Estatísticas da Wikispecial meta-wiki

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
Dec 20180% -53%-59%+1%-57%  -65%      0%
Nov 2018+1% +75%+45%+2%-35%  +61%      +2%
Oct 2018+1% +19%+3%+3%+69%  +46%      +2%
Sep 2018+1% +1%+26%+2%+96%  +20%      0%
Aug 2018+1% +3%-3%+1%+24%  +3%      +1%
Jul 20180% +5%+14%+1%-19%  +6%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
Dec 2018129566449524100 k2428,9 20 k      23 k
Nov 20181289219010505899 k5628,9 58 k      23 k
Oct 201812702726014097 k8628,8 36 k      23 k
Sep 201812630635073995 k5129,3 25 k      22 k
Aug 201812567635043193 k2629,5 20 k      22 k
Jul 201812504564903292 k2129,5 20 k      22 k
Jun 201812448694662892 k2629,5 19 k      22 k
May 201812379654943191 k2229,6 20 k      21 k
Apr 201812314825733690 k2429,6 24 k      21 k
Mar 201812232905984489 k3829,6 29 k      21 k
Feb 2018121421517853588 k3829,6 29 k      21 k
Jan 201811991614834387 k3629,6 30 k      21 k
Dec 2017119301156263286 k3029,7 32 k      21 k
Nov 2017118151237134085 k5629,6 40 k      21 k
Oct 201711692735252683 k2129,7 22 k      21 k
Sep 201711619584633783 k2729,7 23 k      21 k
Aug 201711561625354082 k3629,7 32 k      21 k
Jul 201711499654915181 k4529,7 37 k      20 k
Jun 201711434584774580 k6829,8 38 k      20 k
May 201711376906315778 k5130,1 72 k      19 k
Apr 201711286915976376 k5429,8 45 k      19 k
Mar 2017111951336387274 k6229,8 50 k      19 k
Feb 2017110621317555172 k3529,9 30 k      19 k
Jan 201710931945103071 k3029,9 20 k      19 k
Dec 2016108371036163171 k2430 29 k      19 k
Nov 2016107341156183470 k4129,9 30 k      18 k
Oct 201610619634333169 k2530 20 k      18 k
Sep 201610556443952568 k2430 18 k      18 k
Aug 201610512814972967 k2230,1 20 k      18 k
Jul 201610431684543266 k2730,1 20 k      18 k
Jun 201610363584342666 k2230,2 18 k      18 k
May 201610305624313765 k2330,2 32 k      18 k
Apr 201610243855503964 k2930 26 k      18 k
Mar 201610158655474763 k3030 26 k      18 k
Feb 2016100931618254062 k2630,1 35 k      17 k
Jan 201699321476935662 k5429,9 34 k      17 k
Dec 201597851236985860 k5830,1 40 k      17 k
Nov 20159662965174258 k3830,4 28 k      17 k
Oct 20159566624323357 k2430,5 24 k      17 k
Sep 20159504533932656 k2430,5 22 k      17 k
Aug 20159451513912556 k1930,5 29 k      17 k
Jul 20159400573962055 k1730,3 18 k      16 k
Jun 20159343523902054 k1730,2 16 k      16 k
May 201592911035083454 k2430,2 24 k      16 k
Apr 20159188744793253 k3430,2 26 k      16 k
Mar 20159114804833552 k3130,3670322 k450 Mb48,4 M156 k220 k51 k208 k16 k
Feb 201590342007713151 k2930,4625730 k416 Mb45,2 M155 k213 k50 k167 k16 k
Jan 20158834463522550 k2330,3622319 k405 Mb44,2 M153 k209 k49 k162 k16 k
Dec 20148788443402050 k2130,4623217 k398 Mb43,6 M151 k206 k48 k159 k16 k
Nov 20148744523252049 k2030,4625214 k394 Mb43,1 M150 k203 k46 k156 k16 k
Oct 20148692583942848 k2130,5626818 k389 Mb42,7 M148 k201 k45 k153 k16 k
Sep 20148634634022848 k3430,6628120 k384 Mb42,1 M147 k199 k44 k150 k15 k
Aug 20148571704132447 k2230,8644419 k391 Mb42,1 M145 k195 k44 k147 k15 k
Jul 20148501463252246 k2030,8645318 k386 Mb41,6 M145 k193 k43 k144 k15 k
Jun 20148455463181545 k1530,8648119 k383 Mb41,2 M144 k191 k42 k140 k15 k
May 20148409764022845 k2130,7648424 k379 Mb40,8 M145 k188 k42 k137 k15 k
Apr 20148333664092844 k2730,6651723 k375 Mb40,4 M144 k184 k41 k133 k15 k
Mar 20148267693892944 k2430,7654220 k370 Mb39,8 M144 k180 k40 k130 k15 k
Feb 201481981626534643 k3630,7653838 k363 Mb39,1 M142 k176 k39 k127 k15 k
Jan 20148036664454142 k3130,6655029 k355 Mb38,2 M140 k172 k38 k124 k14 k
Dec 20137970503422541 k1830,6654320 k347 Mb37,3 M138 k169 k37 k122 k14 k
Nov 20137920704013340 k2430,5655522 k342 Mb36,8 M137 k167 k36 k119 k14 k
Oct 20137850623671940 k2430,5653717 k336 Mb36,0 M133 k165 k35 k116 k14 k
Sep 20137788954382639 k2830,7654324 k330 Mb35,3 M131 k162 k34 k112 k14 k
Aug 2013769398458938 k1830,7648619 k320 Mb34,1 M127 k159 k33 k109 k13 k
Jul 20137595964902337 k2930,7649019 k315 Mb33,6 M126 k157 k32 k115 k11 k
Jun 201374991375465236 k3330,9651127 k309 Mb33,0 M124 k153 k31 k110 k11 k
May 201373621045682835 k3131644921 k300 Mb31,7 M122 k149 k30 k105 k11 k
Apr 201372581456113435 k3431,3643930 k292 Mb30,7 M118 k145 k29 k102 k11 k
Mar 20137113744112133 k1931,3645519 k285 Mb29,6 M114 k137 k29 k131 k11 k
Feb 201370391235682833 k2031,3648423 k279 Mb28,8 M113 k134 k28 k129 k10 k
Jan 20136916483501532 k1931,1647714 k273 Mb28,2 M110 k133 k26 k127 k10 k
Dec 20126868753982832 k1931,3649219 k269 Mb27,8 M107 k131 k26 k126 k10 k
Nov 201267931055441931 k1931,3649620 k265 Mb27,3 M106 k129 k25 k123 k10,0 k
Oct 201266881265253331 k2631,2649120 k261 Mb26,9 M105 k128 k24 k122 k9,8 k
Sep 20126562773932930 k1831,4648816 k255 Mb26,4 M103 k127 k23 k120 k9,5 k
Aug 20126485923831429 k1531,4646913 k250 Mb25,9 M102 k126 k23 k116 k9,3 k
Jul 20126393110425929 k1131,4645412 k245 Mb25,4 M100 k125 k22 k114 k9,2 k
Jun 20126283482841128 k1031,464119,0 k241 Mb24,9 M98 k123 k22 k113 k9,2 k
May 20126235413102228 k1531,4640012 k237 Mb24,6 M98 k122 k22 k111 k9,1 k
Apr 20126194443482128 k1831,5637217 k233 Mb24,2 M97 k121 k21 k110 k9,0 k
Mar 20126150613632027 k1131,5636713 k228 Mb23,8 M95 k120 k21 k108 k8,8 k
Feb 201260891505922627 k1531,4630021 k223 Mb23,3 M93 k119 k20 k107 k8,7 k
Jan 20125939493542126 k1631,1626014 k217 Mb22,8 M92 k117 k20 k105 k8,6 k
Dec 20115890442992226 k2231,1618113 k211 Mb22,1 M90 k116 k19 k103 k8,4 k
Nov 20115846723881725 k2531,5619115 k207 Mb21,8 M90 k115 k18 k101 k8,3 k
Oct 20115774914081924 k1731,8627014 k202 Mb21,3 M90 k114 k18 k100 k8,2 k
Sep 201156831003921724 k1131,9624413 k198 Mb20,9 M90 k112 k18 k98 k8,1 k
Aug 20115583793661724 k2631,8617813 k193 Mb20,5 M88 k111 k17 k95 k8,1 k
Jul 20115504342241323 k1232,462478,5 k189 Mb20,0 M85 k110 k17 k93 k8,0 k
Jun 2011547053243622 k932,562517,5 k186 Mb19,7 M84 k109 k17 k92 k7,8 k
May 20115417613111122 k1432,6625310 k184 Mb19,4 M83 k108 k16 k91 k7,7 k
Apr 2011535638229522 k1432,862347,4 k179 Mb19,0 M81 k106 k16 k90 k7,6 k
Mar 2011531842260821 k733,162598,3 k176 Mb18,7 M80 k106 k16 k89 k7,5 k
Feb 201152761144611321 k733,1623813 k174 Mb18,5 M79 k105 k16 k88 k7,4 k
Jan 2011516256335921 k1332,7615310 k170 Mb18,1 M78 k103 k16 k87 k7,3 k
Dec 2010510651265820 k1532,961137,5 k166 Mb17,7 M77 k102 k15 k85 k7,3 k
Nov 20105055743631220 k2333,3608011 k163 Mb17,5 M76 k102 k15 k83 k7,2 k
Oct 2010498180337919 k933,9610110 k159 Mb17,1 M74 k101 k15 k81 k7,0 k
Sep 2010490158248619 k633,960527,4 k156 Mb16,7 M73 k100 k15 k79 k6,9 k
Aug 2010484339222719 k433,860317,2 k154 Mb16,5 M73 k100 k15 k78 k6,9 k
Jul 2010480437195519 k433,659666,6 k151 Mb16,2 M73 k99 k14 k77 k6,9 k
Jun 2010476738186419 k433,559645,0 k150 Mb16,0 M72 k99 k14 k76 k6,8 k
May 2010472957207519 k333,458556,3 k146 Mb15,7 M72 k99 k14 k75 k6,7 k
Apr 2010467243219418 k533,258185,9 k145 Mb15,5 M72 k98 k14 k75 k6,7 k
Mar 2010462946241518 k433,257926,8 k143 Mb15,3 M71 k97 k14 k74 k6,7 k
Feb 201045831524481418 k433,1575513 k141 Mb15,1 M71 k96 k14 k73 k6,6 k
Jan 201044311353541118 k1632,6568714 k138 Mb14,8 M71 k94 k14 k72 k6,6 k
Dec 2009429644207418 k732,755406,3 k130 Mb14,1 M68 k91 k13 k70 k6,5 k
Nov 2009425258273617 k632,855327,2 k128 Mb14,0 M68 k91 k13 k69 k6,5 k
Oct 2009419447232517 k532,755358,2 k127 Mb13,8 M67 k89 k13 k69 k6,4 k
Sep 2009414742190317 k432,556385,2 k125 Mb13,6 M67 k90 k13 k66 k6,4 k
Aug 2009410546260817 k732,456247,6 k124 Mb13,4 M67 k89 k13 k65 k6,2 k
Jul 20094059873461517 k2232,4560911 k122 Mb13,2 M66 k88 k13 k64 k6,1 k
Jun 2009397235199716 k633,156645,8 k118 Mb12,8 M64 k87 k13 k63 k6,1 k
May 20093937522071016 k533,156697,0 k117 Mb12,7 M64 k86 k13 k62 k6,0 k
Apr 20093885542891316 k83356769,0 k115 Mb12,5 M63 k85 k12 k61 k5,9 k
Mar 20093831432841715 k632,956929,7 k114 Mb12,3 M62 k84 k12 k60 k5,8 k
Feb 200937881655321815 k532,6565417 k112 Mb12,1 M61 k83 k12 k59 k5,6 k
Jan 2009362378329715 k1231,8560110 k110 Mb11,8 M61 k82 k12 k58 k5,5 k
Dec 2008354548223815 k63256386,6 k108 Mb11,6 M59 k80 k12 k57 k5,4 k
Nov 20083497702941414 k1231,9554110 k105 Mb11,3 M58 k80 k11 k57 k5,3 k
Oct 20083427392721114 k83255248,9 k102 Mb10,7 M56 k78 k11 k55 k5,2 k
Sep 2008338866268814 k531,953887,9 k99 Mb10,2 M55 k77 k11 k53 k5,1 k
Aug 20083322572631014 k831,753708,6 k98 Mb10,1 M55 k76 k11 k53 k5,0 k
Jul 2008326557243413 k531,653357,5 k96 Mb9,8 M54 k74 k11 k51 k4,9 k
Jun 2008320881329613 k531,5530410,0 k94 Mb9,7 M53 k73 k11 k51 k4,8 k
May 2008312754285913 k1231,151819,5 k92 Mb9,4 M52 k72 k11 k50 k4,7 k
Apr 20083073572441013 k831,250847,8 k87 Mb9,0 M48 k70 k10 k49 k4,7 k
Mar 2008301660243813 k531,250927,7 k86 Mb8,8 M47 k69 k10 k48 k4,6 k
Feb 2008295644218912 k630,950627,2 k84 Mb8,7 M47 k68 k10 k47 k4,5 k
Jan 20082912412221412 k630,850098,0 k82 Mb8,5 M45 k67 k10 k46 k4,3 k
Dec 20072871762811012 k730,649718,5 k80 Mb8,2 M44 k66 k9,9 k46 k4,2 k
Nov 20072795843561612 k1030,5491612 k78 Mb8,0 M35 k65 k9,8 k45 k4,2 k
Oct 2007271161273912 k1430,248399,7 k75 Mb7,8 M33 k63 k9,2 k44 k4,1 k
Sep 2007265051238811 k730,548338,8 k73 Mb7,6 M32 k63 k9,0 k43 k4,0 k
Aug 2007259966221411 k730,347528,0 k70 Mb7,3 M32 k61 k8,6 k42 k3,9 k
Jul 2007253354254911 k930,247178,4 k69 Mb7,1 M32 k59 k8,3 k41 k3,8 k
Jun 200724791003781110 k1830,1474512 k67 Mb7,0 M31 k58 k8,3 k41 k3,7 k
May 200723795922299,9 k530,548187,7 k65 Mb6,7 M31 k56 k8,0 k40 k3,6 k
Apr 200723205721459,7 k630,247837,6 k64 Mb6,5 M30 k54 k8,0 k40 k3,4 k
Mar 200722634921159,5 k53047346,7 k62 Mb6,4 M30 k53 k7,9 k39 k3,3 k
Feb 200722144518479,4 k629,847376,9 k62 Mb6,3 M29 k52 k7,9 k38 k3,3 k
Jan 200721695022489,2 k729,647407,7 k61 Mb6,2 M29 k52 k7,9 k38 k3,1 k
Dec 2006211974299119,0 k1129,5473211 k59 Mb6,1 M29 k50 k7,7 k37 k3,0 k
Nov 20062045102321138,6 k1329,4479212 k58 Mb5,9 M28 k49 k7,5 k36 k2,9 k
Oct 200619437830678,3 k629,448208,8 k56 Mb5,7 M27 k48 k7,3 k35 k2,8 k
Sep 2006186576310148,1 k1029476711 k54 Mb5,5 M27 k47 k7,0 k34 k2,7 k
Aug 20061789101304107,8 k1828,7477112 k53 Mb5,3 M26 k45 k6,5 k33 k2,6 k
Jul 200616885821467,2 k629,349048,1 k50 Mb5,1 M25 k42 k6,2 k31 k2,5 k
Jun 200616306024387,0 k828,949089,4 k49 Mb4,9 M24 k41 k5,9 k30 k2,4 k
May 2006157063232106,8 k828,649239,1 k47 Mb4,8 M23 k40 k5,8 k30 k2,3 k
Apr 200615076424096,5 k628,349598,6 k46 Mb4,7 M23 k39 k5,7 k29 k2,2 k
Mar 200614436621486,4 k627,850689,7 k45 Mb4,6 M23 k38 k5,6 k29 k2,2 k
Feb 200613775617656,2 k92750066,8 k43 Mb4,3 M22 k37 k5,5 k27 k2,1 k
Jan 200613217025365,9 k92749279,9 k41 Mb4,1 M22 k36 k5,4 k25 k2,0 k
Dec 200512518625385,6 k1026,649799,0 k39 Mb3,9 M21 k34 k5,3 k24 k2,0 k
Nov 200511655420055,3 k726,550207,3 k37 Mb3,7 M19 k31 k5,2 k22 k1,9 k
Oct 200511116620245,1 k726,149887,9 k35 Mb3,5 M19 k30 k5,1 k22 k1,8 k
Sep 200510455820324,9 k825,750237,5 k34 Mb3,3 M18 k29 k5,0 k21 k1,7 k
Aug 200598752204104,7 k1225,450438,4 k33 Mb3,2 M18 k28 k4,9 k20 k1,7 k
