 201883-
TheStoneBotUC61,200Oct 19, 2017437Dec 27, 2017368--
External Link to Interwiki (Bot)UC71,080Dec 26, 20112561Jan 22, 20122534--
SteinsplitterBotUC8814Nov 29, 20141492Jun 07, 2016936--
Community Tech botUC9789Feb 09, 2017689Feb 15, 201768333-
タチコマ robotUC10772Jun 07, 20122397Jan 01, 2017728--
SieBotUC11659Feb 09, 20083977Jan 19, 20103267--
RevibotUC12605Oct 09, 20141543Dec 07, 201823--
Peachey88 (Flood)UC13438May 14, 20112787Dec 29, 2013182753-
Reedy BotUC14433Mar 06, 20151395Mar 06, 20151395--
DuesenBotUC15426Mar 06, 20074317Jun 11, 20083854--
LegobotUC16322May 24, 20151316Oct 13, 20151174--
SamoaBotUC17290Jan 27, 20151433Jul 22, 20151257--
DexbotUC18259Sep 20, 20131927May 31, 20141674--
KrenairBotUC19241Jun 18, 20122386Aug 13, 20122330--
BaseBotUC20148Jan 10, 20132180Jan 10, 20132180--
DougBotUC21116Dec 04, 20112583Dec 10, 20112577--
CommonsDelinkerUC22110Dec 22, 20083660Dec 23, 20187--
MiszaBotUC2392Jan 14, 20122542Jun 08, 201320319-
(1.VSNCT)BotUC2457Dec 23, 20102929Feb 07, 20122518--
Flow talk page managerUC2547Jul 10, 20151269Nov 21, 201740413-
MW RFC botUC2639Sep 17, 20131930Mar 11, 20151390--
Diego Grez BotUC2735Jul 07, 20103098Jul 13, 20103092--
RobBotUC2821Jul 16, 20074185Jul 16, 20074185--
InvadibotUC2918Apr 27, 20132073Apr 27, 20132073--
MainframeBotUC3016Jun 03, 2017575Jun 03, 2017575--
FearowBotUC319Jul 15, 20074186Jul 15, 20074186--
ExtensionListBotUC329Feb 09, 20093611Mar 02, 20093590--
DfergbotUC338Feb 16, 20112874Feb 16, 20112874--
JVbotUC347Mar 22, 20161013Mar 22, 20161013--
XqbotUC355Nov 02, 20122249Nov 02, 20122249--
WikiApiaryUC364Aug 10, 20141603Aug 10, 20141603--
Ryush botUC373Apr 05, 20141730Apr 05, 201417301-
TulsibotUC383Jun 30, 20151279Jun 30, 20151279--
MABotUC393Jun 25, 2018188Jun 25, 2018188--
Ttibot~mediawikiwikiUC402May 03, 20093528May 03, 20093528--
MobilefrontendUC412Apr 30, 20122435Apr 30, 20122435--
ReubotUC422Jul 31, 20141613Jul 31, 20141613--
WikimetricsBotUC432Sep 23, 20141559Sep 23, 20141559--
AGbotUC442Sep 19, 20151198Sep 19, 20151198--
CeebotUC452Mar 22, 20161013Mar 22, 20161013--
MediaWiki defaultUC461Oct 18, 20074091Oct 18, 200740911-
AlexbotUC471Jan 19, 20083998Jan 19, 20083998--
ThenobotUC481May 07, 20083889May 07, 20083889--
TradebotUC491Dec 23, 20083659Dec 23, 20083659--
GhalyBotUC501Feb 09, 20093611Feb 09, 200936111-

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJpgOgaOgvPdfPngSvgTiffWebmXcfXls
Dec 201822 k26 k1,5 k3,9 k1,0 k6,8 k4,4 k17 k19 k9,1 k1,3 k383   171637171712,9 k12321411
Nov 201822 k26 k1,5 k3,9 k1,0 k6,8 k4,4 k17 k19 k8,9 k1,2 k381   171637171712,9 k12021411
Oct 201822 k26 k1,4 k3,9 k1,0 k6,7 k4,3 k17 k18 k8,8 k1,1 k374   171634171712,9 k11921311
Sep 201822 k25 k1,4 k3,9 k1,0 k6,6 k4,3 k17 k18 k8,7 k1,1 k369   171629171712,9 k11921311
Aug 201822 k25 k1,4 k3,9 k1,0 k6,5 k4,3 k17 k18 k8,7 k1,1 k368   171628171712,9 k11921311
Jul 201821 k25 k1,4 k3,9 k1,0 k6,5 k4,2 k16 k18 k8,7 k1,0 k365   171627171692,9 k11821311
Jun 201821 k25 k1,4 k3,9 k1,0 k6,4 k4,1 k16 k18 k8,6 k995362   171626171692,9 k11521311
May 201821 k25 k1,4 k3,8 k1,0 k6,4 k4,1 k16 k18 k8,6 k988356   171625171692,8 k11321311
Apr 201821 k24 k1,4 k3,8 k1,0 k6,3 k4,1 k16 k18 k8,5 k982356   171625171692,8 k11221311
Mar 201820 k24 k1,3 k3,8 k1,0 k6,3 k4,0 k16 k18 k8,5 k981355   171624171672,8 k11221311
Feb 201820 k24 k1,3 k3,8 k1,0 k6,2 k4,0 k16 k17 k8,4 k950353   171617171662,8 k11221311
Jan 201820 k24 k1,3 k3,8 k1,0 k6,2 k4,0 k16 k17 k8,4 k941352   171617171662,8 k11221311
Dec 201720 k23 k1,3 k3,8 k1,0 k6,2 k3,9 k16 k17 k8,4 k933351   171615171652,8 k11121311
Nov 201720 k23 k1,3 k3,8 k1,0 k6,2 k3,9 k16 k17 k8,3 k919349   171614171652,8 k11121311
Oct 201719 k23 k1,3 k3,8 k1,0 k6,2 k3,9 k16 k17 k8,3 k902349   170614171652,8 k11121311
Sep 201719 k23 k1,3 k3,8 k1,0 k6,1 k3,8 k16 k17 k8,3 k899348   170614171652,8 k11121311
Aug 201719 k22 k1,3 k3,7 k1,0 k6,1 k3,8 k16 k17 k8,2 k895346   170613171652,8 k11121311
Jul 201719 k22 k1,3 k3,7 k1,0 k6,0 k3,7 k16 k17 k8,2 k895342   170613171652,7 k11121311
Jun 201719 k22 k1,3 k3,7 k1,0 k6,0 k3,7 k16 k17 k8,2 k888336   170613171652,7 k11121311
May 201718 k22 k1,3 k3,7 k9955,9 k3,7 k16 k17 k8,1 k856323   170612171652,7 k11121311
Apr 201718 k22 k1,3 k3,7 k9705,9 k3,6 k16 k17 k8,1 k856320   170610171652,7 k10921311
Mar 201718 k21 k1,3 k3,7 k9705,9 k3,6 k16 k17 k8,0 k853315   170610171632,7 k10921311
Feb 201718 k21 k1,3 k3,6 k9705,8 k3,5 k16 k17 k8,0 k848312   170601171562,7 k10921311
Jan 201718 k21 k1,3 k3,6 k9435,8 k3,5 k16 k17 k7,9 k841311   170601171552,7 k10921311
Dec 201617 k21 k1,3 k3,6 k9345,6 k3,4 k15 k16 k7,8 k829311   170599171552,7 k10821311
Nov 201617 k21 k1,3 k3,6 k9265,6 k3,4 k15 k16 k7,7 k826309   169595171552,6 k10821311
Oct 201617 k20 k1,2 k3,6 k9185,5 k3,4 k15 k16 k7,7 k819306   169593171542,6 k10421311
Sep 201617 k20 k1,2 k3,5 k9155,4 k3,3 k15 k16 k7,6 k803304   169577171542,6 k10421311
Aug 201616 k20 k1,2 k3,5 k9155,4 k3,3 k15 k16 k7,6 k800289   163572171522,6 k10421311
Jul 201616 k20 k1,2 k3,5 k9155,4 k3,3 k15 k16 k7,5 k797281   161569171512,6 k10421311
Jun 201616 k20 k1,2 k3,5 k9055,3 k3,2 k14 k16 k7,5 k796273   161569171512,6 k10421311
May 201616 k19 k1,2 k3,5 k9045,2 k3,2 k14 k16 k7,4 k793272   161566171512,5 k10421311
Apr 201615 k19 k1,2 k3,4 k9035,2 k3,1 k14 k15 k7,4 k786267   161563171362,5 k10421311
Mar 201615 k19 k1,2 k3,4 k8975,1 k3,1 k14 k15 k7,3 k785267   161561171362,5 k10321311
Feb 201615 k19 k1,2 k3,4 k8905,1 k3,0 k14 k15 k7,3 k781265   161560171352,5 k10121311
Jan 201615 k19 k1,2 k3,4 k8885,0 k3,0 k14 k15 k7,2 k770263   160554171322,5 k10121311
Dec 201515 k18 k1,2 k3,3 k8885,0 k3,0 k14 k15 k7,1 k764257   160553171322,5 k10121311
Nov 201514 k18 k1,2 k3,3 k8865,0 k2,9 k13 k15 k6,9 k756243   158552171322,5 k10121311
Oct 201514 k18 k1,2 k3,3 k8834,9 k2,9 k13 k15 k6,7 k713241   158546171322,5 k10121311
Sep 201514 k18 k1,2 k3,3 k8814,8 k2,9 k13 k15 k6,7 k708239   158541171292,4 k9921311
Aug 201514 k18 k1,2 k3,2 k8764,8 k2,8 k13 k15 k6,7 k685236   158539171282,4 k9921311
Jul 201514 k17 k1,2 k3,2 k8714,8 k2,8 k13 k14 k6,6 k675234   158536171252,3 k9921311
Jun 201513 k17 k1,1 k3,2 k8654,7 k2,7 k13 k14 k6,6 k649230   158530171252,3 k9921311
May 201513 k17 k1,1 k3,1 k8634,7 k2,7 k13 k14 k6,5 k638220   158516171252,3 k9821311
Apr 201513 k17 k1,1 k3,1 k8614,7 k2,6 k12 k14 k6,5 k628218   158511171222,3 k9821311
Mar 201513 k17 k1,1 k3,1 k8614,6 k2,5 k12 k14 k6,3 k603174  8485158509171202,2 k9821311
Feb 201512 k16 k1,1 k3,0 k8614,4 k2,5 k11 k14 k6,2 k587142  5956156503171192,2 k9621311
Jan 201512 k16 k1,1 k3,0 k8584,4 k2,4 k10 k14 k6,2 k548140  10027156497171192,2 k8921311
Dec 201412 k16 k1,1 k3,0 k8334,3 k2,4 k10 k13 k6,1 k437124  9702155495171172,2 k8921311
Nov 201412 k16 k1,1 k2,9 k8324,2 k2,4 k10 k12 k5,9 k395112  10358155492171162,2 k8721311
Oct 201411 k16 k1,1 k2,9 k8294,2 k2,3 k10 k10 k5,8 k390106  11153155485171152,1 k8721311
Sep 201411 k15 k1,0 k2,9 k8014,1 k2,2 k9,5 k9,1 k5,6 k38882  21646155471171112,1 k8721311
Aug 201411 k15 k9812,8 k7994,1 k2,1 k8,8 k5,8 k5,4 k36974  9328155463171112,1 k8421311
Jul 201410 k15 k9632,8 k7964,0 k2,1 k8,3 k5,5 k5,2 k36756  6788155459171112,1 k8311311
Jun 201410 k15 k9552,8 k7944,0 k2,0 k7,9 k5,3 k5,1 k35644  6635155455171092,1 k8311311
May 20149,7 k14 k9382,7 k7893,9 k2,0 k7,6 k5,2 k5,0 k35236  7387155435161092,0 k8211311
Apr 20149,4 k14 k9242,7 k7843,8 k2,0 k7,3 k5,1 k4,9 k35235  7908155433161092,0 k7811311
Mar 20149,1 k14 k9132,7 k7813,7 k1,9 k6,5 k5,0 k4,9 k35135  7438154430161082,0 k73 1311
Feb 20148,8 k13 k8942,6 k7773,6 k1,8 k5,2 k4,9 k4,8 k34529  6238154403161061,9 k72 1311
Jan 20148,6 k13 k8792,5 k7753,6 k1,8 k5,0 k4,9 k4,8 k34328  6702154397161061,9 k62 1111
Dec 20138,3 k13 k8712,5 k7723,5 k1,7 k4,9 k4,8 k4,7 k34227  6885154393161051,9 k50 9 1
Nov 20138,0 k13 k8632,4 k7693,4 k1,6 k4,7 k4,8 k4,7 k33626  5831151392161041,8 k49 9 1
Oct 20137,7 k12 k8522,4 k7563,4 k1,6 k4,6 k4,8 k4,6 k33524  5333150385161041,8 k48 8 1
Sep 20137,5 k12 k8482,4 k7563,4 k1,6 k4,6 k4,7 k4,5 k31523  4183150383161041,8 k48 8 1
Aug 20137,3 k12 k8432,3 k7553,3 k1,5 k4,5 k4,6 k4,5 k31523  3826150371161031,7 k47 8 1
Jul 20137,1 k12 k8282,3 k7473,3 k1,5 k4,3 k4,6 k4,4 k31323  5854150365161021,7 k47 8 1
Jun 20136,9 k12 k8222,2 k7433,2 k1,2 k4,1 k4,5 k4,3 k31222  3599150361161021,6 k47 8 1
May 20136,7 k11 k8082,2 k7093,1 k1,2 k4,1 k4,5 k4,3 k30422  4866150354161021,6 k47 8 1
Apr 20136,4 k11 k7742,2 k7023,0 k1,2 k3,9 k4,5 k4,2 k30118  3958150350161011,6 k43 6 1
Mar 20136,3 k11 k7562,1 k6973,0 k1,1 k3,9 k4,4 k4,2 k29917  4279150343161001,6 k38 6 1
Feb 20136,1 k11 k7492,1 k6912,9 k1,1 k3,8 k4,4 k4,2 k29517  490415033916971,5 k36 6 1
Jan 20135,9 k11 k7332,0 k6882,9 k1,1 k3,8 k4,4 k4,1 k29316  497015033316961,5 k36   1
Dec 20125,7 k10 k7222,0 k6742,8 k1,1 k3,7 k4,4 k4,1 k29016  330415032916931,5 k36   1
Nov 20125,6 k10 k7022,0 k6682,8 k1,0 k3,6 k4,4 k4,0 k2895  333015032416891,5 k36   1
Oct 20125,4 k10 k6812,0 k6572,8 k1,0 k3,6 k4,3 k4,0 k2865  347315031216891,5 k33   1
Sep 20125,3 k9,9 k6681,9 k6552,7 k9883,6 k4,3 k3,9 k2855  302015030716891,4 k33   1
Aug 20125,1 k9,7 k6651,9 k6422,7 k9663,6 k4,2 k3,9 k2842  365315029116871,4 k31   1
Jul 20125,0 k9,6 k6491,8 k6422,6 k9483,5 k4,2 k3,8 k2802  331615028915871,4 k31   1
Jun 20124,9 k9,5 k6351,8 k6322,6 k9353,5 k4,1 k3,8 k2762  350515028715841,3 k31   1
May 20124,8 k9,3 k5951,8 k6242,6 k9283,5 k4,1 k3,8 k2692  396015028515821,3 k31   1
Apr 20124,6 k9,2 k5851,7 k6102,5 k8843,5 k4,1 k3,7 k2682  358715028313811,2 k31   1
Mar 20124,5 k9,0 k5771,6 k5982,5 k8583,4 k4,1 k3,7 k2652  355815026812791,1 k30   1
Feb 20124,4 k8,8 k5471,5 k5772,4 k8203,4 k4,1 k3,6 k2612  398215026012781,1 k28   1
Jan 20124,2 k8,6 k5141,5 k5742,3 k7893,3 k4,0 k3,6 k2612  428015025612781,1 k26   1
Dec 20114,1 k8,3 k4801,4 k5702,2 k7233,3 k4,0 k3,5 k2592  333914924912781,0 k25   1
Nov 20114,0 k8,1 k4381,4 k5692,2 k7113,2 k4,0 k3,5 k2581  312214924612781,0 k24   1
Oct 20113,9 k7,9 k4341,4 k5442,1 k7093,1 k3,9 k3,4 k2571  2814149244127396822   1
Sep 20113,8 k7,7 k4301,3 k5372,1 k7073,1 k3,9 k3,4 k2521  3078148236 27194022   1
Aug 20113,6 k7,5 k4271,3 k5352,1 k7033,0 k3,8 k3,3 k249   2684148232 27189522   1
Jul 20113,5 k7,3 k4111,2 k5302,0 k6962,9 k3,7 k3,3 k248   2560148222 27085721   1
Jun 20113,4 k7,2 k4021,2 k5302,0 k6822,6 k3,3 k3,2 k247   2301148217 26783720   1
May 20113,2 k7,1 k3851,2 k5271,9 k6612,6 k3,3 k3,1 k242   1936148213 1668219   1
Apr 20113,1 k7,0 k3771,1 k5171,9 k6542,6 k3,3 k3,1 k242   1615148209 1328139   1
Mar 20113,1 k6,8 k3761,1 k5071,9 k6542,6 k3,3 k3,0 k240   2014148198 1307957   1
Feb 20113,0 k6,7 k3731,0 k4871,9 k6522,6 k3,3 k3,0 k240   1837148197 167567   1
Jan 20112,9 k6,5 k3689973191,8 k6512,6 k3,2 k3,0 k226   1709148196 157386   1
Dec 20102,9 k6,4 k3669663171,8 k6502,5 k3,2 k2,9 k169   1509145189  57186   1
Nov 20102,8 k6,3 k3629373171,8 k6502,5 k3,2 k2,9 k162   1853145185  56945   1
Oct 20102,8 k6,1 k3509143051,7 k6092,5 k3,1 k2,8 k162   1395144178  56795   1
Sep 20102,7 k6,0 k3488893031,7 k6052,5 k3,1 k2,8 k162   1657144177  56573   1
Aug 20102,6 k5,8 k3438793021,7 k6022,4 k3,0 k2,8 k148   1490144173  56522   1
Jul 20102,5 k5,7 k3048513021,7 k5942,4 k3,0 k2,7 k148   1418144170  56272   1
Jun 20102,5 k5,6 k2968263021,7 k5882,4 k3,0 k2,7 k148   1434144167  56062   1
May 20102,4 k5,5 k2898152761,7 k5842,4 k3,0 k2,6 k146   1414141161  56042   1
Apr 20102,3 k5,4 k2737922741,6 k5802,3 k3,0 k2,6 k146   1166140159  55842   1
Mar 20102,3 k5,3 k2697802551,6 k5792,3 k2,9 k2,6 k146   1801138154  55792   1
Feb 20102,2 k5,2 k2667652551,6 k5742,2 k2,9 k2,5 k142   1270138152  55662   1
Jan 20102,1 k5,1 k2617552481,6 k5692,2 k2,9 k2,5 k132   1201138151  55572   1
Dec 20092,0 k5,0 k2597432221,5 k5332,1 k2,9 k2,4 k128   1381136150  55482   1
Nov 20092,0 k4,9 k2537352201,5 k5152,0 k2,8 k2,4 k128   1412136149  55412   1
Oct 20092,0 k4,8 k2517192171,4 k5131,9 k2,8 k2,3 k127   1415135148  55272   1
Sep 20092,0 k4,7 k2486962171,4 k5061,9 k2,6 k2,3 k125   1425135147  55052   1
Aug 20091,9 k4,5 k2476792151,4 k5031,9 k2,6 k2,2 k124   1661134141  54952   1
Jul 20091,9 k4,4 k2456672151,4 k4971,9 k2,6 k2,2 k119   1876133137  44892   1
Jun 20091,9 k4,2 k2436422131,4 k4961,8 k2,5 k2,1 k117   1361128136  44702   1
May 20091,8 k4,1 k2396172131,3 k4941,8 k2,5 k2,0 k117   1384128130  44512   1
Apr 20091,8 k4,0 k2356031981,3 k4831,8 k2,5 k2,0 k117   1298128128  44392   1
Mar 20091,7 k3,8 k2315861971,3 k4801,8 k2,5 k1,9 k117   1550128118  44322   1
Feb 20091,6 k3,6 k2285751911,3 k4691,8 k2,4 k1,9 k117   1371127116  34252   1
Jan 20091,6 k3,5 k2055581881,2 k4481,7 k2,3 k1,9 k115   1535127109  34152   1
Dec 20081,5 k3,4 k2035371871,2 k4411,7 k2,3 k1,8 k115   1554125104  34012   1
Nov 20081,4 k3,2 k1975261651,2 k4041,7 k2,1 k1,8 k114   1320123101  33952   1
Oct 20081,3 k3,1 k1945141651,2 k3991,7 k2,1 k1,7 k113   1501 2395  23912   1
Sep 20081,3 k3,0 k1925011611,2 k3901,6 k2,1 k1,7 k106   1399 2391  23822   1
Aug 20081,2 k2,9 k1904931541,2 k3801,5 k1,9 k1,6 k88   1821 2390  23752   1
Jul 20081,1 k2,7 k1724751411,2 k3751,5 k1,9 k1,6 k82   1323 2385  23622   1
Jun 20081,1 k2,6 k1704611381,1 k3731,4 k1,8 k1,5 k81   1424 2382  23512   1
May 20081,1 k2,4 k1654251381,1 k3701,3 k1,8 k1,5 k78   2306 2079  23212   1
Apr 20081,0 k2,3 k1604081211,0 k3551,3 k1,7 k1,4 k67   1421 1978  23071   1
Mar 20081,0 k2,2 k1523901211,0 k3431,2 k1,7 k1,4 k66   1723 1777  22921   1
Feb 20089612,0 k1403561129843411,1 k1,6 k1,3 k48   1739 1668  22681   1
Jan 20089021,9 k124326969502871,0 k1,5 k1,3 k48   1666 1266  22441   1
Dec 20078531,8 k110301939152709121,4 k1,2 k48   1854 1261  22241   1
Nov 20078111,7 k105282888732497411,2 k1,1 k47   1831 1158  22091   1
Oct 20077551,5 k98264838162246691,1 k1,1 k41   2277 1154  21951   1
Sep 20076421,4 k92256737302036259921,0 k36   3249 1149  21921   1
Aug 20076181,3 k872337267318840485496727   2099 1042  11781   1
Jul 20075701,2 k822077264117236775889715   2166 937  11581   1
Jun 20075151,1 k73175685881542817368183   1546 836  11281   1
May 200747397066151675091332567107613   1653 733  11081   1
Apr 200743987860143554591241696827053   1450 730  11031   1
Mar 200741677655123554001061106706363   1394 628  1861   1
Feb 2007395696531175336599856525693   1396 628  1811    
Jan 200736862950935332497806295023   1320 424  1631    
Dec 200635257150855320593685924663   1439 422  1571    
Nov 200634651146795215882625784333   1301 319  1551    
Oct 200628245146635214978595623933   711 310  1481    
Sep 200626340439605213871585473573   808 28  1481    
Aug 200625635437545213566525383341   1163 28  143     
Jul 200624431634455212956515213171   930 27  135     
Jun 200623126930415211545485052941   834 27  131     
May 200621721226395210735414962701   919 27  129     
Apr 200619417626345210133374772471   1698 27  124     
Mar 2006173148192752893327439230    618 27  117     
Feb 2006171118192452873226437204    368 25  116     
Jan 200615792192252823225427193    788 24  115     
Dec 200514673181551683222384170    543  1  113     
Nov 200512658121350613220378154    306  1   12     
Oct 200511842121250533220376141    595  1   11     
Sep 200599279124943291598134    275  1   11     
Aug 200593209114940271495129    753  1   10     
Jul 200565528321918 89116           8     
Jun 2005591 7151618 85108           7     
May 2005591 7 1418 81103           7     
Apr 2005571 5 1316 7994           5     
Mar 2005551 2 95 6288           2     
Feb 2005511 2 85 5972           2     
Jan 2005491 2 75 5969           2     
Dec 2004491 2 75 5460           2     
Nov 2004441   65 5057                 
Oct 200442    65 4918                 
Sep 200441    65 4914                 
Aug 200439    45 456                 
Jul 200436    24 416                 
Jun 200430    14 356                 
May 200428    13 306                 
Apr 200426    13 303                 
Mar 200423     3 232                 
Feb 200420     3 21                  
Jan 200419     3 18                  
Dec 200318     3 16                  
Nov 200315     3 13                  
Oct 200314     2 11                  
Sep 200312     2 10                  
Aug 200312       10                  
Jul 20039       1                  
Jun 20038       1                  
May 20038                          
Apr 20037                          
Mar 20037                          
Feb 20036                          
Jan 20036                          
Dec 20025                          
Nov 20024                          
Oct 20022                          
Sep 20022                          
Aug 20022                          
Jul 20022                          
Jun 20021                          
May 20021                          
Apr 20021                          
Mar 20021                          
Feb 20021                          
Jan 20021                          
Dec 20011                          

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Apr 2002: 1 1 Browser issues with MediaWiki

Jul 2002: 1 1 Simplified table syntax

Nov 2002: 1 4 Dedicated Wikipedia editor

Dec 2002: 1 2 Machine-friendly wiki interface

Jan 2003: 1 1 Dedicated Wikipedia editor

Feb 2003: 1 1 Machine-friendly wiki interface

Mar 2003: 1 2 One-pass parser , 2 1 Browser issues with MediaWiki

May 2003: 1 1 Simplified table syntax

Jun 2003: 1 1 Dynamic dates

Jul 2003: 1 3 Development policy , 2 1 Markup spec/DTD

Aug 2003: 1 2 Markup spec/OCaml , 2 2 Running MediaWiki on Windows , 3 2 Database layout , 4 2 Sites using MediaWiki , 5 1 Browser issues with MediaWiki

Sep 2003: 1 2 Browser issues with MediaWiki , 2 2 Cur table

Oct 2003: 1 2 Wikitext/2003 syntax

Nov 2003: 1 4 Running MediaWiki on Windows , 2 3 MediaWiki development , 3 2 How to become a MediaWiki hacker , 4 2 System administration

Dec 2003: 1 3 Setting user groups in MediaWiki , 2 2 Browser issues with MediaWiki , 3 2 Markup spec/DTD , 4 2 DocBook XML export

Jan 2004: 1 4 MediaWiki development , 2 3 Running MediaWiki on Windows , 3 2 Memcached , 4 2 DocBook XML export , 5 1 Browser issues with MediaWiki

Feb 2004: 1 2 Edit throttling , 2 2 MediaWiki architecture/ja , 3 2 MediaWiki development , 4 1 MediaWiki architecture

Mar 2004: 1 12 Extension Syntax , 2 6 Developers , 3 5 EasyTimeline , 4 5 WYSIWYG editor , 5 3 Markup spec/DTD , 6 2 One-pass parser , 7 1 MediaWiki architecture

Apr 2004: 1 24 Extension Syntax , 2 22 Extension Syntax/Voting , 3 11 Roadmap/Archive , 4 8 Developers , 5 5 Running MediaWiki on Windows , 6 4 MediaWiki feature list , 7 4 Installation , 8 3 Extension Syntax/Example , 9 3 WikiHiero , 10 3 Running MediaWiki on GNU/Linux , 11 2 MediaWiki architecture , 12 1 Browser issues with MediaWiki

May 2004: 1 10 Roadmap/Archive , 2 5 MediaWiki 1.3 comments and bug reports/Resolved , 3 3 EasyTimeline , 4 3 Developers , 5 2 WYSIWYG editor , 6 1 Browser issues with MediaWiki

Jun 2004: 1 6 Developers , 2 4 MediaWiki development , 3 3 MediaWiki architecture , 4 3 Roadmap/Archive , 5 2 Microsoft Word Macros , 6 2 MediaWiki architecture/ja , 7 2 WikiHiero/Test text , 8 2 EasyTimeline/syntax , 9 2 How to become a MediaWiki hacker

Jul 2004: 1 8 Developers , 2 4 Running MediaWiki on Gentoo Linux , 3 4 Running MediaWiki on GNU/Linux , 4 4 Roadmap/Archive , 5 3 How to become a MediaWiki hacker , 6 2 Possible uses of MediaWiki , 7 2 Configuration tips and tricks , 8 2 Release notes/1.2 , 9 2 Compression , 10 2 Setting user groups in MediaWiki , 11 1 Browser issues with MediaWiki

Aug 2004: 1 5 Developers , 2 4 Guide to setting up interwiki linking , 3 4 Roadmap/Archive , 4 4 Sites using MediaWiki , 5 3 Robots.txt , 6 2 MediaWiki 1.3 , 7 2 Release notes/1.2 , 8 2 Setting user groups in MediaWiki , 9 2 Wik2dict , 10 2 EasyTimeline , 11 2 Wikitext , 12 1 Change the name of the wiki

Sep 2004: 1 8 Developers , 2 7 Sites using MediaWiki , 3 4 EasyTimeline , 4 4 Wikidata/2005 proposal , 5 3 Installation , 6 3 Running MediaWiki on Windows , 7 3 System administration , 8 2 MediaWiki 1.3 , 9 2 Guide to setting up interwiki linking , 10 2 How to become a MediaWiki hacker/fr , 11 2 How to become a MediaWiki hacker

Oct 2004: 1 10 Sites using MediaWiki , 2 6 Developers , 3 6 Wikidata/2005 proposal , 4 4 Proposed Database Schema Changes/October 2004 , 5 3 Security , 6 3 Wikitext , 7 2 MediaWiki 1.3 , 8 2 MediaWiki architecture/ja , 9 2 Compression , 10 2 Installation , 11 2 Preventing access

Nov 2004: 1 12 Firefox toolbar , 2 8 Sites using MediaWiki , 3 4 MediaWiki 1.3 , 4 4 Installation , 5 4 Firefox toolbar/fr/templates , 6 4 Roadmap/Archive , 7 3 Developers , 8 3 How to become a MediaWiki hacker , 9 3 Firefox toolbar/nl/templates , 10 3 Firefox toolbar/en/templates , 11 2 MediaWiki architecture , 12 2 Apache configuration , 13 2 MediaWiki reviews , 14 2 Running MediaWiki on Windows , 15 2 LDAP Authentication

Dec 2004: 1 5 Sites using MediaWiki , 2 3 Roadmap/Archive , 3 2 Compression , 4 2 My MediaWiki Site was hacked. How? What should I do? , 5 2 MediaWiki feature list , 6 2 Firefox toolbar , 7 1 MediaWiki 1.3

Jan 2005: 1 8 Sites using MediaWiki , 2 5 Developers , 3 4 MediaWiki feature list , 4 2 Pywikibot/touch.py , 5 2 Setting user groups in MediaWiki , 6 2 Email notification/FAQ

Feb 2005: 1 7 Sites using MediaWiki , 2 5 MediaWiki feature list , 3 5 Firefox toolbar , 4 3 Developers , 5 3 Running MediaWiki on Windows , 6 3 Roadmap/Archive , 7 2 Alternative parsers , 8 2 Installation , 9 2 Running MediaWiki on Debian GNU/Linux , 10 2 Firefox toolbar/zh-cn/UI , 11 2 Firefox toolbar/sk/code , 12 2 Firefox toolbar/sk/UI , 13 2 Firefox toolbar/pt-br/code , 14 1 MediaWiki 1.3

Mar 2005: 1 7 Firefox toolbar , 2 7 Sites using MediaWiki , 3 4 Fulltext search engines , 4 4 MediaWiki feature list , 5 3 Pywikibot , 6 3 Wikidata/2005 proposal , 7 2 Pywikibot/interwiki.py , 8 2 MediaWiki development , 9 2 EasyTimeline/syntax , 10 2 Extensions FAQ , 11 2 Running MediaWiki on FreeBSD , 12 2 Firefox toolbar/ja/templates , 13 2 Firefox toolbar/it/code , 14 2 Firefox toolbar/it/UI , 15 1 MediaWiki 1.4

Apr 2005: 1 8 Sites using MediaWiki , 2 3 Fulltext search engines , 3 3 External editors , 4 3 Alternative parsers , 5 3 MediaWiki feature list , 6 2 MediaWiki architecture , 7 2 Administrators/ru , 8 2 Wik2dict , 9 2 Page access restriction , 10 2 Graph/Legacy , 11 2 Gis/bugs , 12 2 Installing MediaWiki on SourceForge.net , 13 1 Pywikibot/interwiki.py

May 2005: 1 12 Sites using MediaWiki , 2 4 MediaWiki extensions , 3 3 Guide to setting up interwiki linking , 4 3 Anti-spam features , 5 3 MediaWiki feature list , 6 3 Developers , 7 3 Firefox toolbar , 8 3 Email notification , 9 2 MediaWiki reviews , 10 2 WYSIWYG editor , 11 2 Tag extensions , 12 1 Firefox toolbar/uk-ua/templates

Jun 2005: 1 11 Sites using MediaWiki , 2 5 MediaWiki extensions , 3 3 MediaWiki 1.5 , 4 3 External editors , 5 3 Developers , 6 3 How to become a MediaWiki hacker , 7 3 Installation , 8 2 MediaWiki 1.4 , 9 2 Pywikibot/touch.py , 10 2 Pywikibot , 11 2 Enable TeX , 12 2 Hidden pages , 13 1 Browser issues with MediaWiki

Jul 2005: 1 16 Sites using MediaWiki , 2 13 MediaWiki , 3 9 MediaWiki extensions , 4 5 Installation , 5 4 WYSIWYG editor , 6 3 MediaWiki 1.5 , 7 3 InputBox , 8 2 MediaWiki architecture , 9 2 Fulltext search engines , 10 2 Security , 11 2 External editors , 12 1 MediaWiki Bulk Page Creator

Aug 2005: 1 15 MediaWiki , 2 8 Sites using MediaWiki , 3 5 MediaWiki extensions , 4 4 InputBox , 5 4 Installing MediaWiki on SourceForge.net , 6 4 How to become a MediaWiki hacker/de , 7 4 Tag extensions , 8 4 Localisation , 9 3 Guide to setting up interwiki linking/fr , 10 3 Blahtex/Bugs in browser MathML support , 11 3 Blahtex/Bugs and feature requests , 12 3 How to become a MediaWiki hacker/sr , 13 3 How to become a MediaWiki hacker/fr , 14 3 Extensions FAQ , 15 3 Wikidata/2005 proposal , 16 3 Installation , 17 3 Installation on Uniform Server (Windows) , 18 3 Running MediaWiki on Windows , 19 3 Running MediaWiki on Debian GNU/Linux , 20 3 Database layout , 21 3 MediaWiki/de , 22 3 Download , 23 2 Running MediaWiki on Solaris 9 , 24 2 QuickWMS , 25 2 Pywikibot

Sep 2005: 1 8 Sites using MediaWiki , 2 7 Installation , 3 4 External editors , 4 3 InputBox , 5 3 MediaWiki extensions , 6 3 Installation on Uniform Server (Windows) , 7 3 System administration , 8 3 LocalSettings.php , 9 3 Documentation , 10 2 Security , 11 2 External editors/fr , 12 2 EasyTimeline/syntax , 13 2 Blahtex/Embedding Blahtex in MediaWiki , 14 2 Installing MediaWiki on SourceForge.net , 15 2 MediaWiki feature list , 16 1 MediaWiki 1.5

Oct 2005: 1 9 Sites using MediaWiki , 2 6 Installation , 3 4 Developers , 4 4 MediaWiki extensions , 5 4 Localisation , 6 4 1.6 image storage , 7 4 Project of the Month Questionnaire , 8 4 Download , 9 3 External editors/fr , 10 3 Blahtex/Bugs in browser MathML support , 11 3 Blahtex , 12 3 Extensions FAQ , 13 3 Upgrading MediaWiki , 14 3 Interface/Sidebar , 15 3 Configuration settings , 16 3 Documentation/fr , 17 3 MediaWiki/fr , 18 3 Documentation , 19 2 MediaWiki 1.3 , 20 2 MediaWiki 1.4 , 21 2 MediaWiki 1.5 , 22 2 MediaWiki 1.6 , 23 2 MediaWiki architecture , 24 2 Edit throttling , 25 2 Customizing edit toolbar

Nov 2005: 1 18 Sites using MediaWiki , 2 6 Upgrading MediaWiki , 3 5 Installation , 4 4 Wikidata/2005 proposal , 5 4 LocalSettings.php , 6 4 Localisation , 7 3 MediaWiki extensions , 8 3 NiceCategoryList , 9 3 GraphViz/v0.9 , 10 3 $wgGroupPermissions , 11 3 Download/fr , 12 2 External editors , 13 2 Anti-spam features , 14 2 EasyTimeline/syntax , 15 2 PurgePage , 16 2 Rdf , 17 2 Cite , 18 2 Running MediaWiki on Solaris 10 , 19 2 Interwiki , 20 2 LDAP Authentication , 21 2 Database layout , 22 1 Running MediaWiki on Solaris 9

Dec 2005: 1 15 Sites using MediaWiki , 2 9 Localisation , 3 8 Sites using MediaWiki/en , 4 5 Cite/Cite.php/fr , 5 5 Cite/Cite.php , 6 5 Installation , 7 5 How does MediaWiki work? , 8 4 Developers , 9 4 Configuration settings , 10 3 Setting user groups in MediaWiki , 11 3 Tasks , 12 3 MediaWiki extensions , 13 3 Cite/Cite.php/de , 14 3 Interface/Sidebar , 15 3 Communication , 16 2 Pywikibot/upload.py , 17 2 External editors , 18 2 Anti-spam features , 19 2 Hidden pages , 20 2 Installing MediaWiki on SourceForge.net , 21 2 MediaWiki feature list , 22 2 WYSIWYG editor , 23 2 How to become a MediaWiki hacker , 24 2 LastUserLogin , 25 1 MediaWiki 1.5

Jan 2006: 1 14 Sites using MediaWiki , 2 9 Spam Filter , 3 7 Cite/Cite.php , 4 4 Multilingual MediaWiki , 5 3 Reduce size of the database , 6 3 Anti-spam features , 7 3 Blahtex/Bugs/Bugs in BlahtexWiki , 8 3 MediaWiki extensions , 9 3 Special pages , 10 3 Tag extensions , 11 3 Cite , 12 3 Running MediaWiki on Debian GNU/Linux , 13 3 Preventing access , 14 3 Localisation , 15 3 Sites using MediaWiki/fr , 16 3 MediaWiki/pt , 17 3 MediaWiki/zh , 18 2 Pywikibot , 19 2 Customizing edit toolbar , 20 2 Namespace manager , 21 2 Administrators , 22 2 Guide to setting up interwiki linking , 23 2 Alternative parsers , 24 2 Hidden pages , 25 2 Blahtex/Embedding Blahtex in MediaWiki

Feb 2006: 1 13 Sites using MediaWiki , 2 6 Cite/Cite.php , 3 6 Localisation , 4 4 Sites using MediaWiki/en , 5 3 Reduce size of the database , 6 3 Blahtex , 7 3 Installation , 8 3 Preventing access , 9 3 Moving a wiki , 10 3 Sites using MediaWiki/multilingual , 11 3 MediaWiki/fr , 12 2 Pywikibot/redirect.py , 13 2 Spam Filter , 14 2 Page access restriction , 15 2 Blahtex/Embedding Blahtex in MediaWiki , 16 2 Blahtex/Compatibility , 17 2 Blahtex/Bugs/Bugs in browser MathML support/MathPlayer , 18 2 Blahtex/Bugs/Bugs in blahtex itself , 19 2 Blahtex/Bugs/Bugs in BlahtexWiki , 20 2 Installation/Creating system accounts , 21 2 InstantCommons , 22 2 Developers , 23 2 MediaWiki extensions , 24 2 Special pages , 25 2 Secure HTML

Mar 2006: 1 14 Cite/Cite.php , 2 11 Sites using MediaWiki , 3 6 Installation on Uniform Server (Windows) , 4 6 Interface/Sidebar , 5 5 Very short URL , 6 4 External editors , 7 4 Spam Filter , 8 4 Blahtex , 9 4 Extensions FAQ , 10 4 Tag extensions , 11 4 Sites using MediaWiki/en , 12 4 Configuration settings , 13 3 MapPoints , 14 3 Setting user groups in MediaWiki , 15 3 Job queue , 16 3 Inline SVG extension , 17 3 Inline SVG extension , 18 3 Forum extension , 19 3 Installing MediaWiki on SourceForge.net , 20 3 MediaWiki extensions , 21 3 Installation , 22 3 $wgUrlProtocols , 23 2 Possible uses of MediaWiki , 24 2 Pywikibot/catall.py , 25 2 Simplified table syntax

Apr 2006: 1 18 Google Summer of Code/2006 , 2 10 Sites using MediaWiki , 3 7 FAQ , 4 7 Sites using MediaWiki/en , 5 6 Pywikibot , 6 6 Cite/Cite.php , 7 6 Upgrading to 1.6 , 8 6 Download from SVN , 9 6 Configuration settings , 10 5 Extensions/Wanted Extensions , 11 5 Important Release Notes , 12 4 VBulletin/Users Integration , 13 4 Installation , 14 4 LDAP Authentication , 15 4 Email notification , 16 4 Wiki family , 17 4 Hooks , 18 4 $wgSitename , 19 3 Email authentication before editing , 20 3 External editors , 21 3 Administrators , 22 3 Subversion , 23 3 FCKeditor (by Mafs) , 24 3 WYSIWYG editor , 25 3 Installation on Uniform Server (Windows)

May 2006: 1 17 FAQ , 2 10 Google Summer of Code/2006 , 3 7 Preventing access , 4 7 Markup spec , 5 6 Localisation , 6 5 FCKeditor (by Mafs) , 7 5 Wiki family , 8 5 Upgrading MediaWiki , 9 5 Sites using MediaWiki/en , 10 5 $wgSitename , 11 5 Configuration settings , 12 4 MediaWiki development , 13 4 PageProtection , 14 4 Extensions/Wanted Extensions , 15 4 Installation , 16 4 Sites using MediaWiki/gallery , 17 4 $wgMetaNamespace , 18 3 $wgSMTP , 19 3 DynamicPageList (Wikimedia)/de , 20 3 Blahtex/Bugs/Bugs in browser MathML support/Gecko , 21 3 PageProtection/Sourcecode , 22 3 Developers , 23 3 How to become a MediaWiki hacker , 24 3 StringFunctions , 25 3 DynamicFunctions

Jun 2006: 1 9 FAQ , 2 7 Preventing access , 3 5 Localisation , 4 5 Interface/Sidebar , 5 4 Pywikibot , 6 4 Extensions FAQ , 7 4 Cite/Cite.php , 8 4 ASCIIMath4Wiki , 9 4 $wgMetaNamespace , 10 3 Pywikibot/Compat/Basic use/it , 11 3 External editors , 12 3 Job queue , 13 3 Anti-spam features , 14 3 InputBox , 15 3 How to become a MediaWiki hacker , 16 3 Syntax Highlighting , 17 3 Installation , 18 3 Streamlined Windows Install Guide , 19 3 FAQ/fr , 20 3 File cache , 21 3 Documentation/pl , 22 3 Wiki family , 23 3 Sites using MediaWiki/by size , 24 3 MediaWiki/pl , 25 3 Sites using MediaWiki/en

Jul 2006: 1 15 FAQ , 2 9 Sites using MediaWiki/en , 3 6 Extension requests , 4 6 Upgrading to 1.7 , 5 5 LiquidThreads , 6 5 Sites using MediaWiki/by size , 7 5 Interface/Sidebar , 8 4 Pywikibot , 9 4 Anti-spam features , 10 4 FCKeditor (by Mafs) , 11 4 WYSIWYG editor , 12 4 Preventing access , 13 4 Upgrading to 1.6 , 14 3 Apache configuration , 15 3 Mimetex alternative , 16 3 Job queue , 17 3 Timezone , 18 3 Special pages , 19 3 How to become a MediaWiki hacker , 20 3 Installation , 21 3 Math table , 22 3 SELinux , 23 3 Upgrading to 1.7/de , 24 3 Download from SVN/ja , 25 3 $wgNavigationLinks

Aug 2006: 1 6 Developers , 2 5 FAQ , 3 4 Pywikibot , 4 4 WYSIWYG editor , 5 4 Main page , 6 4 Streamlined Windows Install Guide , 7 4 Preventing access , 8 4 LocalSettings.php , 9 4 Sites using MediaWiki/en , 10 3 DPLforum/old , 11 3 MediaWiki extensions , 12 3 Extension requests , 13 3 Graphical Category Browser , 14 3 Cite/Cite.php , 15 3 Word2MediaWikiPlus , 16 3 Localisation , 17 3 Markup spec , 18 3 Interface/Sidebar , 19 3 Sites using MediaWiki/fr , 20 3 Sites using MediaWiki/de , 21 3 $wgEmergencyContact , 22 3 $wgLogo , 23 3 $wgMetaNamespace , 24 3 Configuration settings , 25 2 Pywikibot/interwiki.py/fr

Sep 2006: 1 10 Community portal , 2 6 Sites using MediaWiki/en , 3 5 External editors , 4 5 Special pages , 5 5 Installation , 6 5 CategoryTree , 7 5 FAQ , 8 5 Configuration settings , 9 4 Contents , 10 4 Interwiki , 11 4 $wgMetaNamespace , 12 3 XFeed - RSS Feed Aggregator , 13 3 Subversion , 14 3 Embed Media , 15 3 DynamicPageList (Wikimedia)/de , 16 3 Main page , 17 3 DynamicPageList2 , 18 3 LocalSettings.php , 19 3 Firefox toolbar , 20 3 Google Maps , 21 3 Bad Image List , 22 3 New User Email Notification , 23 3 Markup spec , 24 3 Hooks , 25 3 $wgEmergencyContact

Oct 2006: 1 7 Sites using MediaWiki/en , 2 5 Special page names , 3 5 Google Maps , 4 5 FAQ , 5 4 User hub , 6 3 Extensions/Wanted Extensions , 7 3 Extension requests , 8 3 GoogleVideo , 9 3 Installation , 10 3 NamespacePermissions , 11 3 DynamicPageList2 , 12 3 Developer account/Subversion , 13 3 SubPageList2 , 14 3 News , 15 3 MediaWiki/ru , 16 3 Short URL , 17 3 Sites using MediaWiki/by size , 18 3 Installation , 19 3 MediaWiki/ko , 20 3 Important Release Notes , 21 2 Microsoft Word Macros , 22 2 Subversion , 23 2 Job queue , 24 2 Embed Media , 25 2 EasyTimeline

Nov 2006: 1 9 Special page names , 2 9 FAQ , 3 6 Very short URL , 4 6 Preventing access , 5 5 Word2MediaWikiPlus , 6 5 Sites using MediaWiki/en , 7 5 Configuration settings , 8 4 Deleteuser , 9 4 Installation , 10 4 Google Custom Search Engine , 11 4 AntiSpoof/Equivalence sets , 12 4 CSS Dropdowns , 13 4 Labeled Section Transclusion , 14 4 Developer account/Subversion , 15 4 Add Button , 16 4 Installation , 17 3 External editors , 18 3 Installation on Uniform Server (Windows) , 19 3 Running MediaWiki on Gentoo Linux , 20 3 QWikiRemarks , 21 3 SelectCategory , 22 3 Submit In Toolbar , 23 3 Ascii Translit , 24 3 DeletedContributions , 25 3 Google Maps/Old versions

Dec 2006: 1 8 Installation , 2 7 FAQ , 3 6 Interwiki , 4 6 Sites using MediaWiki/en , 5 5 Transclusion , 6 5 External editors , 7 5 MakeBot , 8 5 Short URL , 9 4 Job queue , 10 4 Running MediaWiki on Gentoo Linux , 11 4 Preventing access , 12 4 Labeled Section Transclusion , 13 4 Hooks , 14 3 WYSIWYG editor , 15 3 Extension requests , 16 3 Poem , 17 3 Installation on Uniform Server (Windows) , 18 3 Running MediaWiki on Windows , 19 3 LDAP Authentication , 20 3 DynamicPageList2 , 21 3 Pdf Export , 22 3 Word2MediaWikiPlus , 23 3 Urlencode , 24 3 Username Blacklist , 25 3 Snippets/Autoedit

Jan 2007: 1 9 FAQ , 2 8 External editors , 3 8 Sites using MediaWiki/en , 4 6 Pywikibot , 5 6 Parameters to index.php , 6 5 PHPBB/Users Integration , 7 5 LocalSettings.php , 8 5 ImageMap , 9 5 Configuration settings , 10 4 Pywikibot/Compat/Basic use/it , 11 4 Upgrading to 1.9 , 12 4 Labeled Section Transclusion , 13 4 Roadmap/Archive , 14 4 Configuration settings (alphabetical) , 15 4 $wgDefaultSkin , 16 3 Skin projects , 17 3 Spam Filter , 18 3 SpecialUserScore , 19 3 Tasks Extension , 20 3 PageProtectionPlus , 21 3 Developers , 22 3 Special pages , 23 3 Installation , 24 3 Recentchanges table , 25 3 Database layout

Feb 2007: 1 19 FAQ , 2 8 CiteThisPage , 3 8 LocalSettings.php , 4 6 External editors , 5 6 Google Maps , 6 5 Transclusion , 7 5 PHPBB/Users Integration , 8 5 Interface/Sidebar , 9 4 Subversion , 10 4 InputBox , 11 4 Installation , 12 4 Bugzilla , 13 4 Configuration settings (alphabetical) , 14 4 Configuration settings , 15 3 Pywikibot , 16 3 Job queue , 17 3 FCKeditor (by Mafs) , 18 3 StringFunctions , 19 3 Lockdown , 20 3 Hacks , 21 3 Hierarchy , 22 3 Oldimage table , 23 3 Username Blacklist , 24 3 PageSecurity , 25 3 Localisation

Mar 2007: 1 10 Summer of Code 2007/proposals , 2 8 Google Summer of Code/2007 , 3 8 FAQ , 4 6 Transclusion , 5 6 Bugzilla , 6 5 PHPBB/Users Integration , 7 5 LDAP Authentication , 8 5 Security issues with authorization extensions , 9 5 LocalSettings.php , 10 5 Roadmap/Archive , 11 4 Pywikibot , 12 4 Installation , 13 4 Extension hook registry , 14 4 Lockdown , 15 4 DynamicPageList (third-party) , 16 4 VideoFlash , 17 4 MediaWiki on IRC , 18 4 Upgrading , 19 4 Download from SVN , 20 4 Sites using MediaWiki/en , 21 3 Extension requests , 22 3 Special pages , 23 3 SimpleFeed , 24 3 Quiz , 25 3 LDAP Authentication/Generic LDAP Configuration Examples