Jul 20059355617464,3 k725,750987,3 k30 Mb3,0 M16 k27 k4,5 k19 k1,6 k
Jun 20058796020684,0 k925,451397,9 k29 Mb2,8 M15 k25 k4,2 k18 k1,6 k
May 20058195417463,8 k725,251436,6 k27 Mb2,6 M14 k23 k3,7 k16 k1,5 k
Apr 200576548170133,5 k1624,851808,1 k25 Mb2,5 M13 k21 k3,5 k15 k1,4 k
Mar 200571753172113,1 k1326,152717,2 k24 Mb2,4 M12 k19 k3,4 k14 k1,3 k
Feb 20056644717272,7 k1027,353136,5 k22 Mb2,1 M11 k17 k2,9 k12 k1,2 k
Jan 20056174517342,4 k827,755055,9 k20 Mb1,9 M10 k16 k2,5 k10 k1,1 k
Dec 20045723411822,2 k328,158764,2 k19 Mb1,8 M9,6 k15 k2,4 k9,6 k1,0 k
Nov 20045384915742,0 k527,558435,5 k18 Mb1,7 M9,3 k14 k2,0 k9,1 k987
Oct 20044894514271,9 k526,958765,8 k17 Mb1,6 M8,8 k13 k1,9 k8,4 k924
Sep 200444462164101,7 k826,258978,2 k15 Mb1,4 M7,8 k12 k1,7 k7,6 k849
Aug 2004382217141,5 k425,155783,2 k13 Mb1,2 M6,9 k11 k9035,5 k687
Jul 20043612610861,3 k625,357674,4 k12 Mb1,1 M6,6 k10 k9055,4 k628
Jun 20043352711561,1 k325,356044,0 k11 Mb1,0 M6,0 k9,5 k8864,8 k450
May 20043084211831,1 k223,956313,8 k10,0 Mb940 k5,7 k8,7 k7995,0 k375
Apr 200426632762979421,855922,7 k9,3 Mb871 k5,3 k7,9 k7714,0 k343
Mar 200423421841874121,358732,0 k8,5 Mb829 k5,0 k4,2 k7473,6 k313
Feb 20042131243 82822058171,1 k8,0 Mb779 k4,8 k3,6 k6883,2 k287
Jan 20042014252784219,755829947,2 Mb723 k4,6 k3,3 k5913,0 k269
Dec 200319711401727219,954011,2 k4,5 Mb649 k4,3 k3,1 k5862,7 k249
Nov 20031861235 659220,153921,2 k4,1 Mb594 k3,9 k3,0 k5812,4 k208
Oct 20031741550 599220,155461,3 k3,8 Mb551 k3,3 k2,5 k5682,1 k175
Sep 2003159481062546319,757632,9 k3,5 Mb513 k3,0 k2,3 k5102,0 k151
Aug 2003111501371470316,657012,8 k3,0 Mb438 k2,8 k1,9 k3581,6 k136
Jul 200361824 386112,959455572,6 Mb396 k2,4 k1,4 k1161,3 k107
Jun 200353511 364 12,260982942,5 Mb382 k2,4 k1,3 k501,2 k104
May 200348110 352111,761643982,4 Mb374 k2,1 k1,2 k511,1 k97
Apr 20034716 327 11,463412122,3 Mb354 k2,1 k1,1 k491,0 k92
Mar 200346916 31911164075002,3 Mb344 k2,0 k1,0 k471,0 k84
Feb 200337211 298110,165294562,1 Mb328 k2,0 k8204497879
Jan 200335210 25711070452951,9 Mb304 k1,4 k3863784441
Dec 20023319 223 10,273032361,7 Mb281 k1,2 k3073778639
Nov 200232511 20919,772292231,6 Mb262 k1,1 k2353572933
Oct 200227411 18719,773873861,5 Mb241 k1,0 k933563729
Sep 20022355 160 8,977671201,2 Mb204 k97383138013
Aug 20021813 152 8,68071531,2 Mb198 k91983131710
Jul 200217   146 8,68154501,2 Mb194 k90483030810
Jun 200217   140 8,68396261,1 Mb191 k89883030410
May 200217   130 98233181,0 Mb174 k8088302938
Apr 20021758 12719,183772671,0 Mb176 k8058302898
Mar 200212 2 101 8,8857744833 kb138 k6548302437
Feb 20021223 97 8,7872593822 kb136 k6588302317
Jan 20021026 83 9,19332221746 kb124 k6438302115
Dec 2001816 7017,68707203604 kb100 k608492074
Nov 20017711 5426,16766328369 kb60 k479  1694
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  10000  25000  100000  250000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000 
Dec 20181631719495308156247  12931 87635219880264       542  157064645728814836203  1313531
Nov 20182833148010506222585810  15104211161439264126417       662  2087757526342179491911 1413431
Oct 2018170683560139519340103 11862 92234520284335       4421 1495638438278139401732 1211521
Sep 2018153571950733115539711121021 8222981848635971     662  1511663466314175431411 1210521
Aug 20181516713504308153319  10931 97034519691323       5421 176271550832116737132  1210521
Jul 20181507706490329150326  10921 91935321296305       4421 1743785523356167411321 109521
Jun 20181385652466297137283  12741 851303172823410       8421 13455813922501372791  1110421
May 20181650742494295151313  121041 10393621999941114222   653  18016384492691443413   1210521
Apr 201820808485733331463691 121041 105234119393345       653  1795674453279131451532 1110421
Mar 2018190984459837319544112 131031 96133121094384       6532 1940785551358203572031 1110421
Feb 2018251711517854942203591 11942 89932918887373       5421 189569646630115433101  1110531
Jan 2018155170048330515143103 10731 81731517482314       753  2013777511355187541851 119521
Dec 201718178966263711573210  15952 80932317485292       662  124650936324413443162  1311421
Nov 2017199398871344221640123 121042 878340204103302       542  1548669442278138411841 108321
Oct 20171766755525330163265  11931 89932721090343       5421 156363845127013138111  119321
Sep 201714786874632751473712  11731 81030617885232       753  1551673489327183501721 1311322
Aug 2017159375953532416040142 10931 77230317591322       753  1499621458299174562141 1412421
Jul 2017152971549131116751185 11741 72928217375233       652  141758942029016158237  1210421
Jun 2017147065947731515445217 141151 706263161722921      865  149359442827916062287111312521
May 20174884974631405210572512 141142 951366238107382       5521 20548135703772267230131 1311321
Apr 2017169384259738420063278 131042 923342216118432       642  2129836564375229814312  1312522
Mar 2017182386163842923872325112941 902362222110365       8632 203587763243525985349211211621
Feb 201722001030755411221515  141152 83431317986242       763  198382458438419558253  1212621
Jan 20171965730510322155304  12731 80429115673261       882  1657688494331183541721 1210421
Oct 2018170683560139519340103 11862 92234520284335       4421 1495638438278139401732 1211521
Jul 20181507706490329150326  10921 91935321296305       4421 1743785523356167411321 109521
Apr 201820808485733331463691 121041 105234119393345       653  1795674453279131451532 1110421
Jan 2018155170048330515143103 10731 81731517482314       753  2013777511355187541851 119521
Oct 20171766755525330163265  11931 89932721090343       5421 156363845127013138111  119321
Jul 2017152971549131116751185 11741 72928217375233       652  141758942029016158237  1210421
Apr 2017169384259738420063278 131042 923342216118432       642  2129836564375229814312  1312522
Jan 20171965730510322155304  12731 80429115673261       882  1657688494331183541721 1210421
Oct 201612876164332661313161 11941 1240387219101292       772  165369449932916945154  119521
Jul 20161352631454295143323  121141 752269163703531      753  1368557404272152441111 1212421
Apr 20161607758550345165394  12942 87432920799415       7631 1856798560371196571221 151372 
Jan 201622919616934402195611  9531 1273555292130397       8842 1881856630403247682241 9842 
Oct 20151253600432269152338  10731 78332421511839811111115531 1448648475320200591731 1311321
Jul 20151185549396232117205  10941 76031917994349211111110731 121354139125013232102  1310321
Apr 201513936764793031583211  10851 8853532241185811511111 66432170571755134920363202  118531
Jan 20151165503352235123257  10941 677293200105385211111 7431 120052838425513239122  1210611
Oct 201411825463942401202861 9741 7463422271274541111111543  128957639424814541152  10852 
Jul 20141000463325195912261 9821 482182112501621111111762  896441316221115371521 9732 
Apr 20141112563409256126285  11741 661266174973561111111662  1161566413282161481521 8642 
Jan 2014110457644528014641122 141141 636263167993241111111862  935484383268145511742 109421
Oct 20131074499367234124196  121041 75932920911143511111114321 103342131723614035142  10832 
Jul 20131622920490271140236  9841 7072881678425421     3331 91041232221612728131  118421
Apr 20131815906611363168345  111042 8652971737728431     5411 147674456638120846161  149531
Jan 20131105504350218109153  994  64826415879254411111 22   88338127718910929101  107211
Oct 20121350697525343171335  1184  759301201106398422111 661  107054743331216846131  1411521
Jul 20121580612425254919   883  7402781789927421111  53   1313480311198102142   108211
Apr 20129784703482061002171 11951 66629320510634311111  54   76031223515976129   109311
Jan 2012122653235420999213  1093  7102881839442521111  431  847295193122651951  148411
Oct 201113035934082289119   983  7873031819643911111  33   94032119811853155   99521
Jul 201184235622412757132  663  51218810963234211    44111688206139773582   87211
Apr 20117893352291306452  642  436152813812111111  22   627194110601821   55211
Jan 201112455023351806692  742  6091991235917311111  21   838233137753074   66211
Oct 201010544953371957294  55   4551699847162       22   585150835025421  44211
Jul 2010804313195924053  331  4741881195616        11   60013275371843   44211
Apr 2010943377219106374   651  43313080331111      11   91216578501641   65211
Jan 2010368162435418671114  33   67618610962307            1054246143693082   65311
Oct 20097533442321225051  6621 435171117552231      1    50615710058274    74211
Jul 2009115651934620284151  22   508179104432011           60719496452451   33211
Apr 200911534672891615713   221  586195122542241           625201115642684   53211
Jan 200911194853291887274  221  575207107512641      111  690223139642595   32211
Oct 200896340527215159112  11   513196126642122           616184106662961   22211
Jul 200812005112431154442  41   54320612161152       11   80121812969294    43211
Apr 20088333702441435610   331  506192130652841           586193128652961   44321
Jan 200881235722212744142  311  542213131642761      21   6352251297432114   44311
Oct 20079344262731676991  421  564216134572441      11   52217110353246    22211
Jul 20078713762541395091  111  52318411057182       11   58415689422131   4321 
Apr 20078663582141144153       521182112511753      11   50814486412043   2111 
Jan 20078513442241155281  22   641242131602341      22   61419011256161         
Oct 20061135497306131437        703244115461311           634160873614          
Jul 20068393512141085061       5151901035015             543163984914          
Apr 20069053912401285391       53219911358151            580170101511332        
Jan 20069473952531455061       5011741004618             61018911654201         
Oct 20058273142021184442       3471147037101            491131442372         
Jul 2005638287174964261  11   345117562810             41610361289     11   
Apr 200552225617010241134  11   2841097041113            34311164281551        
Jan 2005547252173913841  1    2227943229             2456439135          
Oct 200453823014281387        1998250228             23060331671         
Jul 2004289157108542263       16563391691            16651271372         
Apr 200422311076462021       93322183             113342063          
Jan 20049847251472        5117103              601752           
Oct 20031577150298        52261752             5820127           
Jul 2003843524132        672618124             6218123           
Apr 2003288642        1311               17411           
Jan 200334141031        1985311            1854411         
Oct 200229161182        14753              16321           
Jul 200281          1                 421            
Apr 20021911842        1242               1663            
Jan 20022110631        9321              10432           

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
163,384100.0%2,249,879100.0%
322,71435.8%2,190,01397.3%
1012,95520.4%2,133,87194.8%
326,35410.0%2,019,76189.8%
1002,9404.6%1,830,79881.4%
3161,1631.8%1,517,09767.4%
10003920.6%1,094,30948.6%
3162860.1%577,59725.7%
10000120.0%172,7507.7%

 

50 autores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
KaganerUC1 024,82629190,282307Apr 15, 2005500741811--
Verdy pUC2 018,9514060,175416Oct 16, 20054823378---
Liuxinyu970226UC3 017,1217226,19936Jun 04, 20132035692---
OmotechoUC4 014,73537720,606520Dec 27, 2015109937211--
PathoschildUC5 014,194720,1443Jan 29, 20064718837---
Haytham abulelaUC7 012,7769439,056450Jul 19, 200741826512--
ShizhaoUC8 012,202242,6267Aug 26, 20035605189---
BillinghurstUC9 011,73947940,4041,126Oct 17, 2008372615715--
MarcoAurelioUC10 011,13929517,846515Sep 09, 200837641732--
АтаUC11 011,10327912,034296Jan 25, 201321654283--
StrynUC12 010,2337312,17686Jan 07, 201032792975--
Saederup92UC15+59,12451221,1701,004Sep 12, 201223001,30748--
SjUC17-19,04736,67712Feb 07, 20045440552---
Nemo bisUC19-18,832510,98415Nov 29, 20074049158---
Johan (WMF)UC26 07,693975,16868May 31, 201513093402--
Ruslik0UC27+17,4991792,60916Oct 23, 2008372033---
AnthereUC29 07,298215,107103Oct 06, 200259292711--
Meno25UC30 07,1815112,54681Feb 15, 200743361,17825--
MxnUC31 07,124103,9529Nov 28, 20035511198---
EduardogobiUC32+17,0426612,36470Jan 23, 201514372782--
MF-WarburgUC34 06,68845,1785Jan 18, 20074364149---
TitoduttaUC35+16,353384,29614Jul 12, 201223622952--
JSutherland (WMF)UC38 05,73659,2292Sep 20, 20131927358---
Matěj SuchánekUC39 05,573475,42449Dec 06, 201318502482--
GVarnum-WMFUC40 05,46653,3231Sep 08, 20151209293---
MatiiaUC41 05,454278,85651Oct 16, 2014153610---
TrijnstelUC42 05,42594,99022Oct 10, 2010300340---
DcljrUC45+15,240561,08810Aug 07, 2004525811---
DefenderUC46-15,2402511,21118Aug 19, 2010305547---
RadiXUC47 05,129477,08944May 03, 2009352853---
WargoUC48 04,941465,48368May 13, 201224222514--
StïngerUC50 04,79016,7551Dec 25, 20151101279---
MusikAnimal (WMF)UC51 04,718272,8778Jun 26, 20169171,249---
TegelUC52+14,6453610,39974Sep 11, 2010303212---
SGill (WMF)UC53-14,62925,1091Mar 07, 2017663217---
AjraddatzUC54 04,6141415,7685Apr 08, 2010318822---
Jalexander-WMFUC55 04,516420,7318Aug 18, 20103056195---
BaseUC57 04,44676,93214Sep 02, 20112676136---
ShangkuanlcUC60 04,19088,3765May 25, 20083871193---
Ле ЛойUC62 04,044614,71381Aug 08, 201223351975--
Rschen7754UC63 03,985132,25911Mar 19, 2006466925---
EduaddadUC71+43,8552076,324434Mar 30, 201610051488--
علاءUC73+33,7341392,26143Jun 26, 201691727---
יונה בנדלאקUC74-13,704404,49254Jan 28, 201032581752--
FrigoryUC77+13,607384,96152Oct 19, 201511681172--
SteinsplitterUC79 03,518210,97341Jul 24, 2012235074---
Amire80UC80 03,51213,8535Apr 26, 20064631145---
MilloshUC81 03,42111,322-Jul 02, 20045294297---
Tbayer (WMF)UC83 03,354212,18410Jul 22, 20112718291---
আফতাবুজ্জামানUC86 03,20015,60917Apr 05, 20132095171---

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
PatrickUC613,731Feb 01, 20035811Nov 21, 2017404
PiramidionUC139,172Nov 11, 20141510Oct 31, 201860
Cbrown1023UC149,134Jan 13, 20074369May 03, 20151337
Marco (WMF)UC169,082Mar 07, 2017663Sep 29, 2017457
AphaiaUC188,884May 09, 20045348Nov 27, 20151129
Vodnokon4eUC208,663Jul 03, 20122371Nov 04, 201856
Polimerek (WMF)UC218,345Mar 07, 2017663Aug 23, 2017494
PiRSquared17UC228,187Jun 24, 20103111Sep 02, 2018119
Lionster (WMF)UC237,999Mar 07, 2017663Sep 24, 2017462
VarnentUC247,787Jul 18, 20112722Mar 03, 2018302
Niccolò Caranti (WMF)UC257,717Mar 07, 2017663Sep 30, 2017456
LsanabriaUC287,441Jan 06, 20151454Jun 27, 2018186
Tuanminh01 (WMF)UC337,023Mar 07, 2017663Oct 02, 2017454
EGalvez (WMF)UC366,324Nov 27, 20131859Oct 21, 201870
IopensaUC375,742Oct 13, 20112635Nov 14, 201846
SpacebirdyUC435,368Aug 04, 20054896Apr 14, 20151356
GlaisherUC445,266May 02, 20132068May 24, 2018220
GuillomUC494,882Jan 03, 20064744Apr 04, 2018270
Mike.lifeguardUC564,494Jul 03, 20074198Aug 17, 20112692
PurodhaUC584,299Jun 20, 20054941Aug 18, 2016864