Apr 2007: 1 9 Firefox bugs affecting MediaWiki , 2 8 Sites using MediaWiki/en , 3 6 Preventing access , 4 6 Google Maps , 5 5 Job queue , 6 5 Installation , 7 5 Localisation , 8 5 FAQ , 9 4 Transclusion , 10 4 MediaWiki feature list , 11 4 Quiz , 12 4 SyntaxHighlight , 13 4 MediaWiki on IRC , 14 4 FAQ/ru , 15 4 Short URL , 16 4 Contents , 17 3 CheckUser , 18 3 InputBox , 19 3 Livelets , 20 3 GeSHiCodeTag , 21 3 Maxlag parameter , 22 3 Plexcel , 23 3 Backing up a wiki , 24 3 DiscussionThreading , 25 3 IncludeArticle

May 2007: 1 8 Transclusion , 2 7 Preventing access , 3 7 Short URL , 4 6 Main page , 5 6 FAQ , 6 5 Installation , 7 5 SyntaxHighlight , 8 5 ImageMap , 9 5 AjaxRatingScript , 10 5 Download from SVN , 11 4 Pywikibot , 12 4 CheckUser , 13 4 Job queue , 14 4 Anysite , 15 4 Quiz , 16 4 LocalSettings.php , 17 4 Sysadmin hub , 18 4 Sites using MediaWiki/en , 19 4 Configuration settings , 20 3 Deleteuser , 21 3 How to become a MediaWiki hacker , 22 3 GeSHiCodeTag , 23 3 MarkdownSyntax , 24 3 $wgAllowCopyUploads , 25 3 Poem

Jun 2007: 1 6 Sites using MediaWiki/en , 2 5 CheckUser , 3 5 Cite/Cite.php , 4 5 FAQ , 5 5 Configuration settings , 6 4 InputBox , 7 4 Developers , 8 4 Invision Power Board Authentication , 9 4 Cropper , 10 4 SysopSidebar , 11 4 Read Restrict , 12 4 PHPBB/Users Integration , 13 4 LDAP Authentication , 14 4 Add Article to Category , 15 4 Interface/Sidebar , 16 3 DiscussionThreading/doc , 17 3 Transclusion , 18 3 Pywikibot , 19 3 MediaWiki extensions , 20 3 Special pages , 21 3 Javascript , 22 3 Namespace , 23 3 BoilerplateSelection , 24 3 Proofread Page , 25 3 MediaFunctions

Jul 2007: 1 10 Developers , 2 6 CheckUser , 3 6 DeletedContributions , 4 6 Sites using MediaWiki/en , 5 6 Configuration settings , 6 5 SpamBlacklist , 7 5 Newuserlog , 8 5 Installation , 9 5 ConfirmEdit , 10 5 AuthDrupal , 11 5 Extensions , 12 4 Pywikibot , 13 4 Multi-select Namespace Search , 14 4 ImageMap (McNaught) , 15 4 WYSIWYG editor , 16 4 Extension requests , 17 4 Tag extensions , 18 4 AutoLink , 19 4 Preventing access , 20 4 MyVariables , 21 4 Labeled Section Transclusion , 22 4 FAQ/ru , 23 4 Short URL , 24 3 Deleteuser , 25 3 InputBox

Aug 2007: 1 12 Extension requests , 2 9 Special pages , 3 8 Sites using MediaWiki/en , 4 7 Installation , 5 6 Preventing access , 6 6 Short URL , 7 6 Configuration settings , 8 5 InputBox , 9 5 LDAP Authentication , 10 5 Extensions , 11 5 Skins , 12 5 FAQ , 13 4 Pywikibot , 14 4 WikiCategoryTagCloud , 15 4 Errors and symptoms , 16 4 Todo Tasks , 17 4 Developers , 18 4 Extensions , 19 4 Sites using MediaWiki/de , 20 3 Transclusion , 21 3 External editors: control files , 22 3 LilyPond , 23 3 $wgExtensionCredits , 24 3 Installation/Creating system accounts , 25 3 Query/ru

Sep 2007: 1 11 Extension requests , 2 9 Short URL , 3 8 FAQ , 4 6 InputBox , 5 6 Page Forms , 6 6 Simple Forms , 7 5 Pywikibot , 8 5 Short URL overview , 9 5 Semantic Google Maps , 10 5 LDAP Authentication , 11 5 Extensions , 12 5 DynamicPageList (third-party) , 13 5 Parameters to index.php , 14 5 OpenID , 15 5 Developer account/Subversion , 16 4 Subversion , 17 4 Tag extensions , 18 4 Cite/Cite.php , 19 4 User rights , 20 4 Security issues with authorization extensions , 21 4 TreeAndMenu , 22 4 CategoryTree , 23 4 Google Maps , 24 4 Skins , 25 3 DiscussionThreading/doc

Oct 2007: 1 13 Toolserver:Main Page , 2 7 User rights , 3 7 Sites using MediaWiki/en , 4 6 Transclusion , 5 5 Toolserver:Template:Tool , 6 5 Toolserver:Main Page/lang , 7 5 Extension requests , 8 5 Renameuser , 9 5 Localisation , 10 5 Short URL , 11 5 Interface/Sidebar , 12 5 FAQ , 13 5 Configuration settings (alphabetical) , 14 4 Toolserver:Query service , 15 4 Job queue , 16 4 Extensions , 17 4 MediaWiki on IRC , 18 4 Sites using MediaWiki/multilingual , 19 4 Configuration settings , 20 3 Toolserver:Главна страна , 21 3 Toolserver:~vvv/yaec.php , 22 3 Toolserver:~luxo/contributions/contributions.php , 23 3 Toolserver:Template:Toolserver url , 24 3 Toolserver:Donate , 25 3 Pywikibot

Nov 2007: 1 12 Toolserver:List of Wikimedia bots , 2 7 Short URL , 3 6 Gadgets , 4 6 User rights , 5 5 Toolserver:Main Page , 6 5 InputBox , 7 5 Extension requests , 8 5 Special pages , 9 4 Toolserver:Main Page/lang , 10 4 Mwbot , 11 4 Ajax , 12 4 SphinxSearch , 13 4 LDAP Authentication , 14 4 Extensions , 15 4 AssertEdit , 16 4 Using custom namespaces , 17 4 FAQ/fr , 18 4 Markup spec/BNF/Article , 19 4 FAQ , 20 4 Sites using MediaWiki/fr , 21 3 Toolserver:Query service , 22 3 Toolserver:Pagina principale , 23 3 Toolserver:IRC bots , 24 3 Pywikibot , 25 3 Mailing lists

Dec 2007: 1 9 Short URL , 2 6 Developers , 3 6 FAQ , 4 6 Configuration settings , 5 5 Job queue , 6 5 Mwbot , 7 4 Toolserver:List of Wikimedia bots , 8 4 MoinMoin , 9 4 Semantic Drilldown , 10 4 DismissableSiteNotice , 11 4 TitleBlacklist , 12 4 Localisation statistics , 13 4 PageCSS , 14 4 Gadgets , 15 4 User rights , 16 4 Localisation , 17 3 Transclusion , 18 3 Pywikibot , 19 3 Administrators , 20 3 DPL Calendar , 21 3 Database layout/ja , 22 3 Localisation statistics/stats , 23 3 Translate , 24 3 LuceneSearch , 25 3 CSS

Jan 2008: 1 13 Short URL , 2 8 Extension requests , 3 7 Developers , 4 7 Page Forms , 5 7 FAQ , 6 7 Sites using MediaWiki/en , 7 5 Special pages , 8 5 Configuration settings , 9 4 Toolserver:Query service , 10 4 Toolserver:List of Wikimedia bots , 11 4 Logo , 12 4 Mwbot , 13 4 Maintenance scripts , 14 4 Cite/Cite.php , 15 4 Localization checks , 16 4 CategoryTree , 17 3 Toolserver:Perl , 18 3 Transclusion , 19 3 Pywikibot , 20 3 Administrators , 21 3 DeezerPlaylist , 22 3 SignDocument , 23 3 WikiHiero , 24 3 CustomCategory , 25 3 Test

Feb 2008: 1 12 Extension requests , 2 7 Toolserver:Main Page , 3 7 FAQ , 4 7 Sites using MediaWiki/en , 5 6 Short URL , 6 6 Configuration settings , 7 5 Toolserver:List of Wikimedia bots , 8 5 Transclusion , 9 4 SubPageList3 , 10 4 EditUser , 11 4 Page Forms , 12 4 Preventing access , 13 4 Lockdown , 14 4 Google Maps/Languages , 15 4 Roadmap/Archive , 16 4 Hooks , 17 4 Configuration settings (alphabetical) , 18 3 Job queue , 19 3 SocialProfile , 20 3 $wgFeed , 21 3 WhiteList , 22 3 Bullet Feed , 23 3 Social Bookmarking , 24 3 TagParser , 25 3 InstantCommons

Mar 2008: 1 17 Google Summer of Code/2008 , 2 7 Search Suggest , 3 7 Extension requests , 4 6 LocalSettings.php , 5 5 SocialProfile , 6 5 ParserFunctions , 7 5 Short URL , 8 5 Hooks , 9 5 FAQ , 10 4 Toolserver:List of Wikimedia bots , 11 4 Toolserver:Main Page , 12 4 Upgrading to 1.12 , 13 4 Backing up a wiki , 14 4 Semantic MediaWiki , 15 4 Interface/Sidebar , 16 3 Search/Old , 17 3 MWSearch , 18 3 Release notes/1.12 , 19 3 Upgrading to 1.12/ja , 20 3 Mw tools , 21 3 ExtraNamespaces , 22 3 Quickbar , 23 3 RSS , 24 3 SubPageList3/SPL3Code , 25 3 InputBox

Apr 2008: 1 10 Extension requests , 2 5 AllBooks , 3 5 Developers , 4 5 DynamicPageList (third-party) , 5 5 LocalSettings.php , 6 4 Toolserver:Main Page , 7 4 Transclusion , 8 4 AWC's Forum , 9 4 Config script , 10 4 Installation guide , 11 4 Interwiki , 12 4 CentralAuth , 13 4 Google Maps , 14 4 FAQ , 15 4 Sites using MediaWiki/en , 16 4 $wgFileExtensions , 17 3 Poll , 18 3 Pywikibot , 19 3 Babel , 20 3 Configure , 21 3 Mibbit , 22 3 AjaxWhosOnline , 23 3 Header Tabs , 24 3 Google Summer of Code/2008 , 25 3 Wiki on a stick

May 2008: 1 9 Review queue , 2 8 Extension requests , 3 6 Configuration settings , 4 5 Anti-spam features , 5 5 Developers , 6 5 SyntaxHighlight , 7 4 Transclusion , 8 4 Pywikibot , 9 4 Multilingual MediaWiki , 10 4 Bugzilla/Notes/164 , 11 4 Gadgets , 12 4 MIME type detection , 13 4 Localisation , 14 4 Roadmap/Archive , 15 4 Sites using MediaWiki/en , 16 4 $wgGroupPermissions , 17 3 Toolserver:Main Page/lang , 18 3 Toolserver:Main Page , 19 3 RestrictiveRights , 20 3 Languages , 21 3 SQLite , 22 3 Lock the database , 23 3 Memcached , 24 3 FAQ/he , 25 3 AWC's Forum

Jun 2008: 1 8 Pywikibot , 2 8 Extension requests , 3 8 Sites using MediaWiki/en , 4 5 EditSimilar , 5 5 CSS , 6 5 Page Forms , 7 5 User rights , 8 5 Parameters to index.php , 9 5 FAQ , 10 4 Toolserver:Main Page , 11 4 Review queue , 12 4 Upgrading to 1.12 , 13 4 ConfirmAccount , 14 4 Cite/Cite.php , 15 4 FlaggedRevs , 16 4 Extension Matrix , 17 4 Bugzilla , 18 4 AntiSpoof , 19 3 Transclusion , 20 3 IM Status/IMStatus.i18n.php , 21 3 Job queue/fr , 22 3 GeoGebra , 23 3 GlobalBlocking , 24 3 Collection , 25 3 User rights (older versions)

Jul 2008: 1 6 Developers , 2 6 Extension requests , 3 6 Sites using MediaWiki/ru , 4 5 Semantic Google Maps , 5 5 Page Forms , 6 4 ConfirmAccount , 7 4 Preventing access , 8 4 User rights , 9 4 Hooks , 10 4 FAQ , 11 3 Toolserver:List of Wikimedia bots , 12 3 Toolserver:Main Page , 13 3 Transclusion , 14 3 Semantic Tasks , 15 3 Lucene-search , 16 3 Properties , 17 3 Proofread Page , 18 3 FlaggedRevs , 19 3 SyntaxHighlight , 20 3 ShareThis , 21 3 Extension Matrix , 22 3 Short URL , 23 3 Oversight , 24 3 Roadmap/Archive , 25 3 Sites using MediaWiki/en

Aug 2008: 1 7 Developers , 2 7 Short URL , 3 6 Extension requests , 4 6 Sites using MediaWiki/en , 5 5 IRC cloaks , 6 5 Suggestions for extensions to be integrated , 7 5 AbuseFilter , 8 5 FlaggedRevs , 9 5 Extension Matrix , 10 4 Upgrading to 1.13 , 11 4 Extension default namespaces , 12 4 GenerateSitemap.php , 13 4 LiquidThreads , 14 4 LuceneSearch , 15 4 Sites using MediaWiki/ru , 16 4 Configuration settings , 17 3 Toolserver:List of Wikimedia bots , 18 3 Pywikibot , 19 3 Category table , 20 3 Release notes/1.13 , 21 3 Pseudo-namespace , 22 3 Upgrading. , 23 3 DumpHTML , 24 3 Babel , 25 3 Randomrootpage

Sep 2008: 1 6 Transclusion , 2 5 IRC cloaks , 3 5 Suggestions for extensions to be integrated , 4 5 Markup spec/DTD , 5 5 Developers , 6 4 Huggle/HistoricalManual , 7 4 Pywikibot , 8 4 Main page/de , 9 4 Restrict access by category and group , 10 4 Extension requests , 11 4 Page Forms , 12 4 Extension Matrix , 13 4 ImageMap , 14 4 Google Maps , 15 4 Hooks , 16 3 NoAnonymous , 17 3 Query/de , 18 3 MeanEditor , 19 3 Roadmap/Archive/entry , 20 3 ShortLinksParser , 21 3 Upgrading to 1.13 , 22 3 WhiteList , 23 3 Semantic Calendar , 24 3 Installation requirements , 25 3 StringFunctions

Oct 2008: 1 15 Extension requests , 2 10 CodeReview/To-do , 3 10 Sites using MediaWiki/en , 4 8 Suggestions for extensions to be integrated , 5 5 Drafts , 6 5 Collection/Wishlist/LQT Archive 1 , 7 5 Cite/Cite.php , 8 4 Making Subversion faster , 9 4 Guide to setting up interwiki linking , 10 4 Extension Matrix , 11 4 VideoFlash , 12 4 Roadmap/Archive , 13 4 Wiki family , 14 3 Toolserver:Servers , 15 3 Transclusion , 16 3 Books about MediaWiki , 17 3 Release notes/pre-1.1.0 , 18 3 CodeReview , 19 3 Header Tabs , 20 3 $wgForeignFileRepos , 21 3 Edit , 22 3 Download/old boxy version , 23 3 How to become a MediaWiki hacker , 24 3 PagesOnDemand , 25 3 FlaggedRevs

Nov 2008: 1 9 PDF Writer/Localization , 2 8 Extension requests , 3 8 FlaggedRevs , 4 6 Extension Matrix , 5 5 CodeReview/To-do , 6 5 Collection/Wishlist/LQT Archive 1 , 7 5 Page Forms , 8 5 Poem , 9 4 MediaWiki Developer Meet-Up 2009 , 10 4 ABC , 11 4 External editors , 12 4 Maintenance , 13 4 SpecialDeleteOldRevisions , 14 4 FAQ , 15 4 Sites using MediaWiki/en , 16 3 Huggle/HistoricalManual , 17 3 Pywikibot , 18 3 APC , 19 3 ExtendedProfile , 20 3 Firefox bugs affecting MediaWiki , 21 3 Making Subversion faster , 22 3 SlippyMap , 23 3 Replace Text , 24 3 Collection , 25 3 Page Forms/Version history

Dec 2008: 1 6 Download/old boxy version , 2 6 FAQ , 3 5 InputBox , 4 4 Differences between Wikipedia, Wikimedia, MediaWiki, and wiki , 5 4 ImageProtection , 6 4 Wikimedia sync script , 7 4 Suggestions for extensions to be integrated , 8 4 Installation guide , 9 4 Extension requests , 10 4 Download , 11 3 Toolserver:Code snippets , 12 3 Windows NTLM LDAP Auto Auth , 13 3 GlobalUserrights , 14 3 Requests for comment/Regex-based blacklist , 15 3 Software bundles , 16 3 MediaWiki Developer Meet-Up 2009 , 17 3 DeletePagePermanently , 18 3 RefreshSpecial , 19 3 Job queue , 20 3 Installing MediaWiki , 21 3 Lists , 22 3 Developers , 23 3 Page Forms , 24 3 Running MediaWiki on Debian or Ubuntu , 25 3 System administration

Jan 2009: 1 34 MediaWiki Developer Meet-Up 2009 , 2 28 Toolserver:New server naming , 3 11 Sites using MediaWiki/en , 4 8 Extension requests , 5 7 External editors , 6 6 DataCenter , 7 6 Skinning/Archive , 8 5 This week's updates , 9 5 Suggestions for extensions to be integrated , 10 4 Pager.php , 11 4 Cite/Cite.php , 12 4 Roadmap/Archive , 13 3 Toolserver:Mail , 14 3 Transclusion , 15 3 FBConnect/FBConnect.i18n.php , 16 3 Uniwiki Layouts , 17 3 Collection/Wishlist/LQT Archive 1 , 18 3 Uniwiki Generic Edit Page , 19 3 AbuseFilter , 20 3 Replace Text , 21 3 Configure , 22 3 Lucene-search , 23 3 $wgForeignFileRepos , 24 3 ParserFunctions , 25 3 Developers

Feb 2009: 1 11 MediaWiki Developer Meet-Up 2009 , 2 10 Extension Matrix , 3 6 Sites using MediaWiki/en , 4 5 Transclusion , 5 5 Google Summer of Code/2009 , 6 5 Collection/Wishlist/LQT Archive 1 , 7 5 Download/old boxy version , 8 5 Bugzilla , 9 4 Pywikibot , 10 4 External editors , 11 4 Extension requests , 12 4 Special pages , 13 4 Page Forms , 14 4 FAQ , 15 4 Communication , 16 3 PostgreSQL , 17 3 CommunityVoice , 18 3 MediaWiki history , 19 3 Coding conventions , 20 3 Windows NTLM LDAP Auto Auth , 21 3 AbuseFilter , 22 3 LiquidThreads , 23 3 Simple Forms , 24 3 Labeled Section Transclusion , 25 2 Toolserver:Wiki server assignments

Mar 2009: 1 25 Google Summer of Code/2009 , 2 12 MediaWiki Developer Meet-Up 2009 , 3 9 Extension requests , 4 7 Sites using MediaWiki/en , 5 6 External editors , 6 6 FCKeditor (Official) , 7 5 Transclusion , 8 5 AbuseFilter , 9 5 Download/old boxy version , 10 5 Interface/Sidebar , 11 4 Licenses , 12 4 Extensions/pl , 13 4 Creating pages with preloaded text , 14 4 Developers , 15 4 Extension Matrix , 16 4 Bugzilla , 17 4 Wiki family , 18 4 Configuration settings (alphabetical) , 19 4 Download , 20 3 Toolserver:Servers , 21 3 Toolserver:Replication lag , 22 3 Toolserver:Account approval process , 23 3 Pywikibot/redirect.py , 24 3 $wgUserFallbackLanguages , 25 3 Upgrading to 1.14

Apr 2009: 1 10 Sites using MediaWiki/en , 2 9 Commit access requests , 3 8 Extension requests , 4 6 MediaWiki Developer Meet-Up 2009/Notes , 5 6 Google Summer of Code/2009 , 6 5 Transclusion , 7 5 SlippyMap , 8 5 Extension Matrix , 9 5 Sites using MediaWiki/gallery , 10 4 Toolserver:Nice , 11 4 Gallery of user styles , 12 4 Add Media Wizard , 13 4 MediaWiki Developer Meet-Up 2009 , 14 4 Developers , 15 4 Short URL , 16 4 Sites using MediaWiki/de , 17 4 Download , 18 3 Toolserver:Rules , 19 3 Toolserver:Main Page , 20 3 Pywikibot , 21 3 MediaWiki Developer Meet-Up 2009/Notes/Mapping , 22 3 RevisionDelete/fr , 23 3 Job queue , 24 3 Widgets , 25 3 Semantic Google Maps

May 2009: 1 11 Commit access requests , 2 11 Skinning/Archive , 3 7 Download , 4 5 Extension requests , 5 5 FAQ , 6 5 Sites using MediaWiki/en , 7 4 Pywikibot , 8 4 How to become a MediaWiki hacker , 9 4 StringFunctions , 10 4 Extension Matrix , 11 4 Developer account/Subversion , 12 4 Wiki family , 13 3 Toolserver:Phoenix , 14 3 Toolserver:Code snippets , 15 3 X3d , 16 3 LocalisationUpdate , 17 3 Security for developers , 18 3 Developers , 19 3 VariablesExtension , 20 3 DynamicPageList (third-party) , 21 3 ImageMap , 22 3 Sites using MediaWiki/fr , 23 3 Configuration settings (alphabetical) , 24 3 $wgServerName , 25 3 Configuration settings

Jun 2009: 1 14 Commit access requests , 2 9 Extension requests , 3 9 FAQ , 4 6 Browser issues with MediaWiki , 5 6 DynamicPageList (Wikimedia) , 6 6 Upgrading , 7 6 Download , 8 4 Toolserver:Main Page , 9 4 Pywikibot , 10 4 Release notes/1.15 , 11 4 InputBox , 12 4 Configuration , 13 4 SyntaxHighlight , 14 4 Image administration , 15 4 DynamicPageList (third-party) , 16 4 CharInsert , 17 4 Wiki family , 18 4 Configuration settings , 19 3 Toolserver:Servers , 20 3 Toolserver:History , 21 3 Toolserver:Daemons , 22 3 Transclusion , 23 3 Semantic Bundle , 24 3 Skinning/Archive , 25 3 Developers

Jul 2009: 1 16 Commit access requests , 2 7 Sites using MediaWiki/en , 3 7 Download , 4 6 Developers , 5 6 FAQ , 6 5 Toolserver:List of Wikimedia bots , 7 5 Pywikibot , 8 5 UsabilityInitiative , 9 5 Maps , 10 5 InputBox , 11 5 Extension Matrix , 12 4 Toolserver:Using Solaris , 13 4 Toolserver:Main Page , 14 4 HTML5 , 15 4 Semantic Maps , 16 4 External editors , 17 4 Data Transfer , 18 4 FlaggedRevs , 19 4 SyntaxHighlight , 20 4 Short URL , 21 3 Toolserver:User servers , 22 3 Toolserver:Logging in , 23 3 Toolserver:Account approval process/for reviewers , 24 3 Semantic Maps/Future , 25 3 Maps/Future

Aug 2009: 1 10 Extension requests , 2 9 FAQ , 3 8 Commit access requests , 4 8 Sites using MediaWiki/en , 5 7 Developers , 6 5 Requests for comment/Configuration database , 7 5 ReaderFeedback , 8 5 SyntaxHighlight , 9 4 Presentations , 10 4 Testing portal , 11 4 Suggestions for extensions to be integrated , 12 4 SocialProfile , 13 4 ParserFunctions , 14 4 Configuration , 15 4 Installation guide , 16 4 DynamicPageList (Wikimedia) , 17 3 FileImporter/Data/de.wikipedia , 18 3 Toolserver:Servers , 19 3 Google Summer of Code/2010 , 20 3 Click stats tracker requirements , 21 3 DonationGateway , 22 3 Semantic Maps , 23 3 LDAP Authentication/Suggestions , 24 3 EzMwLucene , 25 3 JS2 Overview

Sep 2009: 1 10 Sites using MediaWiki/en , 2 9 FAQ , 3 8 Commit access requests , 4 6 Extension requests , 5 5 FileImporter/Data/en.wikipedia , 6 5 Toolserver:Translatewiki.net interface , 7 5 Extension Matrix , 8 5 Sites using MediaWiki/pt , 9 5 Sites using MediaWiki/de , 10 4 Toolserver:Job scheduling , 11 4 External editors , 12 4 Developers , 13 4 Preventing access , 14 4 FAQ/ru , 15 3 Toolserver:Servers/lang , 16 3 Pywikibot/welcome.py , 17 3 Combating vandalism , 18 3 LocalisationUpdate , 19 3 JS2 Overview , 20 3 Widgets , 21 3 Page Object Model , 22 3 OAIRepository , 23 3 Translate , 24 3 Edit , 25 3 Combating spam