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 226.821 edições foram feitas por usuários anônimos, de um total de 2886.392 edições ( 7e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
FuzzyBotUC1248,500Oct 26, 20112622Dec 30, 2018-3,11013
Community Tech botUC246,609Nov 02, 2016788Nov 30, 201830653-
EmausBotUC319,659Apr 02, 20132098Dec 31, 2018-1-
SteinsplitterBotUC411,231Aug 30, 20141583Dec 31, 2018-299-
ICEAGE botUC510,845Oct 10, 20103003Nov 15, 20167754-
Alch BotUC69,184Feb 08, 20122517Feb 28, 2018305--
Kimberley-nia BotUC76,912Oct 29, 20074080Mar 12, 20151389--
ThehelpfulbotUC86,823May 09, 20112792Aug 28, 20131950--
InvadibotUC96,511Feb 26, 20132133Jun 14, 20151295--
BotikUC105,793Apr 25, 20151345Jun 11, 201756763-
DellieBotUC114,746Jun 07, 20074224Aug 10, 20083794--
QuentinvBotUC124,237Oct 07, 20112641Aug 05, 20141608224-
ՋոկերԲոտUC132,841Aug 09, 20122334Apr 02, 201417332-
ArchiverBotUC141,961Apr 27, 20141708Dec 22, 20188154-
GrantsBotUC151,859Oct 08, 20131909Dec 31, 2018-2-
AvicBotUC161,802Jul 17, 20151262Dec 25, 20185--
MiszaBotUC171,606Dec 19, 20083663Apr 07, 20141728102-
EdwardsBotUC181,504Sep 01, 20103042Feb 03, 20141791--
タチコマ robotUC191,458Aug 26, 20074144Jan 29, 2017700--
CommonsDelinkerUC201,377Feb 26, 20074325Dec 30, 2018---
MABotUC211,341Jan 30, 20093621Dec 15, 2018155-
TranslationsVolBotUC221,328Sep 15, 20112663Oct 30, 201222522-
Erwin85BotUC231,024Oct 25, 20093353Jan 28, 20103258--
JhsBotUC24916Mar 20, 20112842Apr 05, 20122460--
RevibotUC25866Jan 02, 20151458Nov 13, 201847--
AvocatoBotUC26792Jan 06, 20122550Jul 24, 20131985--
FiledelinkerbotUC27787Feb 26, 20151403Dec 08, 201822--
SpBotUC28781Apr 09, 2016995Dec 30, 2018-712
MastiBotUC29571Mar 25, 2018280Jun 16, 20181979-
AnankeBotUC30527Jul 02, 20112738Jan 01, 20141824--
BOTijoUC31525Mar 28, 20103199Jun 14, 20112756--
PathosbotUC32503Jan 09, 20074373Sep 14, 20083759--
MediaWiki message deliveryUC33471Nov 22, 20131864Dec 27, 2018321
AswnBotUC34443Apr 09, 2017630Dec 31, 2018---
JarBotUC35437Nov 01, 201859Dec 31, 2018---
FluxbotUC36356Nov 20, 20074058Jun 10, 2018203--
DougBotUC37251Dec 04, 20112583Dec 10, 20112577--
JembotUC38242Apr 10, 20103186Feb 21, 20161043--
LivingBotUC39234Oct 05, 20112643Feb 01, 20141793--
EranBotUC40161Apr 24, 20141711Dec 01, 2018298-
Lucia BotUC41144Mar 02, 20112860Mar 02, 20112860--
ReinheitsgebotUC42137Jul 11, 2016902Dec 28, 20182--
SnowbotUC43120Mar 05, 20132126Mar 05, 20132126--
ArthurBotUC44117Aug 01, 20093438Mar 05, 20112857--
TheStoneBotUC45103Dec 12, 2017383Dec 26, 2017369--
SanniBotUC4698Sep 16, 20131931Sep 26, 20131921--
MerlBotUC4791Aug 28, 20093411Jun 29, 20141645--
DuesenBotUC4882Nov 08, 20102974Nov 08, 2010297482-
CTMakerbotUC4962Aug 07, 20131971May 25, 201416801-
MenoBotUC5057Oct 01, 20093377Oct 07, 20112641--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DiaGifHtmlJpgOdpOdtOggOgvPdfPngPovSvgSxcSxdSxiXcfXlsXmlXsl
Dec 2018121 k502 k5,2 k2,3 k117 k23 k1,7 k48 k       157127812351821,4 k13444485311
Nov 2018120 k498 k5,2 k2,3 k116 k22 k1,7 k48 k       157127812351821,4 k13444485311
Oct 2018118 k493 k5,2 k2,3 k113 k22 k1,7 k48 k       157127812351821,4 k13444485311
Sep 2018115 k489 k5,1 k2,3 k113 k22 k1,6 k48 k       157127812351821,4 k13444485311
Aug 2018113 k485 k4,9 k2,3 k112 k22 k1,6 k47 k       157127712351821,4 k13444485311
Jul 2018112 k481 k4,9 k2,3 k112 k22 k1,6 k47 k       157127712351821,4 k13444485311
Jun 2018112 k477 k4,8 k2,3 k112 k22 k1,6 k47 k       157127612351821,4 k13444485311
May 2018111 k473 k4,7 k2,3 k111 k22 k1,6 k47 k       157127612351821,4 k13444485311
Apr 2018110 k470 k4,7 k2,3 k111 k22 k1,6 k47 k       157127612351821,4 k13444485311
Mar 2018109 k466 k4,7 k2,3 k110 k22 k1,6 k47 k       157127612351821,4 k13444485311
Feb 2018108 k463 k4,7 k2,3 k109 k21 k1,6 k46 k       157127512351821,4 k13444485311
Jan 2018107 k460 k4,7 k2,3 k109 k21 k1,6 k46 k       157127512351821,4 k13444485311
Dec 2017106 k458 k4,6 k2,3 k109 k21 k1,6 k46 k       157127512351821,4 k13444485311
Nov 2017105 k455 k4,5 k2,3 k108 k21 k1,6 k46 k       157127412351821,4 k13444485311
Oct 2017103 k451 k4,4 k2,3 k107 k21 k1,6 k45 k       157127412351821,4 k13444485311
Sep 2017102 k448 k4,4 k2,3 k106 k21 k1,6 k44 k       157127412351821,4 k13444485311
Aug 2017101 k445 k4,4 k2,3 k106 k21 k1,6 k42 k       157127412351821,4 k13444485311
Jul 2017100 k442 k4,3 k2,3 k105 k20 k1,6 k40 k       157127412351821,4 k13444485311
Jun 201798 k439 k4,3 k2,3 k104 k20 k1,6 k40 k       157127412351821,4 k13444485311
May 201795 k437 k4,3 k2,3 k104 k20 k1,6 k40 k       157127412351821,4 k13444485311
Apr 201793 k433 k4,3 k2,3 k103 k20 k1,6 k40 k       157127412351821,4 k13444485311
Mar 201792 k429 k4,3 k2,3 k102 k20 k1,6 k39 k       157127412351821,4 k13444485311
Feb 201790 k425 k4,2 k2,3 k101 k19 k1,5 k39 k       157127412351821,4 k13444485311
Jan 201789 k422 k4,2 k2,3 k100 k19 k1,5 k38 k       157127412351821,4 k13444485311
Dec 201688 k419 k4,1 k2,3 k100 k19 k1,5 k38 k       157127412351821,4 k13444485311
Nov 201687 k415 k4,1 k2,3 k98 k19 k1,5 k37 k       157127412351821,4 k13444485311
Oct 201685 k412 k4,1 k2,3 k96 k19 k1,5 k37 k       157127412351821,4 k13444485311
Sep 201685 k410 k4,1 k2,3 k95 k18 k1,5 k37 k       157127412351821,4 k13444485311
Aug 201684 k408 k4,0 k2,3 k94 k18 k1,5 k36 k       157127412351821,4 k13444485311
Jul 201683 k406 k4,0 k2,3 k94 k18 k1,5 k35 k       157127412351821,4 k13444485311
Jun 201682 k403 k4,0 k2,3 k94 k18 k1,5 k35 k       157127412351821,4 k13444485311
May 201681 k401 k4,0 k2,3 k93 k18 k1,5 k34 k       157127412351821,4 k13444485311
Apr 201680 k400 k4,0 k2,3 k93 k18 k1,5 k34 k       157127412351821,4 k13444485311
Mar 201679 k398 k3,9 k2,3 k92 k17 k1,5 k33 k       157127412351821,4 k13444485311
Feb 201678 k397 k3,9 k2,3 k91 k17 k1,5 k29 k       157127412351821,4 k13444485311
Jan 201677 k396 k3,8 k2,3 k91 k17 k1,5 k26 k       157127412351821,4 k13444485311
Dec 201576 k394 k3,7 k2,3 k90 k17 k1,5 k25 k       157127412351821,4 k13444485311
Nov 201574 k392 k3,7 k2,3 k87 k16 k1,5 k24 k       157127312351821,4 k13444485311
Oct 201572 k388 k3,6 k2,3 k85 k16 k1,5 k21 k       157127312351821,4 k13434485311
Sep 201572 k384 k3,2 k2,3 k84 k16 k1,4 k19 k       157127312351821,4 k13434485311
Aug 201571 k381 k3,0 k2,3 k83 k16 k1,4 k19 k       157127312351821,4 k13434485311
Jul 201570 k378 k3,0 k2,3 k83 k16 k1,4 k19 k       157127312351811,4 k13434485311
Jun 201569 k375 k3,0 k2,3 k83 k16 k1,4 k18 k       157127312351811,4 k13434485311
May 201569 k371 k3,0 k2,3 k82 k16 k1,4 k18 k       157127312351811,4 k13434485311
Apr 201568 k366 k3,0 k2,3 k82 k16 k1,4 k18 k       157127312351811,4 k13434485311
Mar 201567 k363 k2,9 k2,3 k81 k15 k1,4 k18 k      17049157127312351811,4 k13434485311
Feb 201566 k358 k2,9 k2,3 k80 k15 k1,4 k18 k      22913157127312351811,4 k13434485311
Jan 201565 k355 k2,8 k2,3 k80 k15 k1,4 k17 k      15014157127312351811,4 k13434485311
Dec 201464 k350 k2,8 k2,3 k79 k15 k1,4 k17 k      13250157127112351811,4 k13434485311
Nov 201463 k347 k2,8 k2,3 k78 k15 k1,4 k17 k      11217157127112351811,4 k13434485311
Oct 201463 k345 k2,8 k2,3 k76 k15 k1,4 k16 k      15097157127112351801,4 k13434485311
Sep 201462 k344 k2,7 k2,3 k76 k15 k1,4 k16 k      16817157127112351801,4 k13434485311
Aug 201461 k342 k2,7 k2,3 k75 k14 k1,4 k15 k      14480157127112351801,4 k13434485311
Jul 201460 k339 k2,7 k2,3 k75 k14 k1,4 k15 k      12864157127112351801,4 k13434485311
Jun 201459 k337 k2,6 k2,3 k75 k14 k1,4 k14 k      12838157127112351801,4 k13434485311
May 201459 k335 k2,6 k2,3 k74 k14 k1,4 k10 k      15135157127112351801,4 k13434485311
Apr 201458 k332 k2,6 k2,3 k73 k14 k1,3 k9,8 k      14699157127112351791,4 k13424485311
Mar 201457 k330 k2,5 k2,3 k73 k13 k1,3 k8,8 k      15614157127112351791,4 k13414485311
Feb 201456 k325 k2,4 k2,3 k72 k13 k1,3 k8,5 k      27762157127112351791,4 k13414485311
Jan 201455 k320 k2,3 k2,3 k71 k13 k1,3 k6,3 k      21537157127112351791,4 k13414485311
Dec 201354 k314 k2,3 k2,3 k71 k13 k1,3 k5,7 k      13786157127112351791,4 k13414485311
Nov 201353 k313 k2,2 k2,3 k69 k13 k1,3 k5,6 k      16866157127112351791,4 k13414485311
Oct 201352 k313 k2,2 k2,2 k68 k13 k1,3 k5,6 k      13463157127012351791,3 k13414485311
Sep 201351 k312 k2,1 k2,2 k67 k12 k1,3 k5,6 k      16171157127012351791,3 k13414485311
Aug 201350 k311 k2,1 k2,2 k67 k12 k1,3 k5,5 k      11434157127012351791,3 k13414485311
Jul 201347 k307 k2,1 k2,2 k66 k12 k1,3 k5,4 k      15608157127012351791,3 k13414485311
Jun 201346 k303 k2,0 k2,2 k66 k12 k1,3 k5,3 k      22336156127012351791,3 k13414485311
May 201345 k299 k2,0 k2,2 k65 k11 k1,2 k5,3 k      17192156127012351791,3 k13414485311
Apr 201344 k294 k1,9 k2,2 k65 k11 k1,2 k5,2 k      19638156126612351781,3 k13414485311
Mar 201343 k291 k1,7 k2,2 k65 k11 k1,2 k5,1 k      14614156126412351781,3 k13414485311
Feb 201342 k287 k1,6 k2,2 k64 k11 k1,2 k4,6 k      18880156126312351701,3 k13414485311
Jan 201341 k283 k1,5 k2,1 k63 k11 k1,2 k3,4 k      11415156126012351681,3 k13414485311
Dec 201241 k279 k1,4 k2,1 k61 k10 k1,2 k3,3 k      15921156125912351681,3 k13404485311
Nov 201240 k276 k1,4 k2,1 k57 k10 k1,2 k3,3 k      16553156125912351661,3 k13354485311
Oct 201239 k272 k1,4 k2,1 k51 k10 k1,2 k2,9 k      17520156125912351641,3 k13334485311
Sep 201238 k268 k1,3 k2,0 k49 k10 k1,2 k2,9 k      14299156124912351591,2 k13164485311
Aug 201237 k264 k1,3 k2,0 k49 k10,0 k1,2 k2,9 k      11034156124812351531,2 k13154485311
Jul 201237 k262 k1,3 k2,0 k48 k9,8 k1,2 k2,9 k      10552156124812351501,2 k13154485311
Jun 201236 k259 k1,3 k2,0 k48 k9,7 k1,2 k2,9 k      7868154124812351501,2 k13154485311
May 201236 k257 k1,2 k2,0 k48 k9,7 k1,2 k2,8 k      10677154124312351501,2 k13154485311
Apr 201235 k254 k1,2 k2,0 k47 k9,6 k1,2 k2,8 k      12606154123512351471,2 k13154485311
Mar 201235 k249 k1,2 k2,0 k47 k9,5 k1,0 k2,8 k      11848154123212251451,2 k13154485311
Feb 201235 k243 k1,2 k2,0 k47 k9,4 k1,0 k2,8 k      18325154122912151341,2 k13154485311
Jan 201234 k235 k1,2 k2,0 k46 k9,3 k1,0 k2,7 k      11712154122812151321,2 k13154485311
Dec 201133 k230 k1,2 k2,0 k45 k9,2 k1,0 k2,6 k      10188154122412151311,2 k13144485311
Nov 201132 k226 k1,2 k1,9 k39 k9,1 k1,0 k2,5 k      12464154121712151251,2 k13144485311
Oct 201132 k221 k1,2 k1,9 k34 k8,9 k1,0 k2,5 k      11196154121012151241,2 k13134485311
Sep 201131 k215 k1,2 k1,9 k33 k8,5 k1,0 k2,4 k      11622154120912151211,2 k13134485311
Aug 201131 k209 k1,1 k1,9 k32 k8,3 k1,0 k2,4 k      10957154120812151171,2 k13134485311
Jul 201130 k202 k1,1 k1,9 k31 k8,1 k1,0 k2,3 k      6940154120712151171,1 k13134485311
Jun 201129 k195 k1,1 k1,9 k31 k8,0 k1,0 k2,3 k      6509154120612151161,1 k13134485311
May 201129 k189 k1,1 k1,9 k30 k7,9 k1,0 k2,3 k      8610154120612151141,1 k13124485311
Apr 201128 k184 k1,1 k1,9 k29 k7,7 k1,0 k2,2 k      6329154120512151131,1 k13124485311
Mar 201128 k180 k1,1 k1,9 k29 k7,6 k1,0 k2,2 k      7002154120312151121,1 k13124485311
Feb 201127 k174 k1,1 k1,8 k28 k7,6 k1,0 k2,2 k      12371154120212151051,1 k13124485311
Jan 201127 k168 k1,1 k1,8 k28 k7,6 k1,0 k2,2 k      8896152120212151041,1 k13114485311
Dec 201027 k166 k1,1 k1,8 k26 k7,5 k1,0 k2,2 k      6319152120212151041,1 k13114485311
Nov 201026 k162 k1,1 k1,8 k24 k7,5 k1,0 k2,2 k      9397152120212151041,1 k13114485311
Oct 201025 k156 k1,0 k1,8 k23 k7,3 k1,0 k2,1 k      9269152120112151041,1 k13114485311
Sep 201025 k152 k1,0 k1,8 k22 k7,2 k9922,1 k      6447152120112151041,1 k13114485311
Aug 201025 k147 k1,0 k1,8 k22 k7,1 k9882,1 k      6213152120012151041,1 k13114485311
Jul 201025 k140 k1,0 k1,8 k21 k7,0 k9802,1 k      5714152120012151041,1 k13104485311
Jun 201024 k135 k1,0 k1,8 k21 k6,9 k9742,1 k      4345152120012151041,1 k13104485311
May 201024 k129 k1,0 k1,8 k21 k6,8 k9732,0 k      5511152120012151021,1 k13104485311
Apr 201024 k123 k1,0 k1,8 k20 k6,8 k9722,0 k      5063152120012151011,1 k13104485311
Mar 201024 k118 k9761,8 k20 k6,8 k9712,0 k      595415212001215821,1 k13104485311
Feb 201024 k112 k9671,8 k20 k6,7 k9702,0 k      120081521192121 801,1 k13104485311
Jan 201024 k108 k9621,8 k20 k6,7 k9692,0 k      124081521192121 771,1 k13104485311
Dec 200923 k102 k9411,8 k19 k6,6 k9681,9 k      52181521192121 771,1 k13094485311
Nov 200923 k97 k9391,8 k17 k6,5 k9681,9 k      61671511192121 761,1 k13094485311
Oct 200923 k92 k9251,8 k14 k6,5 k9661,8 k      62581511192121 731,1 k13094485311
Sep 200922 k87 k8981,8 k13 k6,4 k9651,8 k      44351511192121 721,1 k13084485311
Aug 200922 k81 k8921,8 k13 k6,4 k9621,8 k      68061511190121 721,1 k13084485311
Jul 200922 k75 k8861,8 k13 k6,4 k9611,7 k      99441511190121 711,1 k13084485311
Jun 200921 k69 k8831,8 k12 k6,2 k9591,7 k      51121511190121 701,1 k13084485311
May 200921 k62 k8761,7 k12 k6,2 k9571,4 k      61011511189  1 681,1 k13064485311
Apr 200921 k60 k8321,7 k12 k6,1 k9561,4 k      79031511189  1 671,1 k12924485311
Mar 200920 k58 k7961,7 k11 k6,0 k9551,4 k      86101511189  1 651,1 k12924485311
Feb 200920 k55 k7711,7 k10 k5,9 k9461,3 k      159211511189    641,1 k12914485311
Jan 200920 k52 k7651,7 k10 k5,8 k9371,3 k      90981511189    641,1 k12914485311
Dec 200819 k50 k7561,7 k8,9 k5,8 k9351,3 k      57681511189    641,1 k12884485311
Nov 200819 k49 k7521,7 k7,8 k5,7 k9341,3 k      91141511189    641,1 k12684485311
Oct 200818 k47 k7451,7 k1,4 k5,6 k9331,2 k      78511511189    601,1 k12654485311
Sep 200818 k45 k7391,6 k1,4 k5,6 k9261,2 k      67541511189    601,1 k12564482311
Aug 200818 k44 k7321,6 k1,4 k5,5 k9211,2 k      76661511189    591,1 k12544482311
Jul 200817 k43 k7161,6 k1,4 k5,4 k9151,1 k      63971511187    591,1 k12544482311
Jun 200817 k41 k7001,6 k1,4 k5,4 k9111,0 k      87851511187    591,1 k12534482311
May 200817 k40 k6781,6 k1,4 k5,3 k9071,0 k      83061511185    591,1 k11984482311
Apr 200817 k39 k6591,5 k1,4 k5,2 k8931,0 k      67481511185    581,0 k11814482311
Mar 200816 k38 k6491,5 k1,4 k5,1 k8821,0 k      65651511185    571,0 k11694482311
Feb 200816 k35 k6381,5 k1,3 k4,9 k871977      60821501185    551,0 k11664482311
Jan 200816 k32 k6051,5 k1,3 k4,7 k860891      64981491184    541,0 k11594482311
Dec 200715 k29 k4661,5 k1,2 k4,6 k846847      71361491181    531,0 k11574482311
Nov 200715 k25 k4581,5 k1,1 k4,5 k807832      102781491181    491,0 k11384482311
Oct 200715 k23 k4291,5 k8784,4 k800819      77251491181    491,0 k11384482311
Sep 200714 k19 k4221,4 k5834,3 k796792      67611471181    481,0 k11374462311
Aug 200714 k16 k4141,4 k5724,3 k796769      59051381170    4897911314462311
Jul 200714 k15 k4071,4 k5634,2 k790739      63981381169    4897711314462311
Jun 200713 k14 k3711,4 k5564,2 k783721      100141381168    4897711304462311
May 200713 k12 k3611,4 k5543,8 k781712      64761381166    4697711204462311
Apr 200712 k12 k2831,4 k5533,7 k770694      59721371165    4697611204462311
Mar 200712 k12 k2801,4 k5393,5 k744672      51781371164    4697111204462311
Feb 200712 k11 k2741,4 k5273,4 k735656      51631371163    4696911184462311
Jan 200712 k11 k2681,3 k5273,3 k719618      60901371162    3896511094442311
Dec 200611 k11 k2611,3 k5273,2 k711579      89311361162    3396111094442311
Nov 200611 k10 k2571,3 k5193,1 k705549      97901361161    2895811034442311
Oct 200610 k9,7 k2531,3 k5183,1 k686488      64901351158    289511804442311
Sep 200610 k9,3 k2491,3 k5183,0 k682473      83411351157    289431744442311
Aug 20069,7 k8,8 k2351,2 k5182,9 k635422      89601351147    279071534442311
Jul 20069,1 k7,9 k2261,1 k5172,6 k631362      59571341143    278631364442311
Jun 20068,8 k7,5 k2221,1 k5162,6 k597355      72231331140    268481294442311
May 20068,5 k7,2 k2081,1 k5142,5 k577342      69891301137    268351214442311
Apr 20068,2 k6,8 k2071,1 k5142,3 k561333      64611301134    258291214442311
Mar 20068,0 k6,4 k1871,0 k5142,2 k553311      69251301128    248241204442311
Feb 20067,7 k6,0 k1721,0 k5142,1 k541266      41761301122    248171204442311
Jan 20067,4 k5,7 k1681,0 k5132,0 k527255      67121301114    238061204432311
Dec 20057,1 k5,2 k1649935131,9 k516244      64001291111    227911204332311
Nov 20056,7 k4,8 k1559854991,7 k506232      51491271109    227871204332311
Oct 20056,4 k4,6 k1519694981,6 k494228      54651261106    207791203332211
Sep 20056,2 k4,2 k1499564981,4 k483211      54661261104    197711203321211
Aug 20055,9 k3,9 k1499524981,4 k456204      60571261102    197691203321211
Jul 20055,5 k3,6 k1389374961,3 k401193      4964126199    187581203321211
Jun 20055,2 k3,4 k1349214571,2 k396181      6037125197    187461203311211
May 20054,9 k3,1 k128903651,1 k379150      5102125196    177301203311211
Apr 20054,6 k2,8 k12686765813351143      6558125192    176981203311211
Mar 20054,2 k2,6 k12185365496214121      5641124192    1568812033 1211
Feb 20053,7 k2,4 k1168476542719896      5082124191    1568312033 1211
Jan 20053,3 k2,2 k948276533419571      4580123185    1467112033 1211
Dec 20043,0 k2,0 k927916528719063      2952119178    1464612033 1211
Nov 20042,8 k1,9 k857566025018762      403119167    1363312033 1211
Oct 20042,6 k1,7 k847426023518258      436818164    1362312033 1211
Sep 20042,4 k1,5 k807106016017554      668515162    860112033 1211
Aug 20042,0 k1,4 k776785811915837      242015158    757612032 1111
Jul 20041,8 k1,3 k68677586911030      369315158    757512032 1111
Jun 20041,5 k1,2 k5966357467912      326715157    456612031 1111
May 20041,4 k1,0 k576485529652      2948 5154    455512031 1111
Apr 20041,3 k90647626281257         5146    2546120 1 1111
Mar 20041,1 k8384361828451         5146    2538120 1 1111
Feb 20041,1 k7634360428447         5144    2526120 1 1111
Jan 20041,0 k7264157128142         4144    1495120 1 1111
Dec 20039366933956627138         4144    1491120 1 1 11
Nov 200383366733560 132         4144    1485120 1 1 11
Oct 200374564826555 127         4144    1482120 1 1   
Sep 200366962824501 126         4144     430120   1   
Aug 200359639024394 18         4137     332 20       
Jul 200349126422110 1          2115     91 1       
Jun 20034662272220 1           1      18 1       
May 20034472162012 1           1      10 1       
Apr 20034172071812 1           1      10 1       
Mar 20034021961812 1           1      10 1       
Feb 20033741681711             1      9 1       
Jan 2003297150136             1      4 1       
Dec 2002261133104                    4         
Nov 2002241122103                    3         
Oct 2002215113103                    3         
Sep 200217210010                               
Aug 20021619210                               
Jul 2002155908                               
Jun 2002149858                               
May 2002137827                               
Apr 2002134817                               
Mar 2002107735                               
Feb 2002104603                               
Jan 200288473                               
Dec 200174373                               
Nov 200158313                               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Nov 2001: 1 11 Logo suggestions , 2 10 Main Page , 3 8 Logo suggestions/Leading candidates , 4 8 Wikipedia drop-outs , 5 4 Policy discussion/Articles on commercial enterprises , 6 4 Species names (to be specific) , 7 3 Disability Etiquette , 8 3 Wikipedia Virtual Mind , 9 2 Wikipedia vandalism , 10 2 Wikipedia metadata management