Oct 2009: 1 13 FAQ , 2 9 Upgrading , 3 7 Developers , 4 6 Commit access requests , 5 6 External editors , 6 4 AbuseFilter , 7 4 Semantic Drilldown , 8 4 $wgForeignFileRepos , 9 4 Extension requests , 10 4 Sites using MediaWiki/en , 11 4 Download , 12 3 Meetings/2009-11-02 , 13 3 Convert Socialtextwiki to Mediawiki , 14 3 MediaWiki-Wave , 15 3 Maps/Future , 16 3 Upload , 17 3 Creating pages with preloaded text , 18 3 WYSIWYG editor , 19 3 Page Forms , 20 3 Auth remoteuser , 21 3 FAQ/fr , 22 3 Sites using MediaWiki/ru , 23 3 Interface/Sidebar , 24 3 Sites using MediaWiki/multilingual , 25 3 Configuration settings

Nov 2009: 1 8 Page Forms , 2 6 Commit access requests , 3 6 FAQ , 4 5 Developers , 5 5 Extension requests , 6 5 Sites using MediaWiki/en , 7 4 Memento , 8 4 Special pages , 9 4 How to become a MediaWiki hacker , 10 4 User rights , 11 4 Configuration settings , 12 3 Pywikibot/Overview , 13 3 $wgUseInstantCommons , 14 3 Terminator , 15 3 UsabilityInitiative , 16 3 Apache configuration , 17 3 Widgets , 18 3 Sites using MediaWiki/fr , 19 3 Sites using MediaWiki/de , 20 2 FileImporter/Data/en.wikipedia , 21 2 Toolserver:OpenStreetMap server/Setup notes , 22 2 Huggle/Configuration , 23 2 Pywikibot/replace.py , 24 2 Pywikibot/category.py/it , 25 2 Pywikibot/category.py

Dec 2009: 1 7 Commit access requests , 2 7 FAQ , 3 6 Google Summer of Code/2010 , 4 6 Safe mode , 5 6 Page Forms , 6 4 Maps , 7 4 Installation guide , 8 4 Sites using MediaWiki/ru , 9 3 Gallery of user styles , 10 3 External editors , 11 3 Localisation statistics , 12 3 Usage Statistics , 13 3 Installing MediaWiki , 14 3 Backing up a wiki , 15 3 Semantic MediaWiki , 16 3 User rights , 17 3 Contents , 18 3 Sites using MediaWiki/de , 19 3 $wgSVGConverters , 20 3 $wgServerName , 21 2 Pywikibot/replace.py/fr , 22 2 $wgUploadMaintenance , 23 2 $wgRateLimitsExcludedIPs , 24 2 ApiSVGProxy , 25 2 PlaceNewSection

Jan 2010: 1 12 Project management tools/2010 Review , 2 11 Commit access requests , 3 9 Sites using MediaWiki/en , 4 7 Google Summer of Code/2010 , 5 6 Short URL , 6 6 FAQ , 7 4 Semantic Maps , 8 4 Coding conventions , 9 4 External editors , 10 4 Replace Text , 11 4 Installation requirements , 12 4 Page Forms , 13 4 Preventing access , 14 4 Sites using MediaWiki/de , 15 3 Toolserver:Subversion , 16 3 Maps , 17 3 Gallery of user styles , 18 3 External Data , 19 3 Widgets , 20 3 Errors and symptoms , 21 3 $wgAllowCopyUploads , 22 3 FlaggedRevs , 23 3 User rights , 24 3 CategoryTree , 25 3 ContactPage

Feb 2010: 1 8 Meetings/2010-03-03 , 2 8 External editors , 3 6 Source control considerations , 4 6 Google Summer of Code/2010 , 5 5 Git , 6 5 Commit access requests , 7 5 Sites using MediaWiki/ru , 8 5 FAQ , 9 4 Toolserver:ZWS , 10 4 Toolserver:Jobserver , 11 4 DynamicSidebar , 12 4 Nimbus , 13 4 Gallery of user styles , 14 4 Subversion , 15 4 Developers , 16 4 Sites using MediaWiki/en , 17 3 Pre-commit checklist , 18 3 LocalSettings.php/ru , 19 3 Project management tools/2010 Review , 20 3 Maps , 21 3 JS2 Overview , 22 3 Coding conventions , 23 3 Making Subversion faster , 24 3 Collection/Wishlist/LQT Archive 1 , 25 3 Widgets

Mar 2010: 1 36 Google Summer of Code/2010 , 2 18 Toolserver:Conversion of nightshade to Solaris , 3 7 Meetings/2010-03-03 , 4 6 External editors , 5 6 Extension requests , 6 5 Page Forms , 7 5 Short URL , 8 4 Toolserver:List of things to ask WM-DE , 9 4 New installer/issues , 10 4 Special pages , 11 4 Developer account/Subversion , 12 4 Sites using MediaWiki/ru , 13 4 Sites using MediaWiki/en , 14 4 Sites using MediaWiki/fr , 15 4 Download , 16 3 Toolserver:Code snippets , 17 3 Toolserver:Category:Edit counters , 18 3 Mobile Gateway , 19 3 Poll , 20 3 Google Summer of Code/Past projects , 21 3 PureWikiDeletion , 22 3 RemotePageExistenceDetection/Proof of concept , 23 3 EditConflict , 24 3 Summer of Code 2010/Application template , 25 3 MediaWiki is a corporate solution

Apr 2010: 1 19 Google Summer of Code/2010 , 2 7 Sites using MediaWiki/en , 3 5 New installer/issues , 4 5 Mailing lists , 5 5 Extension requests , 6 4 External editors , 7 4 Collection/Wishlist/LQT Archive 1 , 8 4 Bugzilla , 9 4 MWDumper , 10 3 Toolserver:Python WSGI , 11 3 Export enhancements , 12 3 Facebook , 13 3 Configure , 14 3 Installation guide , 15 3 LiquidThreads , 16 3 How to become a MediaWiki hacker , 17 3 Cite/Cite.php , 18 3 $wgProto , 19 3 Page Forms , 20 3 Sites using MediaWiki/ru , 21 3 MediaWiki/zh , 22 3 Communication , 23 2 Toolserver:Query service , 24 2 Toolserver:Página principal/es , 25 2 Toolserver:Code snippets

May 2010: 1 8 Download , 2 7 Sites using MediaWiki/en , 3 5 Developers , 4 5 Short URL , 5 5 Hooks , 6 5 Configuration settings , 7 4 Bugzilla/Cleanup , 8 4 External editors , 9 4 Upgrading , 10 3 Toolserver:Category:Edit counters , 11 3 Toolserver:Account approval process/for reviewers , 12 3 Presentations , 13 3 Huggle/HistoricalManual , 14 3 RevisionDelete/ja , 15 3 HarvardReferences , 16 3 New installer/issues , 17 3 MaintenanceShell , 18 3 Commit access requests , 19 3 Facebook , 20 3 Ajax , 21 3 $wgConf , 22 3 Extension requests , 23 3 LiquidThreads , 24 3 Preventing access , 25 3 Backing up a wiki

Jun 2010: 1 9 Sites using MediaWiki/ru , 2 8 External editors , 3 6 Page Forms , 4 6 FAQ , 5 6 Sites using MediaWiki/en , 6 5 ResourceLoader/Requirements/Michael Dale , 7 5 New installer/issues , 8 5 Translate , 9 5 How to become a MediaWiki hacker , 10 4 Google Translator , 11 4 Bots , 12 4 CollaborativeWatchlist , 13 4 Gallery of user styles , 14 4 JS2 Overview , 15 4 Configuring file uploads , 16 4 Download , 17 3 WikiEditor/Toolbar customization , 18 3 TODOListProgressBar , 19 3 ResourceLoader/Requirements/Neil Kandalgaonkar , 20 3 Requests for comment/Distribution and deployment , 21 3 CustomEdit/de , 22 3 Semantic NotifyMe , 23 3 UsabilityInitiative , 24 3 Coding conventions , 25 3 Semantic Drilldown

Jul 2010: 1 8 Research Data Proposals , 2 5 Sites using MediaWiki/en , 3 4 Requests for comment/Distribution and deployment , 4 4 New installer/issues , 5 4 Maps , 6 4 Gallery of user styles , 7 4 External editors , 8 4 EditUser , 9 4 Upgrading , 10 4 Short URL , 11 4 MediaWiki testimonials , 12 4 Configuration settings , 13 4 Download , 14 3 Toolserver:Iterating over wikis , 15 3 Mobile Gateway , 16 3 Release notes/1.16 , 17 3 DataTransclusion , 18 3 Quality assessment tools for Wikipedia readers , 19 3 Wikimedia Engineering/Archive , 20 3 CategoryMultisortChinese , 21 3 Accessibility , 22 3 $wgLogActionsHandlers/ru , 23 3 $wgHttpOnlyBlacklist/ru , 24 3 $wgAPIRequestLog/ru , 25 3 External Data

Aug 2010: 1 7 Article feedback , 2 6 Article feedback/Public Policy Pilot , 3 5 Toolserver:Database access , 4 5 FAQ , 5 4 CentralNotice/Phase 3/Open questions , 6 4 CentralNotice/Phase 2 , 7 4 Development process improvement , 8 4 LiquidThreads 3.0 , 9 4 Wikimedia Engineering/Archive , 10 4 XMLRC , 11 4 FCKeditor (Official) , 12 4 LiquidThreads , 13 4 Page Forms , 14 4 Upgrading , 15 3 Toolserver:ZWS , 16 3 Toolserver:Transferring files , 17 3 Toolserver:Subversion , 18 3 Toolserver:Main Page/lang , 19 3 Toolserver:Main Page , 20 3 LiquidThreads 3.0/Design , 21 3 Article feedback/Public Policy Pilot/Feedback Survey Phase2 , 22 3 ResourceLoader , 23 3 Article feedback/Public Policy Pilot/Technical , 24 3 Pywikibot/Overview , 25 3 WMF Projects/Static HTML snapshots

Sep 2010: 1 12 Hack-A-Ton DC , 2 9 Sites using InstantCommons , 3 7 Article feedback/Public Policy Pilot/Workgroup , 4 6 Wikimedia Engineering/Report/2010/September , 5 6 Upgrading , 6 5 Article feedback/Research , 7 5 SparqlExtension , 8 4 Requests for review , 9 4 Pending Changes enwiki trial/Roadmap , 10 4 External editors , 11 4 Extension requests , 12 4 How to become a MediaWiki hacker , 13 4 Page Forms , 14 4 Sites using MediaWiki/ru , 15 4 Sites using MediaWiki/en , 16 4 Configuration settings , 17 3 Toolserver:Wiki server assignments , 18 3 Toolserver:Query service , 19 3 Toolserver:OrphanTalks , 20 3 Gerrit/Code review , 21 3 Meetings/Test framework/2010-09-10 , 22 3 WolframAlphaWidgets , 23 3 Article feedback/Public Policy Pilot/Feedback Survey , 24 3 Article feedback/Public Policy Pilot , 25 3 Test framework deployment

Oct 2010: 1 25 Hack-A-Ton DC , 2 10 How to become a MediaWiki hacker , 3 7 Sites using MediaWiki/ru , 4 6 Wikimedia Engineering/Report/2010/September , 5 5 Article feedback/Public Policy Pilot/Workgroup , 6 5 Gallery of user styles , 7 4 Document UNCified , 8 4 ResourceLoader , 9 4 Pywikibot/Scripts , 10 4 Coding conventions , 11 4 Page Forms , 12 4 Roadmap/Archive , 13 4 FAQ , 14 4 Sites using MediaWiki/fr , 15 3 Toolserver:Maintenance schedule , 16 3 WMF Projects/Upgrade Payments Infrastructure , 17 3 WMF Projects/Technical Documentation , 18 3 Register globals , 19 3 Gerrit/Code review , 20 3 Sites using InstantCommons , 21 3 ResourceLoader/Legacy JavaScript , 22 3 Selenium Framework , 23 3 New installer/issues , 24 3 Security for developers , 25 3 External editors

Nov 2010: 1 9 Extension requests , 2 7 Article feedback/Public Policy Pilot/Additional Pages , 3 7 Wikimedia Engineering/Report/2010/October , 4 6 FAQ , 5 5 Toolserver:List of Wikimedia bots , 6 5 Sites using InstantCommons , 7 5 Article feedback/Public Policy Pilot/Workgroup , 8 5 Download , 9 4 Toolserver:LDAP , 10 4 Coding conventions , 11 4 RSS , 12 4 Installation guide , 13 4 Developer account/Subversion , 14 4 Short URL , 15 4 Sites using MediaWiki/en , 16 4 Configuration settings , 17 3 Toolserver:Phoenix , 18 3 Toolserver:Nice , 19 3 Toolserver:Account renewal , 20 3 BlueSpice , 21 3 SimpleSurvey/Specifications , 22 3 PNGHandler , 23 3 Offline , 24 3 Backward compatibility , 25 3 UploadWizard/Test plan

Dec 2010: 1 7 MediaWiki 1.17/roadmap , 2 6 Push , 3 6 Google Summer of Code/2011 , 4 6 Extension requests , 5 5 Security for developers , 6 5 Performance tuning , 7 5 Developers , 8 5 FlaggedRevs , 9 5 Database layout , 10 5 Sites using MediaWiki/ru , 11 5 FAQ , 12 5 Sites using MediaWiki/en , 13 4 Article feedback/Public Policy Pilot/Additional Pages , 14 4 Summer of Code 2011/Project ideas , 15 4 Sites using InstantCommons , 16 4 Tabber , 17 4 How to become a MediaWiki hacker , 18 4 Database access , 19 4 Upgrading , 20 4 Hooks , 21 3 Toolserver:IRC bots , 22 3 LiquidThreads 3.0/Design , 23 3 Snippets , 24 3 Codurr , 25 3 New installer/Test plan

Jan 2011: 1 12 Sites using MediaWiki/en , 2 9 WYSIFTW , 3 8 How to become a MediaWiki hacker , 4 6 MediaWiki 1.17/roadmap , 5 6 FAQ , 6 5 LiquidThreads 3.0/Design , 7 5 Gallery of user styles , 8 5 GraphViz/v0.9 , 9 5 Developer account/Subversion , 10 5 Configuring file uploads , 11 4 Files and licenses concept , 12 4 Live Translate , 13 4 Wikimedia Engineering/Report/2010/December , 14 4 Google Summer of Code/2011 , 15 4 LiquidThreads 3.0 , 16 4 Google Summer of Code/Past projects , 17 4 LiquidThreads , 18 4 Preventing access , 19 4 ConfirmEdit , 20 4 Upgrading , 21 3 Toolserver:List of Wikimedia bots , 22 3 Toolserver:Job scheduling , 23 3 Toolserver:Admin:Shopping list , 24 3 Deglobalization , 25 3 WMF Projects/Data Dumps

Feb 2011: 1 22 Berlin Hackathon 2011 , 2 17 Google Summer of Code/2011 , 3 15 MediaWiki 1.17/Wikimedia deployment , 4 11 ResourceLoader/Migration guide (users) , 5 7 MediaWiki 1.17/Wikimedia deployment/es , 6 6 MediaWiki 1.17/Wikimedia deployment/fr , 7 6 Summer of Code 2011/Project ideas , 8 6 ResourceLoader/Legacy JavaScript , 9 6 Sites using MediaWiki/en , 10 5 Bug management/Bugzilla usage , 11 5 MediaWiki 1.17/Revision report , 12 5 Snippets , 13 5 ResourceLoader/Core modules , 14 5 LiquidThreads , 15 4 MediaWiki 1.17/Wikimedia deployment/de , 16 4 MediaWiki 1.17/Wikimedia deployment/it , 17 4 MediaWiki 1.17/Wikimedia deployment/pt , 18 4 Account Creation Improvement Project , 19 4 Wikimedia Engineering/Report/2011/January , 20 4 Narayam , 21 4 ResourceLoader , 22 4 UploadWizard , 23 4 External editors: control files , 24 4 ConfirmEdit , 25 4 Short URL

Mar 2011: 1 50 Google Summer of Code/2011 , 2 29 Berlin Hackathon 2011 , 3 10 Sites using MediaWiki/en , 4 7 Personal image filter , 5 6 Mailing lists , 6 6 Developer account/Subversion , 7 5 Git/Conversion/issues , 8 5 Style guide/Forms , 9 5 Collection/openZIM , 10 5 2011 Wikimedia fundraiser/Requirements , 11 5 New-installer issues/Main page , 12 5 Coding conventions , 13 5 Combating spam , 14 4 Wikimedia Engineering/Report/2011/March , 15 4 JavaScript parsing library , 16 4 Wikimedia Engineering/Report/2011/February , 17 4 AdvancedMeta , 18 4 Review queue , 19 4 LiquidThreads , 20 4 ConfirmEdit , 21 4 Sites using MediaWiki/ru , 22 3 Toolserver:Servers , 23 3 ResourceLoader/Migration guide (users) , 24 3 MediaWiki 1.18 , 25 3 EditAccount

Apr 2011: 1 18 Berlin Hackathon 2011 , 2 16 Google Summer of Code/2011 , 3 6 Review queue , 4 5 Wikimedia Apps/Features & Roadmap , 5 5 Supported browsers , 6 5 Writing an extension for deployment , 7 5 HipHop , 8 5 Compatibility , 9 5 Coding conventions , 10 5 Developers , 11 4 Interlanguage/WMF Design Pass , 12 4 Parser 2011 , 13 4 Developing extensions , 14 3 Mobile Gateway/Features & Roadmap , 15 3 Wikimedia Mobile engineering/imported/Mobile projects , 16 3 GbrowseImage , 17 3 CustomUserSignup , 18 3 EmailCapture , 19 3 Suggestions to split from core into extensions , 20 3 Gadget Studio , 21 3 Editor engagement/Participant Lifecycle , 22 3 PDF Include , 23 3 VisualEditor/Design/Software overview , 24 3 Snippets/Compare link , 25 3 WebFonts

May 2011: 1 13 Berlin Hackathon 2011 , 2 11 Wikimedia Engineering/Report/2011/April , 3 10 MediaWiki 1.17 , 4 7 Toolserver:Suggestions , 5 7 Berlin Hackathon 2011/Attendees , 6 6 Article feedback , 7 6 $wgUseTeX , 8 5 Wikimedia maintenance notice/ko , 9 5 Wikimedia maintenance notice/zh-hans , 10 5 WikiLove , 11 5 Article feedback/FAQ , 12 5 Google Summer of Code/2011 , 13 5 MediaWiki/pt-br , 14 5 LiquidThreads , 15 5 Release notes , 16 4 Wikimedia maintenance notice , 17 4 JavaScript unit testing , 18 4 Wikimedia Engineering/Report/2011/May , 19 4 Analytics/Reportcard , 20 4 Wikimedia Platform Engineering , 21 4 Release notes/1.17 , 22 4 Berlin Hackathon 2011/Volunteers , 23 4 Suggestions to split from core into extensions , 24 4 Parser 2011 , 25 4 HipHop

Jun 2011: 1 13 Tarballs , 2 11 Wikimedia Engineering/Report/2011/June , 3 10 Mobile site rewrite/Testing/Rendering , 4 10 Sites using MediaWiki/en , 5 9 Mobile site rewrite/Testing/General , 6 9 Coding conventions , 7 8 WikiLove/Media coverage , 8 8 Send2Wiki , 9 7 Wikimedia engineering 20% policy , 10 6 Database testing , 11 6 Mobile site rewrite/Testing/Show-hide , 12 6 Page Forms , 13 5 GlobalProfile/design , 14 5 Berlin Hackathon 2011/Notes/Saturday , 15 5 WikiLove , 16 5 WikiLove , 17 5 Wikimedia Engineering/Report/2011/May , 18 5 Wikimedia Platform Engineering , 19 5 ResourceLoader/Core modules , 20 5 Article feedback , 21 5 LiquidThreads , 22 4 Toolserver:List of Wikimedia bots , 23 4 Toolserver:Main Page , 24 4 JSWikiGantt , 25 4 Mobile site rewrite/Testing/Missing functionality

Jul 2011: 1 15 Sites using MediaWiki/en , 2 10 WikiLove , 3 8 Page Forms , 4 7 External editors: control files , 5 7 MediaWiki testimonials , 6 6 Wikimedia Mobile engineering/BadRedirect/UA , 7 6 Requests for comment/Reduce math rendering preferences , 8 6 Article feedback/status , 9 6 Article feedback/Ideas log , 10 6 Article feedback/FAQ , 11 6 Article feedback , 12 6 Widgets , 13 6 Send2Wiki , 14 6 ConfirmEdit , 15 5 MoodBar , 16 5 WikiLove/Stories , 17 5 PHP unit testing , 18 5 Suggestions for extensions to be integrated , 19 5 WYSIWYG editor , 20 5 Database layout , 21 4 How to become a MediaWiki hacker/Workshop , 22 4 WikiLove/Idea Log , 23 4 Tarballs , 24 4 Mobile web/MobileFrontend deployment , 25 4 Continuous integration/Legacy server

Aug 2011: 1 17 Wikimedia Mobile engineering/BadRedirect/UA-donotwant , 2 15 Wikimedia Mobile engineering/BadRedirect/UA , 3 9 Sites using MediaWiki/en , 4 7 NOLA Hackathon 2011 , 5 7 Wikimedia Engineering/Report/2011/July , 6 6 Wikimedia Mobile engineering/BadRedirect/UA-wantredirect , 7 6 Wikimedia Engineering/Report/2011/August , 8 6 Brighton Hackathon 2011 , 9 6 ResourceLoader/Core modules , 10 6 Sites using InstantCommons , 11 6 WYSIWYG editor , 12 6 MediaWiki testimonials , 13 5 Presentations , 14 5 Feedback Dashboard/Phase 1 , 15 5 JQueryMsg , 16 5 MediaWiki 1.18/Revision report , 17 5 WikiLove , 18 5 SwiftMedia , 19 5 WikiScripts , 20 5 Coding conventions , 21 5 Page Forms , 22 5 Send2Wiki , 23 4 Toolserver:Main Page , 24 4 Wikimedia Mobile engineering/BadRedirect , 25 4 Requests for comment/Drop actions in favour of page views and special pages

Sep 2011: 1 19 India Hackathon 2011 , 2 18 NOLA Hackathon 2011 , 3 11 Sites using MediaWiki/en , 4 9 October 2011 Coding Challenge , 5 8 Brighton Hackathon 2011 , 6 7 Language tools/Requirements/Indic language support , 7 7 Wikimedia Engineering/Report/2011/September , 8 7 Extension default namespaces , 9 6 Wikimedia Mobile engineering/BadRedirect/UA-donotwant , 10 6 Wikimedia Mobile engineering/BadRedirect/UA , 11 6 Page Curation , 12 6 Localisation , 13 5 Roadmap , 14 5 Article Creation Workflow/Design , 15 5 MediaWiki 1.18/Revision report , 16 5 MediaWiki 1.18 , 17 5 Developing extensions , 18 5 SphinxSearch , 19 5 ConfirmAccount , 20 5 WYSIWYG editor , 21 4 Toolserver:Main Page , 22 4 October 2011 Coding Challenge/Judging , 23 4 MediaWiki architecture document/How and why , 24 4 Requests for comment/Database field for checksum of page text , 25 4 Feedback Dashboard/Phase 1

Oct 2011: 1 37 India Hackathon 2011 , 2 13 MediaWiki architecture , 3 11 Sites using MediaWiki/en , 4 6 October 2011 Coding Challenge/Banner text , 5 5 October 2011 Coding Challenge/Real-Time , 6 5 October 2011 Coding Challenge/New developer intro , 7 5 October 2011 Coding Challenge/Banner text/ja , 8 5 Brighton Hackathon 2011 , 9 5 NOLA Hackathon 2011 , 10 5 Installation guide , 11 4 Wikimedia Mobile engineering/Features , 12 4 Wikimedia Mobile engineering/Brainstorm , 13 4 Roadmap , 14 4 October 2011 Coding Challenge/FAQ , 15 4 October 2011 Coding Challenge/Slideshow , 16 4 October 2011 Coding Challenge/Mobile , 17 4 October 2011 Coding Challenge/Challenges , 18 4 October 2011 Coding Challenge/Banner text/ne , 19 4 MediaWiki manual smoke test , 20 4 October 2011 Coding Challenge/Banner text/pt , 21 4 Wikimedia Engineering/Report/2011/October , 22 4 Contest , 23 4 Page Curation , 24 4 DonationInterface , 25 4 SwiftMedia

Nov 2011: 1 16 India Hackathon 2011 , 2 12 Wikimedia engineering 20% policy , 3 8 MediaWiki 1.18 , 4 8 Sites using MediaWiki/en , 5 7 Wikimedia Engineering/Report/2011/November , 6 6 San Francisco Hackathon January 2012 , 7 6 October 2011 Coding Challenge/Work in Progress , 8 6 MediaWiki 1.17 , 9 5 Mobile Gateway , 10 5 Roadmap , 11 5 Sandbox , 12 5 India Hackathon 2011/Schedule notes , 13 5 Article feedback/Version 5/Technical Design , 14 5 Page Forms/Defining forms , 15 5 Article feedback/FAQ , 16 5 CheckUser , 17 4 Wikimedia Mobile engineering/Features , 18 4 VisualEditor , 19 4 MediaWiki 1.18/Installation reports , 20 4 Semantic Image Input , 21 4 VisualEditor/Design/Features , 22 4 Article feedback/FAQ/es , 23 4 Release notes/1.18 , 24 4 Gadget kitchen , 25 4 Design/Archive/Athena

Dec 2011: 1 85 VisualEditor/Feedback/LQT Archive 1 , 2 14 San Francisco Hackathon January 2012 , 3 12 Wikimedia Apps/Wikipedia/Feedback , 4 8 ResourceLoader/Core modules , 5 7 Pune Hackathon Feb 2012 , 6 7 Upgrading , 7 6 Wikimedia Engineering/Report/2011/November , 8 6 Page Forms/Defining forms , 9 6 Wikimedia Labs , 10 6 External editors: control files , 11 5 Wikimedia Mobile engineering/imported/Mobile projects/Wikipedia Zero , 12 5 Wikipedia Zero , 13 5 Logging to Special:Log , 14 5 Article feedback/Version 5/Testing , 15 5 Article feedback/Version 5 , 16 5 Developing extensions , 17 5 Narayam , 18 5 Pywikibot , 19 5 Sites using MediaWiki/de , 20 5 MediaWiki/pt , 21 4 Roadmap , 22 4 VisualEditor , 23 4 Pywikibot/replace.py , 24 4 MediaWiki 1.19/Revision report , 25 4 MediaWiki 1.19/Roadmap

Jan 2012: 1 38 San Francisco Hackathon January 2012/Teams , 2 10 VisualEditor/Feedback/LQT Archive 1 , 3 8 Roadmap , 4 8 FeaturedFeeds/WMF deployment , 5 8 San Francisco Hackathon January 2012 , 6 8 Wikimedia engineering 20% policy , 7 7 San Francisco Hackathon January 2012/Showcase , 8 6 Wikimedia Mobile engineering/imported/Mobile projects/Partnerships/Q and A , 9 6 Gadget kitchen/Training , 10 6 Wikimedia Engineering/Report/2012/January , 11 6 Wikimedia Engineering/Report/2011/December , 12 6 MediaWiki 1.19 , 13 6 User rights , 14 6 Developer account/Subversion , 15 5 Wikimedia Mobile engineering/Features , 16 5 ResourceLoader/Migration guide (users) , 17 5 UCOSP Spring 2012 , 18 5 MediaWiki 1.19/Roadmap , 19 5 Lua scripting , 20 5 Article feedback/status , 21 5 WebFonts , 22 5 SubPageList , 23 5 ResourceLoader/Core modules , 24 5 Main page , 25 5 Preventing access

Feb 2012: 1 12 Google Summer of Code/2012 , 2 11 Berlin Hackathon 2012 , 3 11 Wikimedia Engineering/Report/2012/January , 4 10 Gerrit/Advanced usage , 5 8 MediaWiki 1.19/Feature test charters , 6 8 MediaWiki 1.19/Roadmap , 7 8 Git/Conversion , 8 8 Installation guide , 9 7 Wiktionary Mobile/App Feature List , 10 7 ConfirmEdit , 11 6 Roadmap , 12 6 Pune Hackathon Feb 2012 , 13 6 MediaWiki 1.19/Roadmap/status , 14 6 DiscussionThreading , 15 6 Localisation , 16 6 Sites using MediaWiki/en , 17 5 Wikimedia Mobile engineering/Features , 18 5 Wikimedia Engineering/Report/2012/February , 19 5 MediaWiki 1.19/Communications , 20 5 Suhosin , 21 5 ResourceLoader/Migration guide (users) , 22 5 Pune Hackathon Feb 2012/Topics , 23 5 VisualEditor/Feedback/LQT Archive 1 , 24 5 Wikimedia engineering 20% policy , 25 5 MediaWiki 1.19

Mar 2012: 1 36 Developer account , 2 23 Google Summer of Code/2012 , 3 17 Wikimedia Engineering/2012-13 Goals , 4 17 Gerrit/Advanced usage , 5 14 Summer of Code 2012/Mentors , 6 12 Gerrit/New repositories/Requests , 7 10 Toolserver:User:Dab/Debian-Packages , 8 10 Roadmap , 9 10 Download from Git , 10 10 Wikimedia Engineering/Report/2012/February , 11 9 Git/Conversion , 12 8 MobileFrontend/Feedback , 13 8 FAQ , 14 7 Toolserver:Job scheduling , 15 7 Wikimedia Apps/Wikipedia/iOS/Feedback , 16 7 Gerrit/Project ownership , 17 7 Berlin Hackathon 2012 , 18 7 Upgrading , 19 7 Sites using MediaWiki/en , 20 6 MediaWiki 1.19/Post-deploy retrospective , 21 6 How to become a MediaWiki hacker/Extension Writing Tutorial , 22 6 Git , 23 6 DPLforum , 24 5 Toolserver:Interwiki bot MMP , 25 5 Mobile design/status

Apr 2012: 1 74 Developer account , 2 24 Git/Conversion/Extensions queue , 3 20 Berlin Hackathon 2012 , 4 18 Gerrit/Advanced usage , 5 17 Wikimedia Engineering/2012-13 Goals , 6 14 MediaWiki 1.20/wmf1/overview , 7 12 Gerrit/Project ownership , 8 10 Gerrit/New repositories/Requests/Entries , 9 10 Google Summer of Code/2012 , 10 9 Main page , 11 8 Mobile design/Wikipedia navigation/Initial menu feedback , 12 8 MediaWiki 1.20/Roadmap , 13 7 Wikimedia Engineering/Report/2012/March , 14 7 MediaWiki 1.19 , 15 6 Mobile design/Wikipedia navigation , 16 6 Page Curation , 17 6 Git/Conversion , 18 5 Wikibase Repository , 19 5 Mobile Gateway , 20 5 Roadmap , 21 5 Math/MathJax testing , 22 5 Outreach programs/Application template , 23 5 MobileFrontend/Deployments , 24 5 Math , 25 5 Git

May 2012: 1 80 Developer account , 2 19 Berlin Hackathon 2012 , 3 17 Gerrit/Project ownership , 4 16 Berlin Hackathon 2012/Sightseeing/June 1 , 5 13 Gerrit/New repositories/Requests/Entries , 6 12 Berlin Hackathon 2012/Sightseeing/June 3 , 7 12 Wikimedia Engineering/Report/2012/April , 8 10 Gerrit/Tutorial , 9 10 Git/Conversion/Extensions queue , 10 10 Gerrit/Advanced usage , 11 9 Roadmap , 12 9 Download from Git , 13 7 FlaggedRevs , 14 6 Mobile design/Wikipedia navigation/Beta feedback , 15 6 MediaWiki 1.20/wmf3 , 16 6 MediaWiki 1.20/Roadmap , 17 6 VisualEditor/Todo list , 18 6 VisualEditor/status , 19 6 Localisation , 20 5 Toolserver:User:Dab/Debian-Packages , 21 5 MediaWiki 1.20/wmf4 , 22 5 Wiki Loves Monuments mobile application , 23 5 Mobile design/Wikipedia navigation/Whiteboard , 24 5 MediaWiki 1.20 , 25 5 Mobile support in MediaWiki core/status

Jun 2012: 1 47 VisualEditor/Feedback/LQT Archive 1 , 2 46 Developer account , 3 21 Gerrit/Project ownership , 4 12 Gerrit/New repositories/Requests/Entries , 5 10 VisualEditor/June 2012 release FAQs , 6 9 Gerrit/Tutorial , 7 9 Git/Conversion/Extensions queue , 8 8 Mobile Gateway/Mobile homepage formatting , 9 8 Wikimedia Engineering/Report/2012/May , 10 7 Git/IRC , 11 7 VisualEditor , 12 7 Parsoid/Todo , 13 7 Developers , 14 6 Roadmap , 15 6 Design/Archive/Wikimedia Foundation Design/Color usage , 16 6 MediaWiki 1.20/Roadmap , 17 6 Proofread Page , 18 6 Sites using MediaWiki/en , 19 5 MediaWiki 1.20/wmf6 , 20 5 Wiki Loves Monuments mobile application , 21 5 OAuth (obsolete info)/User stories , 22 5 VisualEditor/Todo list , 23 5 AbuseFilter , 24 5 Upgrading , 25 5 Short URL

Jul 2012: 1 97 Developer account , 2 33 Git/Gerrit evaluation , 3 18 Gerrit/New repositories/Requests/Entries , 4 18 Gerrit/Project ownership , 5 11 Git/Conversion/Extensions queue , 6 9 Wikimedia Engineering/Report/2012/July , 7 9 Wikimedia Engineering/Report/2012/June , 8 9 Short URL , 9 8 Gerrit/Advanced usage , 10 7 Roadmap , 11 7 Account creation user experience/Benefits of signing up , 12 7 Visual editor/Feedback , 13 7 Sites using MediaWiki/multilingual , 14 6 Wiki Loves Monuments mobile application/ToDo , 15 6 ResourceLoader/Core modules , 16 6 DPLforum , 17 6 Sites using MediaWiki/en , 18 5 Project management tools , 19 5 Requests for comment/Deprecating inline styles , 20 5 VisualEditor , 21 5 Post-edit feedback , 22 5 Specs/HTML , 23 5 Mobile default for sister projects , 24 5 Gerrit , 25 5 Wikipedia Education Program/status

Aug 2012: 1 33 Developer account , 2 21 Wiki Loves Monuments mobile application/Feedback , 3 17 Gerrit/Project ownership , 4 14 Gerrit/New repositories/Requests/Entries , 5 10 Wikimedia Engineering/Report/2012/August , 6 9 Micro Design Improvements , 7 8 Roadmap , 8 8 Installation guide , 9 7 Milkshake , 10 7 Wikimedia Engineering/Report/2012/July , 11 6 Wiki Loves Monuments mobile application/Marketing , 12 6 DynamicPageList (third-party) , 13 6 Sites using MediaWiki/en , 14 6 Configuring file uploads , 15 5 Wikimedia Apps/WLM/Fact Sheet , 16 5 VisualEditor/API , 17 5 VisualEditor , 18 5 Analytics/Archive/Infrastructure/status , 19 5 Lua/Tutorial , 20 5 ResourceLoader/status , 21 5 Language tools , 22 5 Narayam , 23 5 Upgrading , 24 5 FAQ , 25 4 Hourlies

Sep 2012: 1 45 Developer account , 2 14 Git/Conversion/Extensions still in svn , 3 13 Wikimedia Labs/Toolserver features wanted in Tool Labs , 4 11 Meeting best practices (including remote staff) , 5 11 Requests for comment/Core user preferences , 6 11 Gerrit/Project ownership , 7 10 Wiki Loves Monuments mobile application/Feedback , 8 10 Gerrit/New repositories/Requests/Entries , 9 8 Roadmap , 10 7 Git/Conversion/Extensions queue , 11 6 Bangalore DevCamp November 2012 , 12 6 ResourceLoader/Core modules , 13 5 Requests for comment/Add developer link to footer of Wikimedia wikis , 14 5 Micro Design Improvements , 15 5 Mobile/Release history , 16 4 Bangalore DevCamp November 2012/Topics , 17 4 Wikimedia Engineering/Report/2012/September , 18 4 Language tools/Impact Measurement and Metrics , 19 4 Wikimedia Apps/How to release an app , 20 4 Wikimedia Engineering/WMF Tech Days 2012 , 21 4 MediaWiki 1.20/Roadmap , 22 4 Wikimedia Engineering/2012-13 Goals , 23 4 Multimedia/status , 24 4 VisualEditor/status , 25 4 Language tools/status

Oct 2012: 1 61 Developer account , 2 30 Gerrit/Project ownership , 3 23 Gerrit/New repositories/Requests/Entries , 4 18 Meetings/2012-10-18 , 5 16 Requests for comment/Core user preferences , 6 12 Meetings/2012-10-30 , 7 12 Wikimedia Engineering/Report/2012/October , 8 11 Pune Language Engineering Meetup November 2012 , 9 10 MediaWiki 1.21/Roadmap , 10 10 Bangalore DevCamp November 2012/Topics , 11 8 Roadmap , 12 8 Gerrit/+2 , 13 8 Bangalore DevCamp November 2012 , 14 8 Git/Workshop , 15 7 Google Code-in/2013 , 16 7 Bangalore Language Engineering Meetup November 2012 , 17 7 Wikimedia Engineering/Report/2012/September , 18 7 Gerrit/Advanced usage , 19 6 Reading/Web/Mobile Beta , 20 5 Developer reading list , 21 5 Wikivoyage migration/Accounts , 22 5 Wikivoyage migration , 23 5 Micro Design Improvements , 24 5 Mobile/Release history , 25 5 ContentHandler

Nov 2012: 1 96 Developer account , 2 34 Outreachy/Round 6 , 3 14 Gerrit/Project ownership , 4 12 Meetings/2012-11-29 , 5 11 Gerrit/New repositories/Requests/Entries , 6 10 Developers/Maintainers , 7 8 Wikimedia Engineering/Report/2012/November , 8 7 MediaWiki 1.21/Roadmap , 9 7 Events , 10 6 Requests for comment/URL shortener , 11 6 Meetings/2012-11-15 , 12 6 Personal tools , 13 6 Gerrit/Advanced usage , 14 5 Meetings/Guest speakers , 15 5 MediaWiki Language Extension Bundle , 16 5 Developers/Maintainers/OpsRow , 17 5 Developers/Maintainers/ExtensionRow , 18 5 Developers/Maintainers/ComponentRow , 19 5 Bangalore Language Engineering Meetup November 2012 , 20 5 Parsoid , 21 5 Suggestions for extensions to be integrated , 22 5 What is MediaWiki? , 23 5 Installation guide , 24 5 Developers , 25 4 Reading/Web/Mobile Beta

Dec 2012: 1 36 Amsterdam Hackathon 2013 , 2 26 Developer account , 3 18 Gerrit/New repositories/Requests/Entries , 4 17 Events/FOSDEM/2013 , 5 14 Groups/Proposals/Ahmedabad , 6 14 Gerrit/Project ownership , 7 10 Developers/Maintainers , 8 10 Outreachy/Round 6 , 9 9 ResourceLoader/Core modules , 10 9 Localisation , 11 8 Roadmap , 12 8 Groups/Proposals , 13 7 Wikimedia Labs/Tool Labs/Needed Toolserver features , 14 7 Groups/Promotion , 15 7 Wikimedia Engineering/Report/2012/November , 16 6 Groups/Proposals/Browser testing , 17 6 Groups/San Francisco , 18 6 MediaWiki 1.21/wmf6 , 19 6 Meetings/2012-12-13 , 20 6 Wikimedia Engineering/2012-13 Goals , 21 6 Social media , 22 6 Wikimedia Engineering , 23 6 Events , 24 5 Reading/Web/Mobile Beta , 25 5 Groups/Proposals/Ciudad de México

Jan 2013: 1 20 Gerrit/New repositories/Requests/Entries , 2 17 Third-party MediaWiki users discussion , 3 16 Sites using MediaWiki/en , 4 14 Wikimedia Engineering/Report/2012/December , 5 13 Gerrit/Project ownership , 6 12 Roadmap , 7 8 Meetings/2013-01-17 , 8 7 Groups/San Francisco , 9 7 Developers/Maintainers , 10 7 Installation guide , 11 6 Wikibase Repository , 12 6 Groups/Proposals/Bug Squad , 13 6 Notifications/Feature requirements , 14 6 Requests for comment , 15 6 Suggestions for extensions to be integrated , 16 5 GeoData/blogpost , 17 5 Quality Assurance/Weekly goals , 18 5 VisualEditor/Testing Non-Latin Characters Input and Behavior , 19 5 Google Summer of Code/2013 , 20 5 Wikimedia Engineering/Report/2013/January , 21 5 Events/GNUnify , 22 5 Outreach programs/LevelUp/Q1 2013 , 23 5 Mobile/2013 strategy planning , 24 5 Groups/Promotion , 25 5 GettingStarted

Feb 2013: 1 34 Wikimedia Labs/Tool Labs/List of Toolserver Tools , 2 32 Gerrit/Project ownership , 3 22 Google Summer of Code/2013 , 4 18 EventLogging/Workshop , 5 16 Amsterdam Hackathon 2013 , 6 15 Amsterdam Hackathon 2013/Topics , 7 15 Gerrit/New repositories/Requests/Entries , 8 13 Requests for comment/Password requirements , 9 11 Wikimedia mobile engineering/Mobile QA/Commons uploads , 10 10 Wikimedia Engineering/Report/2013/January , 11 10 Scribunto/Lua reference manual , 12 9 Meetings/2013-02-28 , 13 9 Wikimedia Apps/Commons , 14 8 Events/GNUnify , 15 8 Outreach programs/Possible projects , 16 8 Messages API , 17 7 Professional development and consulting , 18 7 Developers/Maintainers , 19 7 MediaWiki 1.21/Roadmap , 20 7 MediaWiki Bulletin Board Modifications , 21 6 Wikimedia Labs/Tool Labs/Needed Toolserver features , 22 6 Notifications/Feature requirements , 23 6 Coding conventions/JavaScript , 24 6 Wikimedia Platform Engineering , 25 6 Requests for comment

Mar 2013: 1 40 Google Summer of Code/2013 , 2 34 Wikimedia Labs/Tool Labs/List of Toolserver Tools , 3 31 Amsterdam Hackathon 2013/Attendees , 4 23 Gerrit/Project ownership , 5 20 Outreach programs/Possible projects , 6 16 Amsterdam Hackathon 2013/Topics , 7 14 Meetings/2013-03-21 , 8 12 Amsterdam Hackathon 2013 , 9 10 Wikimedia Engineering/Report/2013/February , 10 9 Gerrit/New repositories/Requests/Entries , 11 8 EventLogging/Workshop , 12 8 Wikimedia Apps/Commons , 13 8 Scribunto/Lua reference manual , 14 7 Bug management/Triage/20130318 , 15 7 Gerrit/Tutorial , 16 6 Wikibase Client/Lua , 17 6 Wikimedia Engineering/Report/2013/March , 18 6 Wikimedia mobile engineering/Mobile QA/Commons uploads , 19 6 MediaWiki 1.21/Roadmap , 20 6 MediaWiki 1.21 , 21 6 Events , 22 6 Lua scripting , 23 6 Multimedia/status , 24 6 Main page , 25 5 EventLogging/Guide

Apr 2013: 1 36 Google Summer of Code/2013 , 2 23 Amsterdam Hackathon 2013/Attendees , 3 21 Gerrit/Project ownership , 4 14 Outreach programs/Possible projects , 5 14 Gerrit/New repositories/Requests/Entries , 6 13 Outreach programs/Possible mentors , 7 12 MediaWiki , 8 11 Wikimedia Labs/Tool Labs/List of Toolserver Tools , 9 8 Outreachy/Round 6 , 10 7 Wikimedia Engineering/Report/2013/March , 11 7 Amsterdam Hackathon 2013/Topics , 12 7 MediaWiki 1.21 , 13 7 Score , 14 7 Multimedia/status , 15 6 Wikimedia Engineering/Report/2013/April , 16 6 MediaWiki 1.22/Roadmap , 17 6 Amsterdam Hackathon 2013 , 18 6 Main page , 19 6 Configuration settings , 20 5 Moodle , 21 5 Meetings/2013-04-18 , 22 5 DPLforum/de , 23 5 Coding conventions/Python , 24 5 Wikimedia Engineering/Report/2013/March/summary , 25 5 Scribunto/Lua reference manual/ru

May 2013: 1 83 Amsterdam Hackathon 2013/Workshops , 2 43 Google Summer of Code/2013 , 3 29 Amsterdam Hackathon 2013/Attendees , 4 28 Toolserver:Labs-Moving-Survey , 5 17 Gerrit/New repositories/Requests/Entries , 6 14 Architecture guidelines , 7 14 Amsterdam Hackathon 2013 , 8 13 MediaWiki-Vagrant , 9 13 Amsterdam Hackathon 2013/Topics , 10 10 Outreachy/Round 6 , 11 10 Gerrit/Project ownership , 12 8 Groups/Proposals/Accessibility Tracking , 13 8 MediaWiki 1.22/Roadmap , 14 8 Echo , 15 8 CLDR , 16 7 Wikimedia Engineering/Report/2013/May , 17 7 Outreach programs/Possible mentors , 18 7 VisualEditor/Feedback/LQT Archive 1 , 19 7 Upgrading , 20 6 BookManager/Improve support for book structures , 21 6 Wikimedia Engineering/Report/2013/April , 22 6 Gerrit/Advanced usage , 23 5 MediaWiki 1.22 , 24 5 TemplateData , 25 5 Gerrit/git-review

Jun 2013: 1 23 Google Summer of Code/2013 , 2 20 Gerrit/New repositories/Requests/Entries , 3 14 Gerrit/Project ownership , 4 11 Requests for comment/Support for user-specific page lists in core , 5 11 Release Management RFP/2013/NicheWork and Hallo Welt! , 6 11 Universal Language Selector , 7 9 Wikimedia Engineering/2013-14 Goals , 8 8 Requests for comment/CirrusSearch , 9 7 Meetings/2013-06-27 , 10 7 Universal Language Selector/FAQ , 11 7 Architecture guidelines , 12 7 Wikimedia Engineering/Report/2013/May , 13 6 Release Management RFP/2013/EIJL , 14 6 PHP 5.4 , 15 6 VisualEditor , 16 6 VisualEditor/Feedback/LQT Archive 1 , 17 6 Requests for comment , 18 5 Meetings/2013-06-27-midday , 19 5 MediaWiki 1.22/wmf8 , 20 5 GSoC2013-i18n , 21 5 Git/Conversion/pywikibot , 22 5 Outreach programs/status , 23 5 UniversalLanguageSelector , 24 5 Requests for comment/Deprecating inline styles , 25 5 Design/Typography

Jul 2013: 1 19 VisualEditor/TranslationCentral , 2 18 Google Summer of Code/2013 , 3 18 Gerrit/New repositories/Requests/Entries , 4 9 Wikimedia Engineering/Report/2013/June , 5 8 VisualEditor , 6 7 Quality Assurance/Meetings/2013-07-18 , 7 7 ResourceLoader/Core modules , 8 7 Parsoid , 9 6 Mobile web projects , 10 6 Wikimedia Mobile engineering/imported/Mobile team/Mobile web/Mission , 11 6 VisualEditor/Portal , 12 6 Wikimedia Engineering/2013-14 Goals , 13 6 Git/Conversion/pywikibot , 14 5 README , 15 5 VisualEditor/Portal/he , 16 5 Wikimedia Engineering/Report/2013/July , 17 5 VisualEditor/Portal/ja , 18 5 VisualEditor/Portal/Localization , 19 5 Editing team/Weekly triage meetings , 20 5 Universal Language Selector/FAQ , 21 5 VisualEditor/Portal/Keyboard shortcuts , 22 5 MediaWiki 1.22/Roadmap , 23 5 Git/Reviewers , 24 5 GuidedTour , 25 5 Outreach programs/status

Aug 2013: 1 31 Wikimedia Engineering/WMF Tech Days 2013/Brainstorming , 2 20 Gerrit/New repositories/Requests/Entries , 3 15 Google Summer of Code/2013 , 4 11 VisualEditor/TranslationCentral , 5 8 Reading/Multimedia/Architecture , 6 8 Requests for comment , 7 8 CLDR , 8 7 Requests for comment/LESS , 9 7 Notifications/Release Plan 2013 , 10 7 Wikimedia Engineering/Report/2013/July , 11 7 VisualEditor , 12 7 Bugzilla/Fields , 13 6 ResourceLoader/Core modules , 14 5 Requests for comment/Login security , 15 5 Flow/FAQ , 16 5 MediaWiki-Vagrant , 17 5 User rights , 18 4 Flow/MVP , 19 4 UpdateMediaWiki , 20 4 Wikimedia Release Engineering Team/Quarterly review, August 2013 , 21 4 CirrusSearch , 22 4 VisualEditor/Portal/Keyboard shortcuts , 23 4 Git/Reviewers , 24 4 Community metrics , 25 4 October 2011 Coding Challenge/Submissions

Sep 2013: 1 16 Wikimedia Engineering/WMF Tech Days 2013/Brainstorming , 2 15 Google Summer of Code/2013 , 3 13 Wikimedia Engineering/WMF Tech Days 2013 , 4 13 Gerrit/New repositories/Requests/Entries , 5 12 Requests for comment , 6 11 Outreach programs/status , 7 9 Outreach programs/Possible projects , 8 8 VisualEditor , 9 7 How to contribute , 10 6 Search/Old/CirrusSearchFeatures , 11 6 Flow/Design/Iteration 3 , 12 6 Flow/Design/Iteration 1 , 13 6 Wikimedia Engineering/Careers , 14 6 Requests for comment/LESS , 15 6 Beta Features , 16 6 Specs/HTML , 17 6 VisualEditor/status , 18 6 Pywikibot/Installation , 19 6 Parsoid , 20 6 What is MediaWiki? , 21 5 Beta Features/New Features , 22 5 Flow/Design/Iteration 2 , 23 5 Newsletter , 24 5 Wikimedia Engineering/Report/2013/September , 25 5 Wikimedia Engineering/2013-14 Goals