Dec 2001: 1 7 Logo suggestions/Humorous logos , 2 6 Main Page , 3 6 Logo suggestions/Leading candidates , 4 5 Neutral point of view/draft , 5 5 Avoid copyright paranoia , 6 3 International Wikipedia question , 7 3 Wikipedia Client , 8 3 Axe grinding , 9 2 Logo suggestions , 10 2 Wikisource , 11 1 Columns in 30 minutes or less

Jan 2002: 1 14 Wikimedia merchandise , 2 4 Main Page , 3 4 Why there will always be debate in this project , 4 4 Wikipedia's first press release--draft for comment , 5 3 T-shirt vote summary , 6 3 Listing deleted titles

Feb 2002: 1 3 Main Page , 2 3 Uploads being abused , 3 3 Discussion on business models and organizational charters applicable to large free wikis , 4 2 Science Hypertextbook project , 5 1 Market research in progress at meta wikipedia

Mar 2002: 1 4 Science Hypertextbook project , 2 3 Main Page , 3 2 Discussion on business models and organizational charters applicable to large free wikis , 4 2 Proposed Wikipedia policy on foreign characters , 5 2 Wikipedia cloning project

Apr 2002: 1 7 Main Page , 2 5 The Wikipedia Community , 3 5 Response to 24 , 4 4 NPOV as description, not prescription , 5 4 Systemic bias of Wikipedia , 6 3 Natural point of view , 7 3 T-shirt vote summary , 8 3 Kill the Stub Pages , 9 1 BP synopsis for ActiveUserWikiAdminCommunity

May 2002: 1 2 Main Page , 2 1 Errors in the Encyclopædia Britannica which have been corrected in Wikipedia

Jun 2002: 1 1 The best president to have a beer with

Jul 2002: 1 2 Wikipedia haiku , 2 1 The best president to have a beer with

Aug 2002: 1 5 Main Page , 2 3 Faith vs science with regard to the Wikipedia , 3 2 Wiki table markup discussion history , 4 2 Worst cases

Sep 2002: 1 4 Main Page , 2 4 There is also an English Wikipedia available , 3 3 Avoid copyright paranoia , 4 2 Wikipedia timeline , 5 2 The Free Universal Encyclopedia and Learning Resource , 6 2 Wikipedia and copyright issues

Oct 2002: 1 12 What to do with www.wikipedia.org , 2 11 Main Page , 3 8 MediaWiki feature request and bug report discussion , 4 5 Hoofdpagina , 5 5 There is also an English Wikipedia available , 6 4 Thoughts on Wikipedia interlanguage priorities , 7 4 Quelle utilisation pour www.wikipedia.org ? , 8 4 Wikipedia and corporate structure , 9 3 The need for some form of Wikipedia Yearbook , 10 3 Forside , 11 3 Ĉefpaĝo , 12 3 Consolidating vs breaking up , 13 3 Wikipedia and copyright issues , 14 2 Mailing list-s division , 15 2 Syndication feeds , 16 2 Empty page page , 17 2 Trophée du Libre (2003) , 18 2 Portada/es , 19 2 Unicode utilities , 20 2 Selige linguam Wikipediae maestro literaturae

Nov 2002: 1 6 Main Page , 2 5 The provisional portal of Wikipedia , 3 5 Wikipedia and copyright issues , 4 4 Dedicated Wikipedia editor , 5 3 Domena Polskiej Wikipedii , 6 3 TMC's sysop request , 7 2 Huvudsida , 8 2 Wiktionary , 9 1 MediaWiki feature request and bug report discussion

Dec 2002: 1 5 Wiktionary , 2 5 Thoughts on language integration , 3 4 Main Page , 4 4 WIKIng , 5 3 Niepożądane zachowania , 6 3 Wikipedians categorized by sub-cultural affiliation , 7 3 Wikipedia Client , 8 2 FormatSandbox , 9 2 Music markup , 10 2 XML syntax , 11 2 Machine-friendly wiki interface , 12 2 Wikitax (proposal) , 13 2 Wikimedia News

Jan 2003: 1 14 What to do with www.wikipedia.org , 2 5 Date formats in various languages , 3 4 Paper Wikipedia , 4 4 Linux user Wikimedians , 5 3 Main Page , 6 3 Meetup , 7 3 Burn All GIFs , 8 2 MediaWiki feature request and bug report discussion , 9 2 Cabal , 10 2 Protected pages considered harmful , 11 1 FormatSandbox

Feb 2003: 1 19 Wikipedia mascot , 2 6 Legion of Trolls , 3 3 Main Page , 4 3 Wikisource , 5 2 Minor , 6 2 Larry Sanger , 7 2 MediaWiki , 8 2 Linux user Wikimedians , 9 2 Date formats in various languages , 10 2 The ideal Wikimedia board of trustees , 11 2 Hoofdpagina , 12 1 Privacy policy

Mar 2003: 1 37 Article count reform , 2 18 Wikipedia mascot , 3 9 Wiki stats other than the article count , 4 6 Main Page , 5 5 Automatic transformation of hyphens and dashes , 6 5 Wikimedia cache strategy evolution during 2003 , 7 4 What to do with entries related to September 11 casualties , 8 3 Legion of Trolls , 9 3 Wikipedia4 (proposal) , 10 3 Accueil , 11 3 The provisional portal of Wikipedia , 12 2 メインページ , 13 2 Compiler optimizations , 14 2 Wikimedia Foundation , 15 2 Kernel upgrade , 16 2 PHP caching and optimization , 17 1 Alternative PHP Cache

Apr 2003: 1 7 Main Page , 2 5 Wikipedia mascot , 3 4 User details special page , 4 3 Image pages , 5 3 Wikipedia is not Wiki , 6 3 Twelve leverage points , 7 3 Meetup , 8 2 ArbitraryLinkingDiscussion , 9 2 WikiPediaReasonable , 10 2 Image pages/Data syntax

May 2003: 1 8 Main Page , 2 6 Deletion management redesign , 3 6 Bans , 4 4 Wikimedia power structure , 5 4 GodKing , 6 4 Association of Wikimedians , 7 3 MediaWiki feature request and bug report discussion , 8 3 Wikimedia language code , 9 3 Bans and blocks/old , 10 3 User details special page , 11 3 Mac user Wikimedians , 12 3 Vegetarian Wikimedians , 13 2 Board manual , 14 2 Wikimedia charter , 15 2 List of WikiWomen , 16 2 Geospatial reference , 17 2 Move Text to Filesystem , 18 2 Permission grant extent , 19 1 Intermediate solution for interlanguage links

Jun 2003: 1 7 List of Wikimedians by religion , 2 6 Main Page , 3 6 List of Wikimedians by race and/or ethnicity , 4 6 List of Wikimedians by favorite color , 5 6 Wikimedia News , 6 5 Linux user Wikimedians , 7 3 Wikimedia Foundation , 8 3 Wikipedia mascot , 9 2 Wikipedians by favorite colour , 10 2 Using domains , 11 1 Intermediate solution for interlanguage links

Jul 2003: 1 22 International logo contest/Logos 1-25 , 2 16 International logo contest , 3 12 Wikipedia mascot , 4 11 Layout vote , 5 10 International logo contest/Logos 26-50 , 6 7 List of Wikimedians by religion , 7 7 Wikimedia News , 8 5 Main Page , 9 5 Concours international de logo , 10 4 Move meta.wikipedia.org to wikimedia.org , 11 4 国际图标竞赛 , 12 4 Wikipedia on CD/DVD , 13 4 Wikipedia software upgrade status , 14 3 Internationaler Logo-Wettbewerb , 15 3 Development policy , 16 3 Wikipedia Weekly News , 17 3 List of Wikimedians by favorite color , 18 2 Intermediate solution for interlanguage links , 19 2 Errors in the Encyclopædia Britannica which have been corrected in Wikipedia , 20 1 Privacy policy

Aug 2003: 1 162 International logo contest/Logos 1-25 , 2 121 International logo contest/Logos 76-100 , 3 113 International logo contest/Logos 126-150 , 4 111 International logo contest/Logos 26-50 , 5 108 International logo contest/Logos 51-75 , 6 92 International logo contest/Logos 101-125 , 7 21 Wikimedia press releases/500,000 Wikipedia articles , 8 12 Wikipedia mascot , 9 11 International logo contest/Vote instructions , 10 10 Premier communiqué de presse de Wikimédia , 11 9 Main Page , 12 8 Name of Wikipedia , 13 8 Wikipedia.org is more popular than... , 14 8 International logo contest , 15 8 List of Wikimedians by favorite color , 16 6 Maps , 17 5 The ideal Wikimedia board of trustees , 18 5 The provisional portal of Wikipedia , 19 4 International logo contest/Finalists , 20 4 RK , 21 4 Internationale Logo-Wahl , 22 4 Wikimedia Foundation , 23 4 Wikipedia mascot/name , 24 4 MediaWiki , 25 4 Language.php

Sep 2003: 1 228 International logo contest/Ratification , 2 177 International logo contest/Ballot , 3 67 International logo contest/Logos 1-25 , 4 52 International logo contest/Logos 126-150 , 5 45 International logo contest/Logos 76-100 , 6 41 International logo contest/Logos 51-75 , 7 39 International logo contest/Logos 26-50 , 8 27 International logo contest/Vote on voting method , 9 24 International logo contest/Final logo variants , 10 24 International logo contest/Logos 101-125 , 11 21 Internationale Logo-Wahl/Stimmzettel , 12 18 International logo contest/Finalists , 13 15 Wikipedia mascot , 14 13 Wikimedia press releases/500,000 Wikipedia articles , 15 11 Main Page , 16 11 Why Wikipedia ran slow in late 2003 , 17 8 Wikimedia News , 18 7 Wikipedia raster name , 19 7 List of Wikimedians by religion , 20 6 International logo contest/Final logo variants/Nohat , 21 5 Linguistic democracy in a multilingual project , 22 5 Wikipedia.org is more popular than... , 23 5 International logo contest/Vote instructions , 24 4 International logo contest/Final logo variants/Paullusmagnus , 25 4 Deletionism

Oct 2003: 1 54 International logo contest/Final logo variants , 2 51 Link style vote , 3 24 Main Page , 4 18 International logo contest/Ratification , 5 14 Logo feedback , 6 11 Watchlist privacy , 7 11 International logo contest/Final logo variants/Nohat , 8 9 Wikipedia raster name , 9 7 WikiTrivia , 10 7 Cologne Blue skin problems , 11 7 The provisional portal of Wikipedia , 12 6 Sharing images across projects , 13 6 List of Wikimedians by religion , 14 6 List of Wikimedians by favorite color , 15 6 Linux user Wikimedians , 16 5 Wikipedia subtitle translations , 17 5 Queer Wikimedians , 18 4 Semi-deletion , 19 4 Linguistic democracy in a multilingual project , 20 4 Inclusionism , 21 4 Wikimedia press releases/500,000 Wikipedia articles , 22 4 Mac user Wikimedians , 23 4 Wikimedia News , 24 3 Privacy policy , 25 3 Embedding external images