Oct 2013: 1 53 Architecture Summit 2014/Attendees , 2 17 Gerrit/New repositories/Requests/Entries , 3 12 Google Code-in/2013 , 4 11 How to contribute , 5 10 Outreach programs/Possible projects , 6 10 Outreach programs/status , 7 10 Requests for comment , 8 8 Outreachy/Round 7 , 9 7 Analytics/Hypercube , 10 7 Beta Features/New Features , 11 7 Notifications/Release Plan 2013 , 12 7 Beta Features , 13 7 Wikimedia Engineering/2013-14 Goals , 14 7 Flow/FAQ , 15 7 MediaWiki 1.22/Roadmap , 16 6 Password reset , 17 6 Design/Team/Process , 18 6 Archived Pages , 19 6 Flow/Design/FAQ , 20 6 Search/Old , 21 6 MediaWiki 1.22 , 22 6 Design , 23 6 VisualEditor/status , 24 6 Developers , 25 5 Events/FOSDEM/2014

Nov 2013: 1 27 Outreachy/Round 7 , 2 23 Google Code-in/2013 , 3 19 Gerrit/New repositories/Requests/Entries , 4 13 Outreach programs/Possible projects , 5 12 Media Viewer/About , 6 10 Architecture meetings/RFC review 2013-11-06 , 7 9 Beta Features/About , 8 8 Architecture meetings/RFC review 2013-11-20 , 9 8 Wikimedia Engineering/Report/2013/October , 10 8 Wikimedia Engineering/2013-14 Goals , 11 8 Bugzilla/Fields , 12 7 Requests for comment , 13 7 How to contribute , 14 6 Beta Features/Nearby Pages , 15 6 Enterprise MediaWiki hackathon , 16 6 MediaWiki 1.23/Roadmap , 17 6 Typography refresh , 18 6 Beta Features/New Features , 19 6 Starter kit , 20 6 MediaWiki 1.22 , 21 6 Search/Old/status , 22 6 VisualEditor/status , 23 6 Writing an extension for deployment , 24 6 BoardVote , 25 5 Zürich Hackathon 2014/Attendees

Dec 2013: 1 18 Media Viewer/About , 2 18 Gerrit/New repositories/Requests/Entries , 3 15 Requests for comment , 4 12 Bug management/Phabricator etiquette , 5 11 Outreach programs/Possible projects , 6 11 Gerrit/Project ownership , 7 10 Wikimedia Engineering/Report/2013/November , 8 9 Search/Old , 9 9 Outreach programs/status , 10 9 Project management tools , 11 8 Intersections with Wikidata , 12 8 MediaWiki 1.22/Known issues , 13 8 Zürich Hackathon 2014/Attendees , 14 8 Wikimedia Release Engineering Team , 15 8 Structured Discussions , 16 8 Bugzilla/Fields , 17 7 Architecture Summit 2014/RFC clusters , 18 7 Design , 19 7 How to report a bug , 20 7 Localisation , 21 6 Architecture meetings/RFC review 2013-12-18 , 22 6 Outreachy/Round 7 , 23 6 MediaWiki 1.22 , 24 6 Git/Reviewers , 25 6 Coding conventions/PHP

Jan 2014: 1 48 Architecture Summit 2014/Straw poll , 2 38 Architecture Summit 2014/Dinner sign-up , 3 23 Gerrit/Project ownership , 4 22 Bug management/Phabricator etiquette , 5 18 Architecture Summit 2014 , 6 17 Gerrit/New repositories/Requests/Entries , 7 15 Requests for comment/Passwords , 8 15 Media Viewer/About , 9 14 Search/Old , 10 12 Events/FOSDEM/2014 , 11 10 Facebook Open Academy , 12 10 Zürich Hackathon 2014/Attendees , 13 9 Wikimedia Engineering/Report/2013/December , 14 9 Universal Language Selector , 15 8 Requests for comment/HTML templating library , 16 8 Parsoid/Setup , 17 7 Architecture Summit 2014/RFC clusters , 18 7 Wikimedia Release Engineering Team , 19 7 Search/Old/status , 20 7 Upgrading , 21 7 Sites using MediaWiki/en , 22 6 Architecture Summit 2014/UI styling , 23 6 MediaWiki 1.23/Roadmap , 24 6 Typography refresh , 25 6 StructuredDiscussions

Feb 2014: 1 35 Zürich Hackathon 2014/Attendees , 2 28 Google Summer of Code/2014 , 3 28 Outreach programs/Possible projects , 4 16 Zürich Hackathon 2014/Topics , 5 15 Gerrit/New repositories/Requests/Entries , 6 13 Media Viewer/About , 7 12 Search/Old , 8 11 Gerrit/Project ownership , 9 10 Requests for comment/UploadWizard: scale to sister projects , 10 10 Requests for comment/Passwords , 11 9 MediaWiki/Homepage redesign/Preview , 12 8 NYC Enterprise MediaWiki Hackathon , 13 8 Bug management/Phabricator etiquette , 14 8 Typography refresh , 15 7 Design , 16 7 VisualEditor , 17 7 Requests for comment , 18 6 Page Previews , 19 6 Architecture meetings/RFC review 2014-02-05 , 20 6 Wikimedia Release Engineering Team , 21 6 Release notes/1.22 , 22 6 Search/Old/status , 23 6 VisualEditor/Feedback/LQT Archive 1 , 24 6 VisualEditor , 25 6 Installation guide

Mar 2014: 1 59 Google Summer of Code/2014 , 2 34 Zürich Hackathon 2014/Topics , 3 34 Zürich Hackathon 2014/Attendees , 4 23 Outreach programs/Possible projects , 5 20 Search/Old , 6 18 Outreachy/Round 8 , 7 17 Upstream projects , 8 15 Typography refresh , 9 14 Gerrit/New repositories/Requests/Entries , 10 12 Typography refresh/Font choice/Test , 11 12 Beta Features/Nearby Pages , 12 10 Universal Language Selector/WebFonts , 13 9 Zürich Hackathon 2014 , 14 9 Universal Language Selector/Design/Interlanguage links , 15 8 Project management tools/Review/Options , 16 8 Media Viewer/About , 17 8 Beta Features/About , 18 8 Outreach programs/Possible mentors , 19 7 Outreachy/Round 7 , 20 7 Git/Reviewers , 21 7 Requests for comment , 22 6 Typography refresh/Font choice , 23 6 Wikimedia Engineering/Report/2014/February , 24 6 Wikimedia Release Engineering Team , 25 6 Content translation

Apr 2014: 1 78 Requests for comment/Phabricator , 2 24 Zürich Hackathon 2014/Topics , 3 18 Zürich Hackathon 2014/Attendees , 4 17 Typography refresh , 5 17 Search/Old , 6 15 Gerrit/New repositories/Requests/Entries , 7 13 Page Previews , 8 11 Media Viewer/About , 9 11 Main page , 10 10 Git/Reviewers , 11 9 Wikimedia Platform Engineering/MediaWiki Core Team/Quarterly review, April 2014 , 12 9 Requests for comment , 13 8 Reading/Multimedia/Media Viewer/Survey , 14 8 Localisation , 15 7 Typography refresh/Font choice/Test , 16 7 Wikimedia Engineering/2013-14 Goals , 17 7 Configuring MediaWiki , 18 6 Wikimedia Engineering/Report/2014/March , 19 6 Reading/Multimedia/Media Viewer/Release Plan , 20 6 Outreachy/Round 8 , 21 6 Universal Language Selector/Design/Interlanguage links , 22 6 MediaWiki-Vagrant/Roles , 23 6 Wikimedia Release Engineering Team , 24 6 MediaWiki 1.23 , 25 6 Design

May 2014: 1 50 Zürich Hackathon 2014/Topics , 2 23 Gerrit/New repositories/Requests/Entries , 3 17 Google Summer of Code/2014 , 4 16 Zürich Hackathon 2014/Attendees , 5 15 Zürich Hackathon 2014/Schedule , 6 15 Performance guidelines , 7 15 Requests for comment/Phabricator , 8 13 VisualEditor , 9 9 Wikimedia Engineering/2014-15 Goals , 10 9 MediaWiki 1.23 , 11 8 Reading/Multimedia/Media Viewer/Release Plan , 12 8 Outreachy/Round 8 , 13 8 Zürich Hackathon 2014 , 14 8 MediaWiki-Vagrant , 15 8 Git/Reviewers , 16 8 Compatibility , 17 7 Wikimedia Engineering/Report/2014/April , 18 7 Sites using MediaWiki/en , 19 6 Performance profiling for Wikimedia code , 20 6 Phabricator/Plan , 21 6 Wikimedia Platform Engineering/MediaWiki Core Team/Backlog , 22 6 Media Viewer/About , 23 6 Compact Personal Bar , 24 6 Requests for comment , 25 6 Upgrading

Jun 2014: 1 32 Wikimedia Engineering/2014-15 Goals , 2 17 Tool Labs/Collection of issues after Toolserver shutdown , 3 17 Gerrit/New repositories/Requests/Entries , 4 16 Requests for comment/Alternate disclosure policy , 5 16 Release Management RFP/2014/Mark y Markus LLC , 6 13 Release Management RFP/2014/Consortium , 7 11 Media Viewer/About , 8 9 Google Summer of Code/2014 , 9 9 MediaWiki 1.23 , 10 9 Gerrit/Project ownership , 11 7 Wikimedia Engineering/Report/2014/May , 12 7 SUL finalisation , 13 7 Security for developers/Architecture , 14 7 Wikimedia Release Engineering Team , 15 6 MediaWiki 1.24/Roadmap , 16 6 Git/Reviewers , 17 6 VisualEditor , 18 6 Growth/Growth 2014/status , 19 6 VisualEditor , 20 6 Multimedia/status , 21 6 Developing extensions , 22 5 How to become a MediaWiki hacker/Volunteer achievements , 23 5 Distribution/Use cases , 24 5 Design/Archive/WikiFont , 25 5 Page Previews

Jul 2014: 1 126 Tool Labs/Collection of issues after Toolserver shutdown , 2 16 Requests for comment/API roadmap , 3 14 Wikimedia Engineering/2014-15 Goals , 4 13 Page Previews , 5 13 Gerrit/New repositories/Requests/Entries , 6 12 Gerrit/Project ownership , 7 11 Requests for comment/Caching references , 8 9 Thumbnail style update , 9 9 Media Viewer/About , 10 9 Wikimedia Release Engineering Team , 11 8 Requests for comment/Alternate disclosure policy , 12 7 Skinning Part 1 , 13 6 Wikimedia Engineering/Report/2014/July/summary , 14 6 VisualEditor/Design/User testing , 15 6 Wikimedia Research/Showcase , 16 6 Parsoid/Setup , 17 6 Compact Personal Bar , 18 6 Git/Reviewers , 19 6 Special pages , 20 5 Requests for comment/A central repository for templates and other bits and pieces , 21 5 Wikimedia Engineering/Report/2014/July , 22 5 Wikimedia Platform Engineering/MediaWiki Core Team/Quarterly review, July 2014 , 23 5 Wikimedia Apps/Android release policy , 24 5 Bug management/Triage/20140724 , 25 5 Wikimedia Engineering/Report/2014/June

Aug 2014: 1 27 Tool Labs/Collection of issues after Toolserver shutdown , 2 17 Groups/Proposals/MediaWiki Cooperation , 3 14 Search/Old , 4 14 MediaWiki-Vagrant , 5 13 Gerrit/New repositories/Requests/Entries , 6 12 VisualEditor/2014 Translathon , 7 10 Git/Reviewers , 8 9 Requests for comment/API roadmap , 9 9 Math , 10 8 Outreach programs/Possible projects , 11 8 Compatibility , 12 7 Universal Language Selector/Design/Interlanguage links , 13 7 Gerrit/Project ownership , 14 7 Coding conventions , 15 6 Icon standardisation , 16 6 Page Previews , 17 6 Media Viewer/About , 18 6 Google Summer of Code/2014 , 19 6 VisualEditor , 20 6 Differences between Wikipedia, Wikimedia, MediaWiki, and wiki , 21 6 Skin configuration , 22 6 Main page , 23 5 OOUI , 24 5 MediaWiki Stakeholders' Group/Meetings/2014-08-22 Telco , 25 5 MediaWiki UI

Sep 2014: 1 20 Search/Old , 2 17 Tool Labs/Collection of issues after Toolserver shutdown , 3 13 Page Previews , 4 12 Compact Personal Bar , 5 12 Outreach programs/Possible projects , 6 10 Groups/Proposals/MediaWiki Cooperation , 7 10 Phabricator , 8 9 HHVM , 9 9 Gerrit/New repositories/Requests/Entries , 10 8 HHVM/About , 11 8 Git/Reviewers , 12 6 MediaWiki Developer Summit 2015 , 13 6 Beta Features/Other projects sidebar , 14 6 MediaWiki 1.24 , 15 6 MediaWiki-Vagrant , 16 6 Gerrit/Project ownership , 17 5 MediaWiki 1.25 , 18 5 Wikimedia Engineering/Report/2014/August , 19 5 Wikimedia Engineering/2014-15 Goals , 20 5 Wikimedia Platform Engineering/MediaWiki Core Team/Backlog , 21 5 SUL finalisation , 22 5 Structured Discussions/Rollout , 23 5 Mobile/Release history , 24 5 VisualEditor/status , 25 5 Math

Oct 2014: 1 16 Gerrit/New repositories/Requests/Entries , 2 14 Outreachy/Round 9 , 3 14 HHVM , 4 13 Page Previews , 5 12 Wikimedia Engineering/2014-15 Goals , 6 9 Tool Labs/Collection of issues after Toolserver shutdown , 7 9 ConfirmEdit , 8 8 Wikimedia Engineering/2014-15 Goals/Q2 , 9 8 MediaWiki Developer Summit 2015 , 10 8 Phabricator/Help , 11 8 Search/Old , 12 8 Math , 13 7 OOUI , 14 7 Wikimedia Engineering/2014-15 Goals/Q3 , 15 7 TemplateData , 16 6 Reading/Web/Team/Onboarding , 17 6 MediaWiki Stakeholders' Group/Tasks/Feature wishlist , 18 6 Amsterdam Hackathon 2014/Attendees , 19 6 Groups/Proposals/MediaWiki Cooperation , 20 6 Media Viewer/About , 21 6 Outreach programs/Possible projects , 22 6 Gerrit/Project ownership , 23 6 Phabricator , 24 6 How to debug , 25 5 WikiGrok/Claim suggestions

Nov 2014: 1 20 Google Code-in/2014 , 2 16 Gerrit/New repositories/Requests/Entries , 3 12 Phabricator/versus Bugzilla , 4 11 Page Previews , 5 10 MediaWiki Developer Summit 2015 , 6 10 Phabricator/Help , 7 9 MediaWiki Developer Summit 2015/Attendees , 8 9 MediaWiki 1.24 , 9 8 Tool Labs/Collection of issues after Toolserver shutdown , 10 8 Media Viewer/About , 11 8 VisualEditor , 12 8 Phabricator , 13 7 Phabricator/Bugzilla default CCs , 14 7 Phabricator/Bugzilla migration weekend , 15 7 Phabricator/Diffusion/Callsign naming conventions/Existing repositories , 16 7 Amsterdam Hackathon 2014/Attendees , 17 7 Groups/Proposals/MediaWiki Cooperation , 18 6 MediaWiki Stakeholders' Group/Meetings/2014-11-07 Telco , 19 6 Wikimedia Engineering/2014-15 Goals/Q3 , 20 6 MediaWiki Stakeholders' Group , 21 6 Mobile web projects/status , 22 6 User rights , 23 6 Localisation , 24 6 Upgrading , 25 5 Wikibase/Indexing

Dec 2014: 1 18 MediaWiki Developer Summit 2015 , 2 18 Page Previews , 3 12 Wikimedia Engineering/2014-15 Goals/Q3 , 4 10 Wikibase/Indexing , 5 9 MediaWiki-Vagrant , 6 8 Google Code-in/2014 , 7 8 Phabricator , 8 7 Phabricator/Project management , 9 7 Phabricator/Help , 10 7 Compact Personal Bar , 11 7 Gerrit/New repositories/Requests/Entries , 12 7 VisualEditor/Feedback/LQT Archive 1 , 13 7 VisualEditor/status , 14 6 Phabricator/Security , 15 6 Outreachy/Round 9 , 16 6 Structured Discussions , 17 6 Git/Reviewers , 18 5 Phabricator/Bots , 19 5 MediaWiki Developer Summit 2015/Attendees , 20 5 MediaWiki 1.25 , 21 5 Tool Labs/Collection of issues after Toolserver shutdown , 22 5 Design , 23 5 Coding conventions/PHP , 24 5 PageTriage , 25 5 Localisation

Jan 2015: 1 49 MediaWiki Developer Summit 2015 , 2 23 Gerrit/Project ownership , 3 16 Wikimedia Engineering/2014-15 Goals , 4 16 Page Previews , 5 12 Gerrit/New repositories/Requests/Entries , 6 8 MediaWiki-Vagrant , 7 7 Requests for comment/Hierator , 8 7 MediaWiki Developer Summit 2015/Attendees , 9 7 Wikimedia Engineering/2014-15 Goals/Q3 , 10 7 Phabricator/Help , 11 7 Developers/Maintainers , 12 6 Compact Personal Bar , 13 6 VisualEditor , 14 6 Phabricator , 15 6 ConfirmAccount , 16 6 Preventing access , 17 5 Wikimedia Engineering/Report/2014/December , 18 5 Version check and opt-in site reporting , 19 5 Wikibase/Indexing , 20 5 MediaWiki 1.25 , 21 5 Beta Features/Other projects sidebar , 22 5 StructuredDiscussions , 23 5 Hosting services , 24 5 Design , 25 5 Download from Git

Feb 2015: 1 32 Wikimedia Hackathon 2015/Buddies , 2 17 Gerrit/New repositories/Requests/Entries , 3 13 Wikimedia Engineering/2014-15 Goals , 4 8 Wikimedia Platform Engineering/MediaWiki Core Team/Backlog/Improve dumps , 5 8 Phabricator/Help , 6 8 Editing team/Weekly triage meetings , 7 7 Extension registration , 8 7 Phabricator/Project management , 9 7 Wikimedia Research/Showcase , 10 7 Universal Language Selector/FAQ , 11 7 MediaWiki-Vagrant , 12 6 Page Previews , 13 6 Content translation/status , 14 6 Outreach programs/Possible projects , 15 6 Scribunto/Lua reference manual , 16 6 VisualEditor/status , 17 5 MediaWiki 1.24 , 18 5 Media Viewer/About , 19 5 VisualEditor , 20 5 Gerrit/Project ownership , 21 5 Sites using MediaWiki/en , 22 4 HTML templates , 23 4 Gather , 24 4 Gather , 25 4 Wikimedia Release Engineering Team/Process

Mar 2015: 1 53 Wikimedia Hackathon 2015/Attendees , 2 40 Wikimedia Hackathon 2015/Buddies , 3 32 Wikimedia Engineering/2014-15 Goals , 4 13 VisualEditor , 5 12 Wikimedia Hackathon 2015 , 6 9 Gerrit/New repositories/Requests/Entries , 7 8 Gather/FAQ , 8 8 VisualEditor , 9 7 Requests for comment/Master-slave datacenter strategy for MediaWiki , 10 7 Phabricator/Help , 11 7 Page Previews , 12 7 MediaWiki-Vagrant , 13 7 Outreach programs/Possible projects , 14 6 Team Practices Group/Glossary , 15 6 VisualEditor/Beta Features/General , 16 5 VisualEditor/Survey 2015 , 17 5 Flow/Volunteers to test , 18 5 Outreachy/Past projects , 19 5 Google Summer of Code/2015 , 20 5 Team Practices Group/Health check survey , 21 5 Contributors/status , 22 5 Universal Language Selector/Design/Interlanguage links , 23 5 Coding conventions/PHP , 24 5 VisualEditor/Feedback/LQT Archive 1 , 25 4 VisualEditor/Survey 2015/fr

Apr 2015: 1 19 Gerrit/New repositories/Requests/Entries , 2 18 Wikimedia Hackathon 2015/Attendees , 3 10 Wikimedia Engineering/2014-15 Goals , 4 9 Phabricator/Help , 5 9 Content translation , 6 9 Git/Reviewers , 7 9 VisualEditor , 8 8 Wikimedia Apps/Share a fact , 9 7 Wikimedia Hackathon 2015/Mobile apps , 10 7 Wikimedia Hackathon 2015/Buddies , 11 7 How to become a MediaWiki hacker , 12 5 Wikimedia Hackathon 2015 , 13 5 MediaWiki 1.25 , 14 5 Hackathons , 15 5 Citoid , 16 5 TemplateData , 17 5 Scribunto/Lua reference manual , 18 5 Main page , 19 5 Version lifecycle , 20 4 Reading/Mobile needs from MediaWiki API , 21 4 Wikimedia Language engineering/Reports/2014-15 Q3 Report , 22 4 Wikimedia Security Team/Check/iSEC Assessment 2014 , 23 4 VisualEditor/IME Testing , 24 4 Outreachy/Past projects , 25 4 HTML templates

May 2015: 1 55 Wikimedia Hackathon 2015/Buddies , 2 42 Wikimedia Hackathon 2015/Program , 3 40 Wikimedia Hackathon 2015/Attendees , 4 19 Wikimedia Hackathon 2015 , 5 13 Gerrit/New repositories/Requests/Entries , 6 9 Wikimedia Engineering/2014-15 Goals , 7 9 VisualEditor , 8 8 Wikimedia Apps/Android FAQ , 9 8 Extension registration , 10 8 MediaWiki 1.25 , 11 8 VisualEditor , 12 7 Lyon Hackathon 2015/Keysigning , 13 7 Phabricator/Help , 14 7 Download from Git , 15 6 MediaWiki 1.26/Roadmap , 16 6 Universal Language Selector/Design/Interlanguage links , 17 5 Reading/Features , 18 5 Wikimedia Discovery , 19 5 Reading/Mobile needs from MediaWiki API , 20 5 Content translation/Languages , 21 5 Graph/Demo , 22 5 Graph , 23 5 Community Engagement (Product) , 24 5 Contributors , 25 5 Content translation

Jun 2015: 1 23 Wikimedia Engineering/2015-16 Q1 Goals , 2 19 Gerrit/New repositories/Requests/Entries , 3 10 VisualEditor , 4 9 Citoid , 5 8 Wikimedia Discovery , 6 7 Lightning Talks , 7 7 Wikimedia Discovery/Team/Onboarding , 8 7 Phabricator/Help , 9 7 Design , 10 6 Wikimedia Release Engineering Team/Goals/201516Q1-planning , 11 6 Architecture focus 2015 , 12 6 MediaWiki 1.26/Roadmap , 13 6 Phabricator , 14 5 Reading/Web/SWAT policy , 15 5 VisualEditor/2015 Process Review , 16 5 Team Practices Group/Phabricator tips , 17 5 Wikimedia Apps/Android FAQ , 18 5 Team Practices Group , 19 5 Wikimedia Engineering/2014-15 Goals , 20 5 Parsoid/Setup , 21 5 Wikimedia Apps/Team , 22 5 TemplateData , 23 5 Coding conventions , 24 5 SyntaxHighlight , 25 4 Deployment tooling/Future

Jul 2015: 1 17 Gerrit/New repositories/Requests/Entries , 2 15 Structured Discussions/Request Structured Discussions on a page , 3 11 Wikimedia Engineering/2015-16 Q1 Goals , 4 11 Beta Features/Other projects sidebar , 5 10 Wikimedia Discovery , 6 8 SyntaxHighlight , 7 7 Wikimedia Discovery/Team/Onboarding , 8 7 Phabricator/Help , 9 7 Phabricator , 10 6 Project management tools/2015 survey , 11 6 Readers , 12 6 MediaWiki-Vagrant , 13 6 VisualEditor , 14 6 Wikimedia Maps/2015-2017 , 15 5 Scrum of scrums/2015-07-01 , 16 5 Citoid/Enabling Citoid on your wiki , 17 5 Wikimedia Language engineering/Reports/2015-June , 18 5 Contributors , 19 5 Wikimedia Engineering/2014-15 Goals , 20 5 Design , 21 5 Git/Reviewers , 22 5 Download , 23 4 Reading/QA/Sample articles , 24 4 Education Program/July 2015 roadmap notes , 25 4 VisualEditor/Portal/TemplateData/fa

Aug 2015: 1 24 Structured Discussions/Request Structured Discussions on a page , 2 22 Code of Conduct , 3 19 VisualEditor:Test , 4 15 Beta Features/Other projects sidebar , 5 14 Gerrit/New repositories/Requests/Entries , 6 9 Analytics/Wikistats/TrafficReports/Future per report B2 , 7 9 Page Previews , 8 9 Google Summer of Code/Past projects , 9 8 Reading/Strategy/Kickoff , 10 8 Wikimedia Engineering/2015-16 Q1 Goals , 11 8 Wikimedia Apps/Android FAQ , 12 8 Wikimedia Maps/2015-2017 , 13 7 Lightning Talks , 14 7 Phabricator/Help , 15 7 Design , 16 7 VisualEditor , 17 6 Team Practices Group/Measuring Types of Work , 18 6 Wikimedia Release Engineering Team/Skill matrix , 19 6 VisualEditor/Gadgets , 20 6 Phabricator , 21 6 ResourceLoader/Migration guide (users) , 22 6 How to contribute , 23 6 Upgrading , 24 5 Wikimedia User Interface/User-stories , 25 5 Reading/Strategy

Sep 2015: 1 18 Structured Discussions/Request Structured Discussions on a page , 2 14 Gerrit/New repositories/Requests/Entries , 3 11 VisualEditor:Test , 4 10 Lightning Talks , 5 8 Code of Conduct , 6 8 Wikimedia Engineering/2015-16 Q1 Goals , 7 8 Phabricator/Help , 8 8 Wikimedia Research/Showcase , 9 7 Reading/Strategy/Strategy Process , 10 7 Wikimedia Engineering/2015-16 Q2 Goals , 11 7 Wikimedia Developer Summit/2016 , 12 6 Wikimedia Language engineering/Reports/2015-August , 13 6 Git/Reviewers , 14 6 Gerrit/Tutorial , 15 6 How to contribute , 16 6 Main page , 17 5 Wikimedia Maps/2015-2017/Future Plans , 18 5 Page Previews , 19 5 Starter kit , 20 5 Structured Discussions , 21 5 Wikimedia Maps/2015-2017 , 22 5 Phabricator , 23 5 Collaboration , 24 4 MediaWiki 1.27/Roadmap , 25 4 Analytics/Wikistats/TrafficReports/Future per report B2

Oct 2015: 1 27 Structured Discussions/Request Structured Discussions on a page , 2 20 Wikimedia Engineering/2015-16 Q2 Goals , 3 15 Gerrit/New repositories/Requests/Entries , 4 12 VisualEditor:Test , 5 9 Page Previews , 6 7 Community Tech team/Community Wishlist Survey/Invitation , 7 7 Code of Conduct , 8 7 Wikimedia Discovery , 9 7 Wikimedia Engineering , 10 6 Google Code-in/2015 , 11 6 Wikimedia Language engineering/Reports/2015-September , 12 6 Analytics/Wikistats/TrafficReports/Future per report B2 , 13 6 Wikimedia Engineering/2015-16 Q1 Goals , 14 6 Beta Features , 15 6 MediaWiki-Vagrant , 16 6 Coding conventions/PHP , 17 6 How to report a bug , 18 5 Wikipedia.org Portal Improvements , 19 5 Developer Relations/Weekly summary , 20 5 Outreachy/Round 11 , 21 5 Wikimedia Release Engineering Team/Skill matrix , 22 5 Reading/Component responsibility , 23 5 Wikimedia Apps/Team/Android/App hacking , 24 5 Community Tech , 25 5 Outreach programs/Life of a successful project

Nov 2015: 1 26 Google Code-in/2015 , 2 15 WMF product development process/2015-11-05 , 3 12 Lightning Talks , 4 11 Structured Discussions , 5 10 Wikimedia Discovery/FAQ , 6 10 WMF product development process , 7 10 VisualEditor:Test , 8 10 Structured Discussions/Request Structured Discussions on a page , 9 10 Page Previews , 10 10 Universal Language Selector/Design/Interlanguage links , 11 10 Wikimedia Audiences , 12 9 Readers , 13 8 Contributors , 14 8 Gerrit/New repositories/Requests/Entries , 15 8 Wikimedia Engineering , 16 7 Reading/Quarterly Planning/Q3 , 17 7 MediaWiki 1.26 , 18 7 RelatedArticles , 19 7 Compatibility , 20 6 Reading/Strategy/Strategy Process/Testing , 21 6 Analytics/Wikistats/TrafficReports/Future per report B2 , 22 6 Reading/Component responsibility , 23 6 Beta Features , 24 6 Development statistics , 25 6 Data formats

Dec 2015: 1 27 Wikimedia Engineering/2015-16 Q3 Goals , 2 19 Google Code-in/2015 , 3 15 Wikimedia Developer Summit/2016/Dinner sign-up , 4 13 CirrusSearch/CompletionSuggester , 5 12 Wikimedia Audiences , 6 10 Wikimedia Engineering/2015-16 Q2 Goals , 7 9 Reading/Quarterly Planning/Q3 , 8 9 Gerrit/New repositories/Requests/Entries , 9 8 VisualEditor:Test , 10 8 Readers , 11 7 Lightning Talks , 12 7 Extension registration , 13 6 Wikimedia Language engineering/Reports/2015-November , 14 6 Wikimedia Developer Summit/2016/2016-01-05 , 15 6 Wikimedia Developer Summit/2016/2016-01-04 , 16 6 Reading/Web/Projects/Related pages , 17 6 Wikimedia Hackathon 2016 , 18 6 Phabricator/Creating and renaming projects , 19 6 FAQ , 20 5 Wikimedia Developer Summit/2016/Attendees , 21 5 Wikimedia Developer Summit/2016 , 22 5 Wikimedia Engineering/2015-16 Q1 Goals , 23 4 Wikimedia Security Team/SDLC , 24 4 MediaWiki Usage Report 2015 , 25 4 Requests for comment/Migrate code review and management to Phabricator from Gerrit

Jan 2016: 1 87 Wikimedia Developer Summit/2016/Dinner sign-up , 2 19 Wikimedia Developer Summit/2016/2016-01-04 , 3 19 VisualEditor:Test , 4 18 Wikimedia Developer Summit/2016/2016-01-05 , 5 17 Wikimedia Developer Summit/2016 , 6 16 CirrusSearch/CompletionSuggester , 7 14 Structured Discussions/Request Structured Discussions on a page , 8 11 Wikimedia Audiences , 9 11 Gerrit/New repositories/Requests/Entries , 10 10 Wikimedia Hackathon 2016 , 11 9 Wikimedia Hackathon 2016/Attendees , 12 9 Wikimedia Developer Summit/2016/transport sharing , 13 9 Wikimedia Engineering/2015-16 Q2 Goals , 14 7 Wikimedia Discovery/Knight FAQ , 15 7 Wikimedia Developer Summit/2016/Attendees , 16 7 Reading/Web/Projects/Related pages , 17 7 Wikimedia Discovery , 18 7 Math , 19 6 Notifications/Sorting schemes , 20 6 Team Practices Group/Tracking core and strategic work , 21 6 Wikimedia Release Engineering Team/Skill matrix , 22 6 Events/FOSDEM/2016 , 23 6 Wikimedia Research/Showcase , 24 6 Git/Reviewers , 25 5 CategoryMembershipChanges/de

Feb 2016: 1 20 Reading/Web/Projects/Improve in-article language switching on mobile web , 2 20 Reading/Quarterly planning/Q4 , 3 19 Wikimedia Hackathon 2016/Attendees , 4 15 CirrusSearch/CompletionSuggester , 5 11 Wikimedia Discovery , 6 11 Wikimedia Audiences , 7 11 Gerrit/New repositories/Requests/Entries , 8 10 Wikimedia Discovery/FAQ , 9 10 Wikibase/Indexing/SPARQL Query Examples , 10 8 EMWCon Spring 2016 , 11 7 Wikimedia Hackathon 2016 , 12 7 VisualEditor:Test , 13 7 Structured Discussions/Request Structured Discussions on a page , 14 7 Lightning Talks , 15 7 Readers , 16 6 Discovery/2016-02-16 Discussing Knowledge Engine with Lila , 17 6 MediaWiki 1.27/Roadmap , 18 6 Wikimedia Engineering/2015-16 Q4 Goals , 19 6 Phabricator/Help , 20 6 VisualEditor , 21 6 SyntaxHighlight , 22 5 Wikipedia Education Program/Dashboard/FAQ , 23 5 Phabricator/February 2016 upgrade , 24 5 Reading/FY2016-2017 Architecture Needs , 25 5 Wikimedia Language engineering/Reports/2016-January

Mar 2016: 1 25 Wikimedia Engineering/2015-16 Q4 Goals , 2 22 Wikimedia Hackathon 2016/Attendees , 3 17 Wikimedia Hackathon 2016/ParticipantInfo , 4 14 WikiArabia Tech Meetup 2016 , 5 13 Wikimedia Hackathon 2016 , 6 13 Wikimedia Audiences , 7 12 Gerrit/New repositories/Requests/Entries , 8 10 Structured Discussions/Request Structured Discussions on a page , 9 9 Wikimedia Engineering/2015-16 Q3 Goals , 10 8 WikiArabia Tech Meetup 2016/Transport , 11 8 WikiArabia Tech Meetup 2016/shared taxi , 12 8 Wikimedia Hackathon 2016/Program , 13 8 Wikibase/Indexing/SPARQL Query Examples , 14 7 Wikimedia Discovery/Portal Team/Roles and responsibilities , 15 7 VisualEditor:Test , 16 7 Wikimedia Discovery , 17 6 User Interaction Consultation , 18 6 Wikimedia Language engineering/Reports/2016-February , 19 6 VisualEditor/Single edit tab , 20 6 Reading/Web/Projects/Related pages , 21 6 Wikimedia Release Engineering Team/Skill matrix , 22 6 Phabricator/Project management , 23 5 User Interaction Consultation/start proper maintenance of the really good existing stuff. , 24 5 Discovery/Status updates/2017-10-09 , 25 5 Reading/Web/Projects/Related pages/Draft RFC

Apr 2016: 1 41 Wikimedia Hackathon 2016/Showcase , 2 24 Wikimedia Hackathon 2016/Program , 3 18 Gerrit/New repositories/Requests/Entries , 4 11 Wikimedia Hackathon 2016 , 5 10 Wikimedia Hackathon 2016/ParticipantInfo , 6 10 Wikimedia Engineering/2015-16 Q3 Goals , 7 9 Wikimedia Audiences , 8 8 Wikibase/Indexing/SPARQL Query Examples , 9 8 MediaWiki-Vagrant , 10 7 Wikimedia Maps/2015-2017/Conversation about interactive map use , 11 7 EMWCon Spring 2016 , 12 7 WMDE Engineering , 13 7 Wikimedia Engineering/2015-16 Q4 Goals , 14 7 VisualEditor:Test , 15 7 VisualEditor , 16 6 Discovery/Status updates/2017-10-09 , 17 6 Content translation , 18 5 3D , 19 5 Wikimedia Language engineering/Reports/2016-March , 20 5 WMDE Engineering/Wikidata , 21 5 WMDE Engineering/Mentoring , 22 5 Wikimedia Hackathon 2016/Attendees , 23 5 MediaWiki 1.27/Roadmap , 24 5 Structured Discussions/Request Structured Discussions on a page , 25 5 MediaWiki Stakeholders' Group

May 2016: 1 66 Analytics/Wikistats/DumpReports/Future per report , 2 18 EMWCon Spring 2016 , 3 15 Wikimedia Audiences , 4 13 Reading/Quarterly planning/FY2016-2017/Q1 , 5 12 Page Previews , 6 10 Wikibase/Indexing/SPARQL Query Examples , 7 9 Discovery/Status updates/2017-10-09 , 8 9 VisualEditor:Test , 9 8 Gerrit/New repositories/Requests/Entries , 10 7 Page Previews/preferences , 11 7 Wikimedia Engineering/2016-17 Q1 Goals , 12 7 Sites using MediaWiki/en , 13 6 MediaWiki 1.28/Roadmap , 14 6 Wikimedia Engineering/2015-16 Q4 Goals , 15 6 Phabricator/Project management , 16 6 Scribunto/Lua reference manual , 17 5 EMWCon Spring 2016/Panel Discussion Day 1 , 18 5 EMWCon Spring 2016/Program , 19 5 Wikimedia Language engineering/Reports/2016-April , 20 5 Team Practices Group/Goals/FY2016Q4 , 21 5 Wikimedia Maps/2015-2017/Conversation about interactive map use , 22 5 SessionManager and AuthManager , 23 5 Pywikibot/Installation , 24 4 Parsing/Replacing Tidy , 25 4 Wikimedia Technical Committee/Minutes

Jun 2016: 1 22 Wikimedia Engineering/2016-17 Q1 Goals , 2 14 Wikimedia Audiences , 3 11 Wikibase/Indexing/SPARQL Query Examples , 4 9 VisualEditor:Test , 5 9 Page Previews , 6 9 Gerrit/New repositories/Requests/Entries , 7 8 Analytics/Wikistats/DumpReports/Future per report , 8 8 MediaWiki 1.27 , 9 8 Design , 10 7 Edit Review Improvements , 11 7 RevisionSlider , 12 7 Discovery/Status updates/2017-10-09 , 13 7 Wikidata Query Service/User Manual , 14 7 MediaWiki-Vagrant , 15 6 Universal Language Selector/Compact Language Links , 16 6 VisualEditor , 17 5 VisualEditor/Roadmap/Update 2016-06-23 , 18 5 Core Infrastructure Initiative Best Practices badge , 19 5 Wikimedia Technical Committee/Minutes , 20 5 Wikimedia Engineering/2015-16 Q4 Goals , 21 5 Wikimedia Discovery , 22 5 Git/Reviewers , 23 4 Team Practices Group/How To Engage With TPG , 24 4 Wikimedia Apps/Team/iOS/Notifications , 25 4 Wikipedia.org add mobile app badges

Jul 2016: 1 20 Page Previews , 2 9 Wikimedia Audiences , 3 8 Wikipedia.org updated page layout , 4 8 Wikibase/Indexing/SPARQL Query Examples , 5 8 Gerrit/New repositories/Requests/Entries , 6 7 VisualEditor:Test , 7 6 Analytics/Wikistats/DumpReports/Future per report , 8 6 Discovery/Status updates/2017-10-09 , 9 6 Wikimedia Release Engineering Team/Skill matrix , 10 6 Structured Discussions/Request Structured Discussions on a page , 11 6 Design , 12 6 MobileFrontend , 13 6 Page table , 14 5 Universal Language Selector/Compact Language Links , 15 5 Wikimedia Language engineering/Reports/2016-June , 16 5 Wikimedia Research/Goals/RDFY17Q1 , 17 5 RevisionSlider , 18 5 Wikimedia Engineering/2016-17 Q1 Goals , 19 5 Wikimedia Discovery , 20 5 Contributors , 21 5 VisualEditor , 22 4 Scrum of scrums/2016-07-13 , 23 4 Team Practices Group/How To Engage With TPG , 24 4 Edit Review Improvements , 25 4 Wikimedia Technical Committee/Minutes

Aug 2016: 1 20 Page Previews , 2 17 Wikibase/Indexing/SPARQL Query Examples , 3 14 Reading/Quarterly planning/FY2016-2017/Q2 , 4 13 Wikimedia Audiences , 5 11 VisualEditor:Test , 6 11 Gerrit/New repositories/Requests/Entries , 7 10 Wikimedia Engineering/2016-17 Q2 Goals , 8 9 ORES review tool , 9 9 Structured Discussions/Request Structured Discussions on a page , 10 8 Technical Collaboration Guidance , 11 7 Reading/Readers contributions , 12 7 MediaWiki 1.28/Roadmap , 13 6 Requests for comment/A Spec For Wikitext , 14 6 Wikimedia Discovery , 15 6 Developers/Maintainers , 16 6 Configuration settings , 17 5 \"Keep me logged in\" extended to one year/fr , 18 5 \"Keep me logged in\" extended to one year , 19 5 Wikimedia Developer Summit/2017 , 20 5 Wikimedia Engineering/2016-17 Q1 Goals , 21 5 Discovery/Status updates/2017-10-09 , 22 5 Wikimedia Research/Showcase , 23 5 Database transactions , 24 5 Installation guide , 25 5 Hooks

Sep 2016: 1 24 Wikimedia Engineering/2016-17 Q2 Goals , 2 12 Wikimedia Audiences , 3 11 Page Previews , 4 9 Wikimedia Developer Summit/2017/About , 5 9 Wikimedia Developer Summit/2017 , 6 8 Wikibase/Indexing/SPARQL Query Examples , 7 7 Cross-wiki Search Result Improvements , 8 7 Requests for comment/Multi-Content Revisions , 9 7 Discovery/Status updates/2017-10-09 , 10 7 VisualEditor:Test , 11 7 Wikimedia Engineering , 12 6 Wikimedia Developer Summit/2017/Topic ideas , 13 6 Cross-wiki Search Result Improvements/Design , 14 6 Wikimedia Language engineering/Reports/2016-August , 15 6 Gerrit/Tutorial , 16 6 Gerrit/New repositories/Requests/Entries , 17 5 Reading/Readers contributions , 18 5 ORES review tool , 19 5 MediaWiki 1.28/Roadmap , 20 5 Wikimedia Engineering/2016-17 Q1 Goals , 21 5 Wikimedia Apps/Team/Android/App hacking , 22 5 Design , 23 5 Git/Reviewers , 24 5 Resetting passwords , 25 4 Wikimedia Discovery/Search/Glossary

Oct 2016: 1 16 Google Code-in/2016 , 2 12 Wikimedia Developer Summit/2017 , 3 11 Wikimedia Audiences , 4 10 Wikimedia Engineering/2016-17 Q2 Goals , 5 10 VisualEditor:Test , 6 10 Page Previews , 7 9 Gerrit/New repositories/Requests/Entries , 8 8 Wikimedia Research/Showcase , 9 7 Wikimedia Engineering/2016-17 Q1 Goals , 10 7 Developers/Maintainers , 11 7 Sites using MediaWiki/en , 12 6 Parsing/Replacing Tidy , 13 6 Team Practices Group/Team Norms , 14 6 Scribunto/Lua reference manual , 15 5 Wikimedia Developer Summit/2017/How to grow our technical community , 16 5 Wikimedia Developer Summit/2017/Building on Wikimedia services: APIs and Developer Resources , 17 5 2017 wikitext editor , 18 5 MediaWiki 1.28/Roadmap , 19 5 Discovery/Status updates/2017-10-09 , 20 5 Wiki family , 21 4 Wikimedia Language engineering/Reports/2016-September , 22 4 Requests for comment/JSON validation , 23 4 Wikimedia Developer Summit/2017/Call for participation , 24 4 Wikimedia Developer Summit/2017/About , 25 4 Wikimedia Developer Summit/2017/Program

Nov 2016: 1 32 Google Code-in/2016 , 2 14 Gerrit/New repositories/Requests/Entries , 3 13 Wikimedia Audiences , 4 10 Wikimedia Engineering/2016-17 Q2 Goals , 5 10 Page Previews , 6 8 VisualEditor:Test , 7 7 EMWCon Spring 2017 , 8 7 Wikimedia Developer Summit/2017 , 9 7 Reading/Web/Projects/Related pages , 10 7 Suggestions for extensions to be integrated , 11 6 ORES review tool , 12 6 RevisionSlider , 13 6 Media Viewer/About , 14 5 Wikimedia Developer Summit/2017/Dinner sign-up , 15 5 Wikispeech/Logo , 16 5 MediaWiki 1.29/Roadmap , 17 5 Contributors , 18 4 Scrum of scrums/2016-11-16 , 19 4 Design/Statement of purpose , 20 4 Parsing/Replacing Tidy/FAQ , 21 4 Scrum of scrums/2016-10-26 , 22 4 Google Code-in/Mentors , 23 4 Page Previews/2016 A/B Tests , 24 4 Wikimedia Developer Summit/2017/About , 25 4 Phabricator/Help

Dec 2016: 1 24 Wikimedia Developer Summit/2017/Participant Info , 2 24 Wikimedia Engineering/2016-17 Q3 Goals , 3 13 VisualEditor:Test , 4 11 2017 wikitext editor , 5 10 Wikispeech , 6 9 Wikimedia Audiences , 7 8 Wikimedia Developer Summit/2017/Program , 8 7 EMWCon Spring 2017 , 9 7 Wikimedia Engineering/2016-17 Q2 Goals , 10 7 Gerrit/New repositories/Requests/Entries , 11 6 Wikimedia Language engineering/Reports/2016-November , 12 6 Wikimedia Developer Summit/2017/Dinner sign-up , 13 6 Wikimedia Developer Summit/2017 , 14 6 RevisionSlider , 15 6 MediaWiki-Vagrant , 16 6 Git/Reviewers , 17 6 Scribunto/Lua reference manual , 18 6 InputBox , 19 5 MediaWiki 1.28 , 20 5 Discovery/Status updates/2017-10-09 , 21 5 Contributors , 22 5 Page Previews , 23 5 Parsoid/Setup , 24 5 Cite , 25 5 Poem

Jan 2017: 1 86 Wikimedia Developer Summit/2017/Dinner sign-up , 2 36 Wikimedia Developer Summit/2017/Program , 3 24 Wikimedia Developer Summit/2017/All Session Notes , 4 12 Wikimedia Developer Summit/2017/Remote Participation , 5 10 Wikimedia Developer Summit/2017/Participant Info , 6 10 Wikimedia Engineering/2016-17 Q3 Goals , 7 9 EMWCon Spring 2017 , 8 9 Events/FOSDEM/2017 , 9 8 Page Previews , 10 8 Wikimedia Audiences , 11 7 Google Code-in/2016 , 12 7 Wikimedia Engineering/2016-17 Q2 Goals , 13 7 Discovery/Status updates/2017-10-09 , 14 7 VisualEditor:Test , 15 7 Git/Reviewers , 16 7 Gerrit/New repositories/Requests/Entries , 17 6 Developer Wishlist , 18 6 Wikimedia Developer Summit/2017 , 19 6 Wikimedia Discovery , 20 5 Wikimedia Developer Summit/2017/Room Setup , 21 5 Content translation/Release criteria round 1 , 22 5 Wikimedia Release Engineering Team/Skill matrix , 23 5 Contributors , 24 5 StructuredDiscussions , 25 5 Beta Features

Feb 2017: 1 84 Developer Wishlist/2017/Documentation , 2 81 Developer Wishlist/2017/Frontend , 3 74 Developer Wishlist/2017/Backend , 4 65 Developer Wishlist/2017/Tools (Phabricator, Gerrit, etc.) , 5 64 Developer Wishlist/2017/Code Contribution (Process, Guidelines, etc.) , 6 47 Developer Wishlist/2017/Developer Environment , 7 46 Developer Wishlist/2017/Extensions , 8 19 Wikimedia Hackathon 2017/Participants , 9 13 EMWCon Spring 2017 , 10 10 Developer Wishlist , 11 10 VisualEditor:Test , 12 9 Discovery/Status updates/2017-10-09 , 13 9 Gerrit/New repositories/Requests/Entries , 14 8 Wikimedia Research/Showcase , 15 7 Code of Conduct , 16 7 Page Previews , 17 7 MediaWiki-Vagrant , 18 7 Wikimedia Audiences , 19 6 Wikimedia Services/Revision storage for HTML and structured data: Use cases , 20 6 Wikimedia Hackathon 2017/Register and Attend , 21 6 MediaWiki 1.29 , 22 6 Web APIs hub , 23 6 Contributors , 24 6 Git/Reviewers , 25 5 Scrum of scrums/2017-02-01

Mar 2017: 1 21 Wikimedia Engineering/2016-17 Q4 Goals , 2 19 EMWCon Spring 2017 , 3 13 Wikimedia Hackathon 2017/Participants , 4 12 EMWCon Spring 2017/Program , 5 12 VisualEditor:Test , 6 10 Wikimedia Hackathon 2017/Participant List , 7 8 Wikimedia Hackathon 2017/Prehackathon Prague , 8 8 Google Summer of Code/2017 , 9 8 Gerrit/New repositories/Requests/Entries , 10 7 EMWCon Spring 2017/Training Signup , 11 7 Wikimedia Engineering/2016-17 Q3 Goals , 12 7 Discovery/Status updates/2017-10-09 , 13 7 Code of Conduct , 14 6 Contributors/Projects/Columns for references , 15 6 WikibaseLexeme/Data Model , 16 6 Wikimedia Audiences , 17 6 Configuring file uploads , 18 5 Wikimedia Language engineering/Reports/2017-February , 19 5 Wikimedia Hackathon 2017/Register and Attend , 20 5 Page Previews , 21 5 Wikibase , 22 4 Visual diffs , 23 4 Code of Conduct/Committee , 24 4 Code of Conduct/Cases , 25 4 LoginNotify

Apr 2017: 1 8 Wikimedia Release Engineering Team/Skill matrix , 2 8 Gerrit/New repositories/Requests/Entries , 3 7 Git/Reviewers , 4 6 Parsoid/Language conversion/Preprocessor fixups , 5 6 Wikimedia Hackathon 2017/Participant List , 6 6 MediaWiki Stakeholders' Group/Fantastic MediaWikis CfP , 7 6 Phabricator/Help , 8 6 Wikimedia Audiences , 9 6 Scribunto/Lua reference manual , 10 5 Wikimedia Hackathon 2017/Venue and Vienna , 11 5 Parsing/Replacing Tidy/FAQ , 12 5 Wikimedia Engineering/2016-17 Q4 Goals , 13 5 Wikimedia Engineering/2016-17 Q3 Goals , 14 5 Wikidata Query Service/User Manual , 15 5 Code of Conduct , 16 5 Developers/Maintainers , 17 5 Parsoid , 18 4 Wikistats 2.0 Design Project/RequestforFeedback/Round2/Non-flow talk , 19 4 Wikimedia Apps/Team/Android/App hacking , 20 4 Editing team/Weekly triage meetings , 21 4 Compatibility , 22 4 Client code , 23 4 Auth remoteuser , 24 3 Specs/HTML/1.4.0 , 25 3 Wikimedia Hackathon 2017/Prehackathon Budapest