Nov 2003: 1 9 Wikimedians by favorite text editor , 2 8 Main Page , 3 8 Wikimedia News , 4 6 Current issues , 5 6 Wikipedia , 6 5 List of Wikimedians by favorite ice cream flavor , 7 5 Current issues/Small Wikipedias , 8 5 Cologne Blue skin problems , 9 5 List of Wikimedians by favorite color , 10 5 Wikipedians categorized by sub-cultural affiliation , 11 4 Running MediaWiki on Windows , 12 4 Wikistress , 13 4 Non-American Wikimedians , 14 4 Interwiki bot , 15 4 Deletionism , 16 4 Contents , 17 4 Wikimedia press releases/500,000 Wikipedia articles , 18 4 MediaWiki , 19 4 The provisional portal of Wikipedia , 20 4 Wikipedia software upgrade status , 21 3 Consumerium , 22 3 Transwiki , 23 3 Egyptopedia , 24 3 Installer ideas , 25 3 MediaWiki development

Dec 2003: 1 18 MediaWiki feature request and bug report discussion , 2 18 Wikimedia News , 3 12 Main Page , 4 8 Interwiki bot , 5 7 Wikimorial , 6 7 The provisional portal of Wikipedia , 7 6 System message , 8 6 Current issues , 9 5 Edits as patches , 10 5 Richtlijnen voor systeembeheerders/werk1 , 11 5 Wikipedia.org is more popular than... , 12 4 Wikimedia Embassy , 13 4 Proposal for dead links , 14 4 Message substitution , 15 4 Wikitravel , 16 4 Interwiki link problem , 17 4 Lorraine , 18 4 Contents , 19 4 Wikimedia Foundation , 20 4 Queer Wikimedians , 21 3 Privacy policy , 22 3 Opera Arabic bug , 23 3 Interwiki bot/Getting started , 24 3 Field-value pairs , 25 3 Setting user rights in MediaWiki

Jan 2004: 1 12 MediaWiki feature request and bug report discussion , 2 11 Current issues , 3 9 Wikimedia News , 4 8 Wikimedia Embassy , 5 8 Wikipedia mascot , 6 6 Do fair use images violate the GFDL? , 7 6 Incivility , 8 6 Interwiki bot , 9 5 Main Page , 10 5 Windows user Wikimedians , 11 5 List of Wikimedians by religion , 12 4 The Wrong Version , 13 4 MediaWiki development , 14 4 Wikimedia press releases/500,000 Wikipedia articles , 15 4 Deletion management redesign , 16 4 Wikipedia software upgrade status , 17 3 Running MediaWiki on Windows , 18 3 Friends of gays should not be allowed to edit articles , 19 3 Edit toolbar , 20 3 Sysop management , 21 3 Title length , 22 3 Source of conflict , 23 3 Guide to the dual-license , 24 3 Recent changes , 25 3 Wikimedians who use PDAs

Feb 2004: 1 20 Wikimedia News , 2 16 Bureaucrat , 3 12 International names for Village Pump , 4 10 MediaWiki feature request and bug report discussion , 5 9 Thumbnailed images , 6 9 Wikimedia servers , 7 8 Main Page , 8 8 Language files to be updated , 9 8 Interwiki requests for adminship , 10 8 Wikipedia.org is more popular than... , 11 7 Current issues , 12 7 Wikipedia logo in each language , 13 6 Requests for logos , 14 6 Do fair use images violate the GFDL? , 15 6 Wikimedia press releases/500,000 Wikipedia articles , 16 5 Requests for permissions/Archive/Bureaucrat archive , 17 5 List of Wikimedians by religion , 18 4 Multilingual Wikimedians , 19 4 List of Wikimedians by favorite color , 20 4 Meetup , 21 4 Queer Wikimedians , 22 3 Wikivoyage/Goals and non-goals , 23 3 Wikimedia Embassy , 24 3 Numberpedia , 25 3 MediaWiki/ja

Mar 2004: 1 84 Stewards/elections 2004 , 2 71 Thumbnailed images , 3 50 Edit summary prefill poll , 4 19 Wikimedia News , 5 17 MediaWiki feature request and bug report discussion , 6 17 Main Page , 7 16 Mailing list merge , 8 15 Requests for logos , 9 13 Foundation-L Proposal , 10 12 Extension Syntax , 11 11 Interwiki requests for adminship , 12 10 Administrators of Wikimedia projects/Wikipedias , 13 9 Goings-on/March 2004 , 14 9 Wikipedia.org is more popular than... , 15 9 List of Wikimedians by religion , 16 7 Sidebar behavior poll , 17 7 Wikipedia logo in each language , 18 6 System administrators , 19 6 Steward requests/Permissions , 20 6 Edit summary prefill poll (2) , 21 6 The provisional portal of Wikipedia , 22 5 Wikimedia Embassy , 23 5 List of Wikimedians by age , 24 5 EasyTimeline , 25 5 WYSIWYG editor

Apr 2004: 1 48 Stewards/elections 2004 , 2 36 Steward requests/Permissions , 3 33 List of Wikimedians by age , 4 23 Extension Syntax , 5 22 Extension Syntax/Voting , 6 20 MediaWiki feature request and bug report discussion , 7 19 Wikimedia News , 8 14 Wikimedia Embassy , 9 13 Stewards , 10 13 Main Page , 11 12 Wikimedians by favorite text editor , 12 11 IRC/Channels , 13 11 MediaWiki roadmap , 14 10 Articles on fr with no interwiki link to en , 15 10 Administrators of Wikimedia projects/Wikipedias , 16 9 Requests for logos , 17 9 Wikipedia logo in each language , 18 8 System administrators , 19 8 Goings-on/April 2004 , 20 8 Language files to be updated , 21 7 Stewards policy , 22 7 Multilingual Wikimedians , 23 7 List of Wikimedians by religion , 24 6 Wikimedia power structure , 25 6 Articles on fr with no interwiki link to en/A

May 2004: 1 100 MediaWiki 1.3 comments and bug reports/Archive , 2 28 Wikimedia Foundation elections/Board elections/2004/Candidates , 3 26 List of Wikimedians by MBTI type , 4 24 MediaWiki feature request and bug report discussion , 5 23 List of articles every Wikipedia should have , 6 23 Translation/list , 7 23 Wikimedia Foundation elections/Board elections/2004/Notice translation , 8 23 Wikimedia News , 9 22 Requests for Wiktionary permissions , 10 21 Steward requests/Permissions , 11 16 Press Corps , 12 15 Main Page , 13 15 Wikipedia languages , 14 14 Server outage message , 15 13 List of Wikimedians by age , 16 12 Artificial languages , 17 12 Offensive content , 18 10 Election Notice Translation , 19 10 Wikimedia Foundation elections/Board elections/2004/FAQ , 20 10 Goings-on/May 2004 , 21 10 List of Wikimedians by birthday , 22 10 IRC/Channels , 23 10 MediaWiki roadmap , 24 9 Wikimedians by geekiness , 25 8 Requests for logos

Jun 2004: 1 96 MediaWiki 1.3 comments and bug reports/Archive , 2 80 Artificial languages equal rights , 3 26 Board vote poll , 4 26 List of Wikimedians by MBTI type , 5 23 MediaWiki feature request and bug report discussion , 6 23 Steward requests/Permissions , 7 22 Wikimedia News , 8 18 Main Page , 9 17 Wikipedia languages , 10 15 Wikimedia chapters , 11 15 List of articles every Wikipedia should have , 12 14 List of Wikimedians by age , 13 14 Article validation , 14 13 Administrators of Wikimedia projects/Wikipedias , 15 12 Grants given to Wikimedia Foundation , 16 12 Membership fees , 17 12 Goings-on , 18 12 Requests for logos , 19 12 Wikimedia servers , 20 10 User style , 21 9 Polls are evil , 22 9 Gallery of user styles , 23 9 IRC/Quotes , 24 8 Q3 and Q4 2004 hardware order worksheet , 25 8 Official position history

Jul 2004: 1 27 Steward requests/Permissions , 2 20 MediaWiki 1.3 comments and bug reports/Archive , 3 16 Main Page , 4 16 Wikimedia Embassy , 5 16 Wikimedia Deutschland/Chat , 6 15 Wikimedia News , 7 14 Foundation website meeting, July 2004 , 8 14 NEH Reference materials grant application/Narrative , 9 14 Interwiki bot , 10 14 List of Wikimedians by religion , 11 13 List of Wikimedians by age , 12 12 MediaWiki feature request and bug report discussion , 13 12 Developer payment/Arguments for and against payment , 14 12 Fragen der Süddeutschen Zeitung , 15 11 Artificial languages equal rights , 16 10 GALILEO Masters 2004 , 17 10 List of Wikimedians by birthday , 18 10 IRC/Channels , 19 9 GALILEO Masters 2004/Questionaire , 20 9 Opt-in Google-ads , 21 9 Wikimedia auf Messen , 22 9 Wikipedia languages , 23 9 IRC/Quotes , 24 9 Requests for logos , 25 8 System administrators

Aug 2004: 1 25 Steward requests/Permissions , 2 24 Wikimedia News , 3 20 MediaWiki 1.3 comments and bug reports/Archive , 4 19 List of Wikimedians by age , 5 14 Developer committee , 6 14 List of Wikimedians by birthday , 7 10 Main Page , 8 9 MediaWiki feature request and bug report discussion , 9 9 Artificial languages equal rights , 10 8 Wikimedia press releases/One million Wikipedia articles (int'l) , 11 8 Copyediting , 12 8 Wikimedia projects , 13 8 List of Wikimedians by MBTI type , 14 8 Contents , 15 7 Changing username , 16 7 Wikimedia Commons , 17 7 Requests for logos , 18 6 Wikimedia Press Team , 19 6 Golden Nica Awards 2004 , 20 6 Translation/list , 21 6 IRC/Quotes , 22 6 Wikimedians by geekiness , 23 6 WikiMen , 24 6 Administrators of Wikimedia projects/Wikipedias , 25 6 Windows user Wikimedians

Sep 2004: 1 64 Wikimania 2005 overview , 2 33 Translation requests/PR-1mil , 3 32 Translation requests/NL-1/En: , 4 27 Steward requests/Permissions , 5 22 Wikimedia News , 6 16 Translation requests/NL-1 , 7 16 Developer activity , 8 15 Main Page , 9 15 Translation requests/NL-1/Ja: , 10 15 Wikimedia press releases/One million Wikipedia articles (int'l) , 11 15 List of Wikimedians by birthday , 12 14 Foundation wiki feedback , 13 14 Wikimedia projects , 14 13 Translation requests/NL-1/Fr: , 15 13 Translation requests/ancient , 16 12 Press release logbook/pr-1mil/En: , 17 12 Translation requests/NL-1/De: , 18 11 Translation requests/WMF/Fundraising pages , 19 11 Translation requests/NL-1/It: , 20 11 Proposals for new projects , 21 10 Request for an account on the Foundation wiki , 22 10 Translation requests/NL-1/Es: , 23 10 Troisième communiqué de presse , 24 10 Edit conflict handling suggestion , 25 10 Non-development tasks for developers

Oct 2004: 1 138 Wikinews/Vote , 2 58 Wikimania 2005 participants , 3 34 Wikimania 2005 overview , 4 30 Steward requests/Permissions , 5 30 Wikinews/Vote/de , 6 28 Association of Inclusionist Wikipedians , 7 21 Wikinews/Vote/fr , 8 20 Wikinews/License straw poll , 9 19 Wikijunior , 10 19 Wikimedia meetup 2005/City Candidate List , 11 19 Association of Deletionist Wikipedians , 12 17 Wikijunior/Project name/Candidate nominations , 13 17 Wikimedia News , 14 14 Wikinews/Vote/ja , 15 14 Newsletter poll , 16 12 Wikinews/Logo/Proposals , 17 12 Translation requests/NL-1/Annc , 18 11 List of Wikimedians by age , 19 11 Wikinews/Vote/Zh/20041022 , 20 11 Translation requests/NL-1 , 21 11 Non-development tasks for developers , 22 10 Main Page , 23 10 Translation of the week , 24 10 Translation requests/WMF , 25 10 21C3

Nov 2004: 1 53 Wikinews/Vote , 2 37 Translation of the week/Translation candidates , 3 32 Translation of the week/2004 translations/Archive , 4 30 Wikimania 2005 participants , 5 29 Translation of the week , 6 28 Wikimania:Name/Vote , 7 27 Steward requests/Permissions , 8 27 Wikimedia News , 9 23 Realtime recent changes , 10 21 Main Page , 11 20 Wikijunior , 12 20 Association of Inclusionist Wikipedians , 13 19 Reports/October 2004/Wikipedia , 14 17 Wikijunior/Project name/Candidate nominations , 15 17 Association of Deletionist Wikipedians , 16 13 Wikijunior project first topics , 17 12 Firefox extension , 18 12 Wikimania 2005 banner , 19 11 Inactive wikis , 20 10 Bar , 21 10 Reports/October 2004/Wiktionary , 22 10 Goings-on , 23 10 List of Wikimedians by birthday , 24 10 List of Wikimedians by religion , 25 9 Wikinews/Vote/ja

Dec 2004: 1 59 Wikinews/Start a new edition , 2 32 Translation of the week/Translation candidates , 3 30 Redirect arrow contest , 4 28 Steward requests/Permissions , 5 24 Translation of the week/2004 translations/Archive , 6 24 Wikinews/Logo/Proposals , 7 23 WQ/Draft , 8 21 Wikimedia News , 9 18 Main Page , 10 18 Translation of the week , 11 18 Association of Inclusionist Wikipedians , 12 17 Wikispelling , 13 15 WQ/Name , 14 14 Translation requests/WQ/2 , 15 12 Proposals for new projects , 16 11 Wikimedians who blog , 17 11 21C3 , 18 10 Wikinews/License straw poll , 19 9 WQ/Team , 20 9 Translation requests/ancient , 21 9 Wikinews , 22 8 Realtime recent changes , 23 8 List of Wikimedians by MBTI type , 24 8 List of Wikimedians by birthday , 25 7 Association of Mergist Wikipedians