May 2017: 1 76 Wikimedia Hackathon 2017/Program , 2 63 Wikimedia Hackathon 2017/Participant List , 3 32 Wikimedia Hackathon 2017/Mentoring Program , 4 16 Wikimedia Hackathon 2017/Featured Tasks , 5 14 Requests for comment/Future of magic links , 6 13 Parsoid/Language conversion/Preprocessor fixups/20170501 , 7 10 MediaWiki Documentation Day 2017 , 8 10 Wikimedia Hackathon 2017/Participants , 9 10 VisualEditor:Test , 10 9 Google Summer of Code/2017 , 11 7 Google Summer of Code 2017/Weekly Reports , 12 7 Wikimedia Hackathon 2017/Wikidata documentation sprint , 13 7 Edit Review Improvements/New filters for edit review , 14 7 MediaWiki-Vagrant , 15 6 Contributors/Projects/Accessible editing buttons , 16 6 Wikimedia Technology/Goals/2017-18 Q1 , 17 6 Wikimedia Audiences , 18 6 Gerrit/New repositories/Requests/Entries , 19 6 Version lifecycle , 20 5 Readers/Status updates/Next , 21 5 Wikimedia Hackathon 2017/Venue and Vienna , 22 5 RevisionSlider , 23 5 Wikimedia Research/Collaborators , 24 5 ArticlePlaceholder , 25 5 Code of Conduct

Jun 2017: 1 14 Wikimedia Technology/Goals/2017-18 Q1 , 2 8 Google Summer of Code 2017/Weekly Reports , 3 8 Reading/Web/PDF Functionality , 4 8 Google Summer of Code/2017 , 5 8 Wikimedia Technology , 6 8 Git/Reviewers , 7 8 Wikimedia Audiences , 8 7 Edit Review Improvements/New filters for edit review , 9 7 Developers/Maintainers , 10 6 Wikimedia Audiences/2017-18 Q1 Goals , 11 6 VisualEditor:Test , 12 6 Gerrit/New repositories/Requests/Entries , 13 6 Social media , 14 6 Labeled Section Transclusion , 15 5 Wikimedia Engineering/June 2017 changes , 16 5 Requests for comment/Future of magic links , 17 5 Edit Review Improvements , 18 5 Wikidata Query Service/User Manual , 19 5 Wikimedia Research/Showcase , 20 5 Client code , 21 4 Contributors/2017–18 Annual Plan/Editing , 22 4 Outreachy/Round 14/WeeklyReports , 23 4 Parsoid/Language conversion/Preprocessor fixups/20170501 , 24 4 MediaWiki 1.30/Roadmap , 25 4 Readers/Status updates/Next

Jul 2017: 1 14 Wikimedia Technology/Goals/2017-18 Q1 , 2 9 Wikimedia Audiences , 3 8 Wikimedia Audiences/2017-18 Q1 Goals , 4 7 New Developers , 5 7 VisualEditor:Test , 6 6 Reading/Web/PDF Functionality , 7 6 Parsing/Replacing Tidy/FAQ , 8 6 Developers/Maintainers , 9 6 Scribunto/Lua reference manual , 10 6 Pywikibot/Installation , 11 5 Readers/Status updates/Next , 12 5 Edit Review Improvements/New filters for edit review , 13 5 Requests for comment/Future of magic links , 14 5 Google Summer of Code/2017 , 15 5 Wikimedia Technology , 16 5 Wikimedia Engineering/2016-17 Q4 Goals , 17 5 Discovery/Status updates/2017-10-09 , 18 5 Wikidata Query Service/User Manual , 19 5 Pywikibot , 20 4 Wikimedia Language engineering/Reports/2017-June , 21 4 Wikimedia Hackathon 2017/Lessons Learned , 22 4 Google Summer of Code 2017/Weekly Reports , 23 4 Reading/Web/MobileFrontend and Minerva , 24 4 Reading/Web/Chore list , 25 4 ORES

Aug 2017: 1 14 Gerrit/New repositories/Requests/Entries , 2 9 Google Summer of Code/Past projects , 3 8 VisualEditor:Test , 4 7 Reading/Web/PDF Functionality , 5 7 Wikimedia Audiences , 6 6 Global Collaboration/Reports/2017-July , 7 6 Google Summer of Code/2017 , 8 6 Extension registration , 9 6 Git/Reviewers , 10 6 Compatibility , 11 5 Mw.wikibase.entity.lua bug fix instructions , 12 5 New Developers , 13 5 Google Summer of Code 2017/Weekly Reports , 14 5 Readers/Status updates/Next , 15 5 Discovery/Status updates/2017-10-09 , 16 5 Readers , 17 5 Outreachy/Past projects , 18 5 Main page , 19 4 Best practices for extensions , 20 4 Technical Advice IRC Meeting , 21 4 Wikimedia Technology/Goals/2017-18 Q1 , 22 4 Wikimedia Apps/Short descriptions/Research , 23 4 Edit Review Improvements/New filters for edit review/fr , 24 4 Reading/Web/Chore list , 25 4 Parsing/Replacing Tidy/FAQ

Sep 2017: 1 19 Wikimedia Technology/Goals/2017-18 Q2 , 2 17 Wikimedia Audiences/2017-18 Q2 Goals , 3 9 Wikimedia Technology/Goals/2017-18 Q1 , 4 9 Structured Discussions , 5 8 Wikimedia Developer Summit/2018 , 6 8 Gerrit/New repositories/Requests/Entries , 7 8 Sites using MediaWiki/en , 8 7 Wikimedia Developer Summit/2018/Writing Tips , 9 6 Outreachy/Round 15 , 10 6 Reading/Web/PDF Functionality , 11 6 VisualEditor:Test , 12 6 MediaWiki-Vagrant , 13 5 Wikimedia Apps/Offline support , 14 5 Technical Advice IRC Meeting , 15 5 Scribunto/Lua reference manual , 16 4 New Editor Experiences , 17 4 Global Collaboration/Reports/2017-July , 18 4 Google Summer of Code 2017/Weekly Reports , 19 4 MediaWiki 1.30/Roadmap , 20 4 Edit Review Improvements/New filters for edit review/fr , 21 4 Wikimedia Audiences/2017-18 Q1 Goals , 22 4 Edit Review Improvements/New filters for edit review , 23 4 Discovery/Status updates/2017-10-09 , 24 4 Citoid/Creating Zotero translators , 25 4 Outreachy/Past projects

Oct 2017: 1 31 Google Code-in/2017 , 2 12 Gerrit/New repositories/Requests/Entries , 3 10 Git/Reviewers , 4 8 Developers/Maintainers , 5 8 AbuseFilter/Rules format , 6 7 MediaWiki 1.31/Roadmap , 7 7 VisualEditor:Test , 8 6 Wikimedia Apps/Philadelphia offsite , 9 6 Readers/Status updates/Next , 10 6 Wikimedia Technology , 11 6 Wikimedia Audiences , 12 6 Communication , 13 5 Wikimedia Discovery/Command Line Tricks , 14 5 New Developers/Quarterly/2017-10 , 15 5 Wikimedia Audiences/2017-18 Q2 Goals , 16 5 Code Health Group , 17 5 Edit Review Improvements , 18 5 Wikibase/Indexing/RDF Dump Format , 19 5 Design , 20 4 ORES/FAQ , 21 4 Wikimedia Technology/Goals/2017-18 Q2 , 22 4 Outreachy/Round 15 , 23 4 JADE , 24 4 Reading/Web/PDF Functionality , 25 4 Editor

Nov 2017: 1 14 Google Code-in/2017 , 2 12 Developers/Maintainers , 3 8 Outreachy/Round 15 , 4 8 Gerrit/New repositories/Requests/Entries , 5 7 Outreachy/Round 15/Bi-weekly Reports , 6 6 New Editor Experiences/Conceptual understanding , 7 6 VisualEditor:Test , 8 6 Wikimedia Audiences , 9 6 AbuseFilter/Rules format , 10 6 Sites using MediaWiki/en , 11 5 Audiences Technology Working Group , 12 5 Global Collaboration/Reports/2017-October , 13 5 Wikimedia Technology/Goals/2017-18 Q2 , 14 5 EMWCon Spring 2018 , 15 5 Edit Review Improvements , 16 5 Design , 17 5 Scribunto , 18 5 How to contribute , 19 5 Version lifecycle , 20 4 DonateBoxInSidebar , 21 4 Discovery/Status updates/Next , 22 4 MediaWiki 1.31/Roadmap , 23 4 ORES , 24 4 ORES review tool , 25 4 Discourse

Dec 2017: 1 20 Wikimedia Technology/Goals/2017-18 Q3 , 2 19 Wikimedia Audiences/2017-18 Q3 Goals , 3 16 Wikimedia Developer Summit/2018/Participants , 4 12 VisualEditor:Test , 5 11 Sites using MediaWiki/en , 6 10 Google Code-in/2017 , 7 9 Wikimedia Technology/Goals/2017-18 Q2 , 8 8 Outreachy/Round 15 , 9 7 ChickTech High School Kickoff 2017/Tasks , 10 7 Outreachy/Round 15/Bi-weekly Reports , 11 7 MediaWiki 1.30 , 12 6 Wikimedia Developer Summit/2018 , 13 6 EMWCon Spring 2018 , 14 6 Client code , 15 5 Global Collaboration/Reports/2017-November , 16 5 MediaWiki 1.31 , 17 5 Wikimedia Technology , 18 5 Gerrit/New repositories/Requests/Entries , 19 5 Version lifecycle , 20 4 Phan-taint-check-plugin , 21 4 Wikimedia Hackathon 2018/Prehackathon Olot , 22 4 Events/FOSDEM/2018 , 23 4 Readers/Status updates/Next , 24 4 Edit Review Improvements , 25 4 Content translation/zh

Jan 2018: 1 23 Wikimedia Developer Summit/2018/Program , 2 12 Wikimedia Hackathon 2018/Prehackathon Montpellier , 3 11 Google Code-in/2017 , 4 10 Wikimedia Developer Summit/2018/Participants , 5 10 Wikimedia Developer Summit/2018 , 6 9 Wikimedia Hackathon 2018/Prehackathon Olot , 7 8 Wikimedia Developer Summit/2018/Facilitation , 8 8 Wikimedia Developer Summit/2018/transport , 9 8 Wikimedia Technology/Goals/2017-18 Q3 , 10 7 Wikimedia Hackathon 2018/Register and Attend , 11 7 VisualEditor:Test , 12 7 Git/Reviewers , 13 6 EMWCon Spring 2018 , 14 6 MediaWiki-Vagrant , 15 6 Gerrit/New repositories/Requests/Entries , 16 5 Global Collaboration/Reports/2017-December , 17 5 Outreachy/Round 15/Bi-weekly Reports , 18 5 Outreachy/Round 15 , 19 5 Edit Review Improvements/New filters for edit review , 20 5 Wikimedia Research/Showcase , 21 5 Professional development and consulting , 22 5 Wikibase/API , 23 5 VisualEditor , 24 5 How to become a MediaWiki hacker , 25 5 User rights

Feb 2018: 1 15 EMWCon Spring 2018 , 2 11 VisualEditor:Test , 3 11 Gerrit/New repositories/Requests/Entries , 4 8 Git/Reviewers , 5 7 Wikimedia Hackathon 2018/Warm-up event Orlandai , 6 7 Google Summer of Code/2018 , 7 7 Wikimedia Hackathon 2018/Prehackathon Montpellier , 8 7 Wikimedia Hackathon 2018/Prehackathon Olot , 9 7 VisualEditor/Diffs , 10 7 VisualEditor , 11 6 Reading/Web/Settings , 12 6 Hackathons/Handbook/Event Interviews , 13 6 2017 wikitext editor , 14 5 Map improvements 2018 , 15 5 EMWCon Spring 2018/Program , 16 5 Outreachy/Round 15/Bi-weekly Reports , 17 5 Discovery/Status updates/Next , 18 5 ORES review tool , 19 5 3D , 20 5 Page Previews , 21 5 Download from Git , 22 4 Global Collaboration/Reports/2018-January , 23 4 Outreachy/Round 15 , 24 4 Wikimedia Hackathon 2018 , 25 4 ORES

Mar 2018: 1 19 Wikimedia Audiences/2017-18 Q4 Goals , 2 18 Wikimedia Technology/Goals/2017-18 Q4 , 3 16 EMWCon Spring 2018 , 4 14 Gerrit/New repositories/Requests/Entries , 5 13 Reading/Web/PDF Functionality , 6 10 EMWCon Spring 2018/Program , 7 10 Wikimedia Technology/Goals/2017-18 Q3 , 8 9 Wikimedia Hackathon 2018/WikiCite , 9 9 Edit Review Improvements/New filters for edit review , 10 7 Google Summer of Code/2018 , 11 7 Wikimedia Audiences , 12 6 In-context help and onboarding , 13 6 Wikimedia Hackathon 2018/Wikimedia and Open Science , 14 6 Wikimedia Hackathon 2018/Prehackathon Montpellier , 15 6 Discovery/Status updates/Next , 16 6 Page Previews , 17 6 Git/Reviewers , 18 6 How to contribute , 19 5 Wikimedia Hackathon 2018/Warm-up event Orlandai , 20 5 Wikimedia Audiences/2017-18 Q3 Goals , 21 5 Outreachy/Round 15/Bi-weekly Reports , 22 5 MediaWiki 1.31/Roadmap , 23 5 VisualEditor:Test , 24 5 MediaWiki Stakeholders' Group , 25 5 Developers/Maintainers

Apr 2018: 1 38 Wikimedia Hackathon 2018/Participant List , 2 13 Gerrit/New repositories/Requests/Entries , 3 9 Google Summer of Code/2018 , 4 8 Netherlands Hackathon 2018 - Women Tech Storm/Attendees , 5 8 Reading/Web/PDF Functionality , 6 8 Page Previews , 7 7 Netherlands Hackathon 2018 - Women Tech Storm , 8 7 Wikimedia Technology , 9 7 VisualEditor:Test , 10 7 Wikimedia Audiences , 11 6 Wikimedia Technology/Annual Plans/FY2019/CDP3: Knowledge Integrity , 12 6 Wikimedia Technology/Goals/2017-18 Q4 , 13 6 Map improvements 2018 , 14 6 Wikimedia Hackathon 2018/Prehackathon Montpellier , 15 6 Parsoid/Setup , 16 6 Compatibility , 17 5 Wikimedia Technical Conference/2018 , 18 5 Wikimedia Hackathon 2018/Wikimedia and Open Science , 19 5 Wikimedia Technology/Goals/2017-18 Q3 , 20 5 MediaWiki 1.31/Roadmap , 21 5 Wikidata Query Service/User Manual , 22 5 VisualEditor , 23 5 HTMLForm , 24 5 Wikitext , 25 4 MediaWiki 1.32/Roadmap

May 2018: 1 91 Wikimedia Hackathon 2018/Program , 2 54 Wikimedia Hackathon 2018/Participant List , 3 24 Wikimedia Hackathon 2018/Mentoring Program , 4 18 Netherlands Hackathon 2018 - Women Tech Storm/Attendees , 5 13 Wikimedia Hackathon 2018/Venue and Barcelona , 6 11 Extension management 2018 feedback/Installing , 7 10 Google Summer of Code/2018 , 8 9 Google Summer of Code/2018/Bi-weekly Reports , 9 9 Reading/Web/PDF Functionality , 10 9 Wikimedia Hackathon 2018 , 11 8 Extension management 2018 feedback/Upgrading , 12 8 Wikimedia Hackathon 2018/Structured Commons , 13 8 VisualEditor:Test , 14 7 Extension management 2018 feedback/Finding , 15 7 Wikimedia Hackathon 2018/Intro to Rust , 16 7 Wikimedia Hackathon 2018/Participants , 17 6 Wikimedia Technical Committee/MediaWiki Platform Architecture Principles , 18 6 Wikimedia Hackathon 2018/WikiCite , 19 6 Page Previews , 20 6 Git/Reviewers , 21 6 Developers/Maintainers , 22 6 ResourceLoader/Core modules , 23 5 GDPR (General Data Protection Regulation) and MediaWiki software , 24 5 MediaWiki 1.32/Roadmap , 25 5 Netherlands Hackathon 2018 - Women Tech Storm

Jun 2018: 1 16 MediaWiki 1.31 , 2 15 Wikimedia Audiences/2018-19 Q1 Goals , 3 11 Google Summer of Code/2018/Bi-weekly Reports , 4 10 Wikimedia Technology/Goals/2018-19 Q1 , 5 10 Google Summer of Code/2018 , 6 10 Gerrit/New repositories/Requests/Entries , 7 9 VisualEditor:Test , 8 8 Wikimedia Technology/Goals/2017-18 Q4 , 9 7 Edit Review Improvements/New filters for edit review , 10 6 Wikimedia Technical Conference/2018/FAQ , 11 6 Reading/Web/Projects/Mobile Page Issues , 12 6 Wikimedia Release Engineering Team/Skill matrix , 13 6 Professional development and consulting , 14 5 PAWS/News/2018-06-21 , 15 5 Extension management 2018 feedback/Other , 16 5 Extension management 2018 feedback/Finding , 17 5 MediaWiki 1.32/Roadmap , 18 5 Wikimedia Technical Conference/2018 , 19 5 Wikimedia Audiences/Contribution taxonomy , 20 5 Design , 21 5 Git/Reviewers , 22 5 AbuseFilter , 23 5 Sites using MediaWiki/en , 24 5 Configuring file uploads , 25 4 FileImporter/Data/fa.wikipedia

Jul 2018: 1 15 Wikimedia Technology/Goals/2018-19 Q1 , 2 14 Wikimedia Audiences/2018-19 Q1 Goals , 3 10 Wikimedia Audiences , 4 9 Gerrit/New repositories/Requests/Entries , 5 8 Edit Review Improvements/New filters for edit review , 6 8 Developers/Maintainers , 7 7 Google Summer of Code/2018/Bi-weekly Reports , 8 7 Technical Advice IRC Meeting , 9 6 Growth , 10 6 Google Summer of Code/2018 , 11 6 Readers/Status updates/Next , 12 6 User rights , 13 5 MediaWiki 1.31 , 14 5 VisualEditor:Test , 15 5 Wikimedia Research/Showcase , 16 5 VisualEditor , 17 4 VisualEditor/Real-time collaboration , 18 4 Wikimedia Apps/Team/iOS/Editing program , 19 4 Wikimedia Maps , 20 4 MediaWiki 1.32/Roadmap , 21 4 Reading/Web/Projects/Mobile Page Issues , 22 4 Discovery/Status updates/Next , 23 4 Editing team , 24 4 Kartographer , 25 4 Wikidata Query Service/User Manual

Aug 2018: 1 38 MediaWiki Stakeholders' Group/TechConf Input/Challenges , 2 37 MediaWiki Stakeholders' Group/TechConf Input/Conference topics , 3 26 MediaWiki Stakeholders' Group/TechConf Input/Future , 4 16 MediaWiki Stakeholders' Group/TechConf Input/Use , 5 14 Google Summer of Code/Past projects , 6 13 Gerrit/New repositories/Requests/Entries , 7 11 MediaWiki Stakeholders' Group/TechConf Input , 8 11 VisualEditor on mobile report , 9 11 Readers/Status updates/Next , 10 10 Wikimedia Technical Conference/2018/Participants , 11 7 User rights , 12 6 Google Summer of Code/2018/Bi-weekly Reports , 13 6 MediaWiki 1.32/Roadmap , 14 6 Google Summer of Code/2018 , 15 6 Technical Advice IRC Meeting , 16 6 Web APIs hub , 17 6 Professional development and consulting , 18 6 Main page , 19 5 Wikimedia Discovery/Team/Onboarding/Matt , 20 5 MediaWiki Stakeholders' Group/TechConf Input/Open questions , 21 5 Discovery/Status updates/Next , 22 5 Wikimedia Discovery/Team/Onboarding , 23 5 Git/Reviewers , 24 5 Download , 25 4 Core Platform Team

Sep 2018: 1 36 Google Code-in/2018 , 2 20 Wikimedia Audiences/2018-19 Q2 Goals , 3 12 Wiki Techstorm , 4 10 Git/Reviewers , 5 8 Reading/Web/Chores , 6 8 Reading/Web/Advanced mobile contributions/Navigation prototype feedback , 7 8 Wikimedia Technology/Annual Plans/FY2019/TEC1: Reliability, Performance, and Maintenance/Goals , 8 8 MediaWiki-Vagrant , 9 8 How to contribute , 10 7 Reading/Web/Advanced mobile contributions/Navigation prototype feedback/Feedback , 11 7 VisualEditor on mobile report , 12 7 Release notes/1.31 , 13 7 Developers/Maintainers , 14 7 Gerrit/New repositories/Requests/Entries , 15 7 VisualEditor , 16 6 Reading/Web/Projects/NewMobileWebsite , 17 6 Localisation , 18 5 Wikimedia Technical Committee/MediaWiki Platform Architecture Principles/Draft 9-2018 , 19 5 MediaWiki 1.32 , 20 5 Technical Advice IRC Meeting , 21 5 VisualEditor/Diffs , 22 5 Release notes/1.27 , 23 5 VisualEditor:Test , 24 5 EasyTimeline , 25 5 Download/ar

Oct 2018: 1 46 Reading/Web/Advanced mobile contributions/Navigation prototype feedback/Feedback , 2 35 Wikimedia Technical Conference/2018/Small Group Dinners , 3 32 Wiki Techstorm/Attendees , 4 16 Wikimedia Technical Conference/2018/Schedule/Roles , 5 15 Google Code-in/2018 , 6 15 Comments , 7 12 Wikimedia Technical Conference/2018/Schedule , 8 9 Reading/Web/Chores , 9 9 Gerrit/New repositories/Requests/Entries , 10 8 Wikimedia Audiences , 11 7 Reading/Web/Advanced mobile contributions/Navigation prototype feedback , 12 7 VisualEditor on mobile report , 13 7 Git/Reviewers , 14 7 MobileFrontend , 15 6 Technical Advice IRC Meeting , 16 6 Contributors/Projects/Removal of the 2006 wikitext editor , 17 6 VisualEditor:Test , 18 5 Growth/Communities/How to work with newcomers on help desks , 19 5 Growth , 20 5 Wikimedia Hackathon 2019 , 21 5 Wikimedia Technical Conference/2018 , 22 5 Editing team , 23 5 Wikibase/zh , 24 5 Wikimedia Research/Showcase , 25 5 Professional development and consulting

Nov 2018: 1 12 Developers/Maintainers , 2 10 Gerrit/New repositories/Requests/Entries , 3 8 Reading/Web/Chores , 4 7 Wikimedia Audiences , 5 6 Wiki Techstorm/Reports , 6 6 Google Code-in/2018 , 7 6 Technical Advice IRC Meeting , 8 6 Editor , 9 6 VisualEditor:Test , 10 6 Download/th , 11 5 VisualEditor on mobile report , 12 5 Wikibase/Indexing/RDF Dump Format , 13 5 How to contribute/th , 14 5 Git/Reviewers , 15 5 Messages API , 16 4 Wikimedia Audiences/2018-19 Q3 Goals , 17 4 MediaWiki 1.33/Roadmap , 18 4 Outreachy/Round 17 , 19 4 VisualEditor/Diffs , 20 4 Universal Language Selector/Compact Language Links , 21 4 Wikidata Query Service/User Manual , 22 4 Wikimedia Apps/Android FAQ , 23 4 Upstream projects , 24 4 Coding conventions/PHP , 25 4 MobileFrontend

Dec 2018: 1 14 Wikimedia Audiences/2018-19 Q3 Goals , 2 10 EMWCon Spring 2019 , 3 9 Google Code-in/Lessons learned , 4 8 Wikimedia Audiences , 5 7 Reading/Web/Chores , 6 7 Wikimedia Technology/Annual Plans/FY2019/TEC1: Reliability, Performance, and Maintenance/Goals , 7 7 Gerrit/New repositories/Requests/Entries , 8 6 New Developers , 9 5 Wikimedia Hackathon 2019 , 10 4 ImageCompare , 11 4 Proton , 12 4 Wikimedia Hackathon 2019/Register and Attend , 13 4 Wikimedia Audiences/2018 Product points of view/Scale , 14 4 Wikimedia Technology/Annual Plans/FY2019/CDP2: Platform Evolution/CDP Budget Segment 7/Goals , 15 4 Wikimedia Technology/Annual Plans/FY2019/TEC6: Address Infrastructure Gaps/Goals , 16 4 Recommendations for mobile friendly articles on Wikimedia wikis , 17 4 Download/my , 18 4 Reading/Web/Projects/Mobile Page Issues , 19 4 Discovery/Status updates/Next , 20 4 TwoColConflict , 21 4 Wikimedia Technology , 22 4 $wgPasswordPolicy , 23 4 User rights/de , 24 4 Hosting services , 25 4 How to contribute/fr

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Friday February 1, 2019 05:59 (final run)

Dump file mediawikiwiki-20190101-stub-meta-history.xml.gz (edits only), size 173 Mb as gz -> 1.2 Gb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-13:56 after 7 min, 53 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.