Jan 2005: 1 161 Wikinews logo contest voting , 2 43 Nofollow , 3 35 Wikinews/Start a new edition , 4 28 Translation of the week/Translation candidates , 5 26 Www.wikipedia.org portal , 6 22 Steward requests/Permissions , 7 20 Proposals for new projects , 8 19 Translation requests/WQ/2 , 9 19 Requests for new languages , 10 19 Wikimedia News , 11 18 Translation of the week/2005 translations/Archive , 12 18 Edit hints , 13 16 Main Page , 14 12 Wikimania 2005 overview , 15 12 Goings-on , 16 12 Association of Inclusionist Wikipedians , 17 11 Www.wikipedia.org portal/Catherine , 18 11 List of Wikipedias , 19 10 Translation of the week/2004 translations/Archive , 20 10 Wikinews/Logo/Proposals , 21 9 Wikinews Chat , 22 9 Redirect arrow contest , 23 9 Translation of the week , 24 9 Administrators of Wikimedia projects/Wikipedias , 25 9 Wikimedia servers

Feb 2005: 1 92 Wikinews logo contest voting/Runoff , 2 51 Wikinews/China , 3 48 Steward requests/Permissions , 4 30 Wikinews/Start a new edition , 5 27 Translation requests/WMF/Fundraising pages , 6 24 Translation requests/WQ/2 , 7 23 Nofollow , 8 21 Main Page , 9 20 Translation of the week/2005 translations/Archive , 10 20 Translation of the week/Translation candidates , 11 19 Wikimedia News , 12 17 Requests for new languages , 13 17 Wikimania 2005 banner , 14 16 Proposals for new projects , 15 15 Association of Inclusionist Wikipedians , 16 13 MediaWiki feature request and bug report discussion , 17 13 Goings-on , 18 13 List of Wikipedias , 19 12 Translation requests/WMF , 20 12 Wikipedia logo in each language , 21 11 日本語版ウィクショナリーの整備 , 22 10 Request for an account on the Foundation wiki , 23 10 Wikinews Chat , 24 10 Wikimania 2005 participants , 25 9 Foundation wiki feedback

Mar 2005: 1 48 Steward requests/Permissions , 2 24 Translation requests/WQ/2 , 3 23 Wikinews/Start a new edition , 4 20 Wikimedia News , 5 19 Association of Inclusionist Wikipedians , 6 17 Translation requests/Wikimania , 7 17 Board agenda/Open questions , 8 17 Presentations , 9 16 List of Wikipedias , 10 15 Translation of the week/2005 translations/Archive , 11 15 Requests for logos , 12 14 Main Page , 13 14 WQ/Retro , 14 13 Requests for new languages , 15 13 Translation of the week/Translation candidates , 16 12 日本語版ウィクショナリーの整備 , 17 11 Goings-on , 18 10 Ignore all rules , 19 10 List of Wikimedians by age , 20 10 Proposals for new projects , 21 10 Administrators of Wikimedia projects/Wikipedias , 22 9 Translation requests/WMF , 23 9 Translation requests/ancient , 24 9 Non-development tasks for developers , 25 9 Interwiki map

Apr 2005: 1 52 Steward requests/Permissions , 2 29 CheckUser , 3 25 Requests for new languages , 4 25 Wikimedia News , 5 22 Translation requests/Wikimania , 6 22 Translation of the week/Translation candidates , 7 18 Wikinews/Start a new edition , 8 17 Translation requests/WMFnews , 9 17 Wikimedia COTW/Help , 10 17 Translation of the week/2005 translations/Archive , 11 17 MediaWiki FAQ , 12 16 List of Wikipedias , 13 14 Contents , 14 13 Wikimedia Embassy , 15 13 Proposals for new projects , 16 13 Association of Inclusionist Wikipedians , 17 12 List of Wikimedians by age , 18 12 Goings-on , 19 11 Registration begins for Wikimania 2005 , 20 11 Vandalism reports , 21 11 Translation requests/ancient , 22 11 List of Wikimedians by birthday , 23 11 Administrators of Wikimedia projects/Wikipedias , 24 10 Privacy policy , 25 10 Legal department/Historical

May 2005: 1 208 Stewards/elections 2005 , 2 43 Steward requests/Permissions , 3 28 Requests for new languages , 4 25 En validation topics , 5 25 Wikinews/Start a new edition , 6 25 Translation of the week/Translation candidates , 7 22 Wikimedia News , 8 21 Proposals for new projects , 9 18 Wikimedia Foundation elections/Board elections/2005/Notice translation , 10 18 Translation of the week/2005 translations/Archive , 11 16 Wikimedia Deutschland/Vorstandswahlen 2005 , 12 16 IRC/Quotes , 13 15 List of Wikipedias , 14 15 Administrators of Wikimedia projects/Wikipedias , 15 14 List of Wikimedians by age , 16 14 Wikimedia Research Network , 17 14 Wikimedia Foundation elections/Board elections/2005/FAQ , 18 14 Translation requests/WMFnews , 19 12 Wikinews design contest , 20 12 Interwiki bot , 21 12 Sites using MediaWiki , 22 11 Wikimedia Foundation elections/Board elections/2005/Candidates , 23 11 Translation requests/quick translation , 24 11 Wikimedia projects , 25 11 Translation/list

Jun 2005: 1 60 Steward requests/Permissions , 2 59 Requests for new languages , 3 31 Wikimedia Research Network , 4 31 Wikimedia News , 5 28 Wikijunior/Project name/Vote , 6 22 List of Wikipedias , 7 20 Wikimedia CH/Archive , 8 19 Wikimedia Foundation elections/Board elections/2005/Notice translation , 9 19 Wikimedia Foundation elections/Board elections/2005/Candidates , 10 17 Translation of the week/Translation candidates , 11 17 Proposals for new projects , 12 16 Wikimedia Research Network/Interests , 13 16 Translation of the week/2005 translations/Archive , 14 14 Wikimedia servers , 15 13 List of Wikimedians by age , 16 13 Wikimedia Foundation elections/Board elections/2005/Interface translation , 17 13 MediaWiki 1.5 upgrade , 18 12 Wikimedia Foundation elections/Board elections/2005/Candidates/fr , 19 12 En validation topics , 20 12 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 21 12 Wikimedia chapters , 22 11 A new look at the interwiki link , 23 11 Wikijunior/Project name/Final vote , 24 11 Administrators of Wikimedia projects/Wikipedias , 25 11 Sites using MediaWiki

Jul 2005: 1 82 Steward requests/Permissions , 2 34 Requests for new languages , 3 32 Wikimedia Foundation elections/Board elections/2005/Results , 4 30 Wikimedia News , 5 27 Wikinews/Start a new edition , 6 27 Proposals for new projects , 7 25 Translation of the week/Translation candidates , 8 23 WikiProject Chess , 9 21 List of Wikipedias , 10 18 Translation of the week/2005 translations/Archive , 11 17 Proposal for Sinitic linguistic policy , 12 17 Capital and small letters for interwiki , 13 16 Sites using MediaWiki , 14 14 Wikimedia Research Network , 15 14 MediaWiki FAQ , 16 12 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 17 12 List of Wikimedians by birthday , 18 11 Wikinews/Future Talk , 19 11 Www.wikipedia.org template/temp , 20 11 Goings-on , 21 10 List of Wikimedians by age , 22 10 Interwiki bot/Warnfiles , 23 9 MediaWiki extensions , 24 8 Toytoy's proposed policy for wiki closure , 25 8 Slavopedia

Aug 2005: 1 95 Steward requests/Permissions , 2 39 Requests for new languages , 3 33 Proposals for new projects , 4 29 Wikimedia News , 5 27 International Wikinews Writing Contest , 6 24 List of Wikipedias , 7 21 Wikimania 2006/Planning , 8 21 Fund drives/2005/Q3 planning/Translations , 9 21 Proposal for Sinitic linguistic policy , 10 20 Translation of the week/2005 translations/Archive , 11 16 Wikimania:Blog , 12 16 Wikinews/Start a new edition , 13 14 Translation of the week/Translation candidates , 14 12 Improving on Wikimania 2005 , 15 12 Fund drives/2005/Q3 planning/Translations/Fundraising drive letter - en , 16 12 Goings-on , 17 12 MediaWiki FAQ , 18 12 Eliminating index.php from the url , 19 11 Wikijunior/Kiki character/Designs/Second last round , 20 11 Spam blacklist , 21 11 Wikinews/License straw poll , 22 11 Rewrite Rules , 23 11 Wikimedia chapters , 24 10 Wikinews/Licensure Poll , 25 10 Fund drives/2005/Q3 planning

Sep 2005: 1 157 Wikiversity/Vote/Votes yes , 2 88 Steward requests/Permissions , 3 56 Wikiversity/Vote/Votes no , 4 47 Requests for new languages , 5 33 International Wikinews Writing Contest , 6 32 Multilingual error messages/Translations , 7 32 International Wikinews Writing Contest/log , 8 28 Proposal for Sinitic linguistic policy , 9 27 Wikinews/Licensure Poll/CC-BY/For , 10 25 Wikimedia News , 11 23 Proposals for new projects , 12 18 Translation of the week/2005 translations/Archive , 13 18 Translation of the week/Translation candidates , 14 18 List of Wikipedias , 15 14 Wikinews/Licensure Poll/WNL2/For , 16 14 Goings-on , 17 12 Botopedia , 18 12 Wikinews/Licensure Poll/WNL2/Oppose , 19 12 Wikinews/Licensure Poll/GFDL/Oppose , 20 11 Ignore all rules , 21 11 Wikiversity , 22 11 Wikinews/Start a new edition , 23 11 Interwiki map , 24 10 Spam blacklist , 25 10 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists

Oct 2005: 1 129 Wikiversity/Vote/Votes yes , 2 80 Steward requests/Permissions , 3 53 Requests for new languages , 4 51 Wikiversity/Vote/Votes no , 5 37 Wikimania 2006/Why and why not? , 6 30 Proposals for new projects , 7 25 Requests for new languages/Old requests archive/Approved , 8 25 Wikimedia News , 9 21 Administrators of Wikimedia projects/Wikipedias , 10 20 Translation of the week/Translation candidates , 11 19 List of Wikipedias , 12 16 Toolserver , 13 16 Wikinews/Start a new edition , 14 14 Wikimania 2006/Planning , 15 14 International Wikinews Writing Contest/log , 16 14 Translation of the week/2005 translations/Archive , 17 14 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 18 13 如何访问维基媒体旗下项目 , 19 13 Wikimedia UK v1.0 , 20 12 Ignore all rules , 21 12 Requests for new languages/Wikipedia Dutch Low Saxon , 22 11 Multilingual error messages/Translations , 23 11 Requests for new languages/Wikipedia Lombard , 24 11 IRC/Quotes , 25 10 Wikimania 2006/Boston

Nov 2005: 1 89 Requests for new languages , 2 73 Steward requests/Permissions , 3 37 Steward requests/Bot status , 4 35 Requests for new languages/Wikipedia Murcian Spanish , 5 28 Proposals for new projects , 6 23 Wikimedia News , 7 20 CheckUser policy , 8 18 Ignore all rules , 9 18 Administrators of Wikimedia projects/Wikipedias , 10 15 List of Wikipedias , 11 14 Requests for new languages/Old requests archive/Approved , 12 14 Translation of the week/Translation candidates , 13 12 Translation of the week/2005 translations/Archive , 14 12 Association of Deletionist Wikipedians , 15 12 Sites using MediaWiki , 16 11 Requests for new languages/Old requests archive/Native speaker support , 17 11 List of Wikimedians by age , 18 11 Toolserver , 19 11 Wikinews/Start a new edition , 20 11 Wikimedia UK v1.0 , 21 10 Wikimedia Research Network , 22 10 Goings-on , 23 10 MediaWiki FAQ , 24 9 November 2005 image server , 25 9 Louvre forbids taking photographs

Dec 2005: 1 218 Stewards/elections 2006 , 2 71 Steward requests/Permissions , 3 68 Fund drives/2005/Q4 planning/Translations , 4 56 Steward requests/Bot status , 5 47 Requests for new languages , 6 32 Translation of the week/Translation candidates , 7 29 Request for an account on the Foundation wiki , 8 26 Wikimedia News , 9 25 Proposals for new projects , 10 21 Wikinews/Start a new edition , 11 21 List of Wikipedias , 12 19 Ignore all rules , 13 18 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 14 16 Translation of the week/2005 translations/Archive , 15 14 Administrators of Wikimedia projects/Wikipedias , 16 13 Requests for new languages/Old requests archive/Approved , 17 13 Foundation wiki feedback , 18 13 Requests for new languages/Wikipedia Ladin , 19 13 Spam blacklist , 20 13 MediaWiki FAQ , 21 13 Sites using MediaWiki , 22 12 Goings-on , 23 11 Association of Deletionist Wikipedians , 24 11 Wikimedia servers , 25 10 Fund drives/2005/Q4 planning/Translations/Fundraising drive letter - fr

Jan 2006: 1 126 Stewards/elections 2006 , 2 105 Requests for new languages , 3 87 Steward requests/Permissions , 4 70 Steward requests/Bot status , 5 39 9/11 wiki move proposal , 6 35 Translation of the week/Translation candidates , 7 32 Wiki for standards/Vote , 8 32 Proposals for new projects , 9 30 List of Wikipedias , 10 28 Ignore all rules , 11 27 Wikimedia News , 12 21 Requests for new languages/Old requests archive/Non-natural , 13 18 Steward requests/Permissions/2006-01 , 14 18 Toolserver , 15 17 MediaWiki FAQ , 16 16 Translation of the week/2006 translations/Archive , 17 14 Requests for new languages/Old requests archive/Approved , 18 14 Request for an account on the Foundation wiki , 19 14 Wikimedia Canada/Participants , 20 14 Spam blacklist , 21 14 Administrators of Wikimedia projects/Wikipedias , 22 13 Stewards , 23 13 Wikimedia Australia , 24 13 Fund drives/2005/Q4 planning/Translations , 25 13 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists

Feb 2006: 1 54 Steward requests/Bot status , 2 53 Steward requests/Permissions , 3 36 Wikimedia News , 4 26 Wikinews/Vote/zh , 5 25 Requests for new languages , 6 23 Translation of the week/Translation candidates , 7 22 Ignore all rules , 8 21 Wikimedia Canada/Participants , 9 21 List of Wikipedias , 10 18 Proposals for new projects , 11 17 Google Grants , 12 17 Wikimedia Foundation board meetings , 13 14 Translation of the week/2006 translations/Archive , 14 14 MediaWiki FAQ , 15 13 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 16 13 Sites using MediaWiki , 17 11 Communications committee , 18 11 IRC/Quotes , 19 10 Wikimedia press releases/English Wikipedia hits milestone 1 million articles , 20 10 Wikimania 2006/Program Team , 21 10 Association of Deletionist Wikipedians , 22 10 Administrators of Wikimedia projects/Wikipedias , 23 10 Wikiquote , 24 9 Wikimedia Taiwan/發起人名冊/非正式 , 25 9 Goings-on

Mar 2006: 1 86 Steward requests/Permissions , 2 78 Requests for new languages , 3 55 Steward requests/Bot status , 4 39 Proposals for new projects , 5 38 Wikimedia News , 6 23 Translation of the week/Translation candidates , 7 21 Office actions , 8 21 List of Wikipedias , 9 20 Requests for new languages/Old requests archive/Approved , 10 18 Wikinews/Start a new edition , 11 17 Translation of the week/2006 translations/Archive , 12 16 Wikinews/Vote/zh , 13 16 MediaWiki FAQ , 14 15 Wikimedia press releases/English Wikipedia hits milestone 1 million articles , 15 14 Foundation wiki feedback , 16 14 Cite/Cite.php , 17 14 Steward requests/Checkuser , 18 13 Ignore all rules , 19 13 Spam blacklist , 20 12 Request for an account on the Foundation wiki , 21 12 Wikimedia Taiwan/發起人名冊/非正式 , 22 12 List of Wikimedians by birthday , 23 12 Administrators of Wikimedia projects/Wikipedias , 24 11 Toolserver , 25 11 IRC/Quotes

Apr 2006: 1 106 Requests for new languages , 2 84 Steward requests/Permissions , 3 60 Proposals for closing projects , 4 53 Wikimedia Taiwan/命名投票 , 5 48 Steward requests/Bot status , 6 41 Wikimedia News , 7 32 Proposals for new projects , 8 26 Translation of the week/Translation candidates , 9 24 OTRS/Personnel , 10 22 List of Wikipedias , 11 21 Ignore all rules , 12 21 MediaWiki FAQ , 13 20 Office actions , 14 18 Summer of Code 2006 , 15 15 Translation of the week/2006 translations/Archive , 16 14 ParserFunctions , 17 14 Spam blacklist , 18 13 Toolserver , 19 13 IRC/Quotes , 20 12 Requests for new languages/Old requests archive/Approved , 21 12 Requests for new languages/Old requests archive/Non-natural , 22 12 Steward requests/Permissions/2006-04 , 23 10 Requests for new languages/Ancient , 24 10 Snowball clause , 25 10 Wikimedia Taiwan/發起人名冊/非正式

May 2006: 1 78 Steward requests/Permissions , 2 64 Requests for new languages , 3 47 Wikimedia News , 4 39 Requests for new languages/Ancient , 5 37 Proposals for closing projects , 6 33 Requests for new languages/Wikipedia Montenegrin , 7 25 Translation of the week/Translation candidates , 8 19 Wikimedia Hong Kong/會員召募/初步意向調查 , 9 19 Proposals for new projects , 10 19 List of Wikipedias , 11 17 Requests for new languages/Old requests archive/Non-natural , 12 15 IRC/Quotes , 13 14 Request for an account on the Foundation wiki , 14 14 Translation of the week/2006 translations/Archive , 15 14 Toolserver , 16 14 Goings-on , 17 13 Requests for new languages/Old requests archive/Approved , 18 13 Foundation wiki feedback , 19 13 Ignore all rules , 20 13 Steward requests/Checkuser , 21 12 Requests for new languages/Old requests archive/Native speaker support , 22 12 ParserFunctions , 23 12 Translation requests/Wikimania/Announcements , 24 11 Wikinews/Start a new edition , 25 11 IRC/Channels

Jun 2006: 1 122 Proposals for closing projects , 2 104 Requests for new languages , 3 73 Steward requests/Permissions , 4 39 Wiktionary/logo/archive-vote-1 , 5 36 Wikimedia News , 6 32 Wikimedia Incubator/logo , 7 31 Translation of the week/Translation candidates , 8 26 Requests for new languages/Wikipedia Montenegrin , 9 24 Translation requests/Wikimania/June notice , 10 22 Requests for new languages/Old requests archive/Non-natural , 11 22 Wikimedia Incubator/name , 12 21 Requests for new languages/Ancient , 13 20 List of Wikipedias , 14 18 Wikibooks/Logo/Archive 1 , 15 18 Fundraising committee/2006/Main page , 16 18 Proposals for new projects , 17 14 Toolserver/New accounts , 18 14 Steward requests/Bot status , 19 13 IRC/Quotes , 20 12 Translation of the week/2006 translations/Archive , 21 12 Spam blacklist , 22 11 Request for an account on the Foundation wiki , 23 11 Svensk lokalförening , 24 11 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 25 10 Requests for new languages/Old requests archive/Approved

Jul 2006: 1 89 Wikimedia Incubator/logo , 2 73 Steward requests/Permissions , 3 70 Requests for new languages , 4 67 Proposals for closing projects , 5 45 Wiktionary/logo/archive-vote-1 , 6 39 Wikimedia Incubator/name , 7 26 Wikimedia News , 8 23 Wikibooks/Logo/Archive 1 , 9 23 Proposals for new projects , 10 22 Translation of the week/Translation candidates , 11 17 Election translations 2006 , 12 17 Steward requests/Checkuser , 13 15 Toolserver/New accounts , 14 15 Steward requests/Bot status , 15 14 Ignore all rules , 16 13 List of Wikipedias , 17 13 Administrators of Wikimedia projects/Wikipedias , 18 12 Foundation wiki feedback , 19 12 Snowball clause , 20 12 Translation of the week/2006 translations/Archive , 21 12 Wikitext examples , 22 12 Editing , 23 10 Spam blacklist , 24 9 Requests for new languages/Old requests archive/Approved , 25 9 Request for an account on the Foundation wiki

Aug 2006: 1 174 Requests for new languages , 2 95 Steward requests/Permissions , 3 69 Wikimedia Foundation elections/Board elections/2006/Candidates/en , 4 32 Election translations 2006 , 5 28 Proposals for new projects , 6 27 Wikimedia News , 7 26 Wiktionary/logo/archive-vote-1 , 8 26 Wikinews/Start a new edition , 9 24 Translation of the week/Translation candidates , 10 23 Proposals for closing projects , 11 22 List of Wikipedias , 12 20 Ignore all rules , 13 20 Wikiversity/Logo/archive-vote-1 , 14 20 Translator in the following language combinations , 15 20 Wikimedia Foundation elections/Board elections/2006/Candidates/de , 16 18 Requests for new languages/Ancient , 17 17 Wikimedia Foundation elections/Board elections/2006/Candidates/fr , 18 15 Translation of the week/2006 translations/Archive , 19 15 List of Wikimedians by birthday , 20 14 Requests for new languages/Wikipedia Montenegrin , 21 13 Stewards , 22 13 Wikimania 2007/Taipei , 23 13 OTRS/Personnel , 24 13 Help Forum , 25 13 Spam blacklist

Sep 2006: 1 131 Wikiversity/Logo/archive-vote-1 , 2 130 Wiktionary/logo/archive-vote-1 , 3 115 Requests for new languages , 4 105 Wikibooks/Logo/Archive 1 , 5 82 Steward requests/Permissions , 6 58 Requests for permissions/CommonsDelinker , 7 45 Snowball clause , 8 45 Proposals for closing projects , 9 42 Wikimania 2007/Torino , 10 31 Wikimania 2007/Taipei , 11 31 Wikimedia News , 12 27 Wikibooks/Logo/Archive 3 , 13 27 Wikinews/Start a new edition , 14 21 Ignore all rules , 15 20 Requests for new languages/Ancient , 16 20 Translation of the week/Translation candidates , 17 19 Wikiversity/Logo/archive-vote-3 , 18 19 List of Wikipedias , 19 18 OTRS/Personnel , 20 17 Wiktionary/logo/archive-vote-3 , 21 16 Wikimedia Taiwan/發起人名冊 , 22 15 Wikimania 2007/Alexandria , 23 13 Proposals for new projects , 24 12 Wikimania 2007/Bid list , 25 12 ParserFunctions

Oct 2006: 1 207 Wiktionary/logo/archive-vote-4 , 2 199 Requests for new languages , 3 159 Wikiversity/Logo/archive-vote-4 , 4 151 Wikibooks/Logo/Archive 4 , 5 126 Wiktionary/logo/archive-vote-3 , 6 99 Wikibooks/Logo/Archive 3 , 7 98 Steward requests/Permissions , 8 96 Wikiversity/Logo/archive-vote-3 , 9 35 Wikimedia News , 10 25 Requests for comment/Board Election 2006 , 11 22 List of Wikipedias , 12 19 Requests for new languages/Ancient , 13 18 Translation of the week/Translation candidates , 14 17 Association of Stroopwafel Addicts , 15 16 Proposals for closing projects , 16 16 Proposals for new projects , 17 15 Requests for new languages/Wikipedia Montenegrin , 18 15 Wikinews/Start a new edition , 19 14 Copyright wishlist , 20 14 Spam blacklist , 21 14 IRC/Quotes , 22 13 Requests for new languages/Old requests archive/Approved , 23 13 Translation of the week/2006 translations/Archive , 24 12 Ignore all rules , 25 12 Toolserver/New accounts

Nov 2006: 1 277 Stewards/elections 2006-2 , 2 171 Proposals for closing projects/Closure of Siberian Wikipedia , 3 94 Requests for new languages , 4 79 Steward requests/Permissions , 5 78 Requests for new languages/Wikipedia Montenegrin , 6 74 Proposals for closing projects , 7 36 Wikiversity/Logo/archive-vote-6 , 8 33 Wikimedia News , 9 31 Requests for new languages/Ancient , 10 30 Discussion on the logo votes , 11 26 Proposals for new projects , 12 23 Stewards/elections 2006-2/statements , 13 23 Stewards/confirm/2009/mul , 14 21 Requests for new languages/Wikisource Siberian , 15 19 Proposals for closing projects/Closure of Moldovan Wikipedia , 16 18 Steward requests/Checkuser , 17 18 Translation of the week/Translation candidates , 18 17 Requests for logos , 19 16 Translation of the week/2006 translations/Archive , 20 15 Requests for new languages/Wikipedia Belarusian (1959) , 21 15 List of Wikipedias , 22 13 Foundation wiki feedback , 23 12 OTRS/Volunteering , 24 12 Requests for comment/Request to Stewards , 25 11 Spam blacklist

Dec 2006: 1 265 Stewards/elections 2006-2 , 2 101 Steward requests/Permissions , 3 67 Proposals for closing projects/Closure of Siberian Wikipedia , 4 59 Stewards/confirm/2009/mul , 5 31 Proposals for new projects , 6 28 Wikimedia News , 7 26 Translation requests/WMF/Fundraising Sitenotice(Anonymous)/2006 , 8 26 Translation requests/WMF/disclaimer/status , 9 24 List of Wikipedias , 10 23 Translation request/WMF/Fundraising Sitenotice(default)/2006 , 11 23 Wikiversity/Logo/archive-vote-6 , 12 22 Snowball clause , 13 22 Steward requests/Checkuser , 14 21 Fundraising FAQ/status , 15 19 Translation requests/WMF/Give the gift of knowledge/status , 16 19 Proposals for closing projects/Closure of Old English Wikisource , 17 19 Proposals for closing projects/Closure of Moldovan Wikipedia , 18 18 Request for an account on the Foundation wiki , 19 18 Spam blacklist , 20 17 Steward requests/Bot status , 21 16 Wikimedia Open Access chat , 22 15 Stewards , 23 15 Foundation wiki feedback , 24 13 Requests for new languages/Wikipedia Ottoman Turkish 2 , 25 13 OTRS/Volunteering

Jan 2007: 1 86 Steward requests/Permissions , 2 29 Wikimedia News , 3 28 Proposals for new projects , 4 23 Spam blacklist , 5 22 Requests for new languages/Wikipedia Montenegrin 2 , 6 18 Proposals for closing projects/Closure of Siberian Wikipedia , 7 18 Translation of the week/Translation candidates , 8 17 Steward requests/Bot status , 9 16 Toolserver/New accounts , 10 16 List of Wikipedias , 11 15 Proposals for closing projects/Closure of Kanuri Wikipedia , 12 15 Wikimedia Japan/Archives/20110819 , 13 15 Steward requests/Checkuser , 14 15 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 15 14 Requests for comment/Blockinblox on Simple English Wikipedia , 16 14 Requests for new languages/Wikipedia Sakha , 17 14 Association of Stroopwafel Addicts , 18 13 Snowball clause , 19 13 Translation requests/WMF/Wikimedia thanks all contributors/status , 20 13 Proposals for closing projects/Closure of Inuktitut Wikipedia , 21 12 Proposals for closing projects/Closure of Finnish Wikiquote , 22 11 Spam blacklist/Log , 23 11 Steward requests/Permissions/Approved temporary , 24 11 Requests for new languages , 25 11 List of Wikimedians by birthday

Feb 2007: 1 90 Steward requests/Permissions , 2 29 List of Wikipedias , 3 28 OTRS/Volunteering , 4 26 Wikimedia News , 5 19 Ignore all rules , 6 19 OTRS/Personnel , 7 18 Steward requests/Checkuser , 8 17 Proposals for closing projects/Closure of Herero Wikipedia , 9 16 Spam blacklist , 10 15 Steward requests/Bot status , 11 15 Proposals for new projects , 12 14 Translation requests/WMF/Press releases/Wikipedia stable, but still dependent on your support/status , 13 14 Proposals for closing projects/Closure of Siberian Wikipedia , 14 14 OTRS , 15 14 Requests for new languages , 16 13 Deceased editors , 17 12 MediaWiki Ideal , 18 12 Proposals for closing projects/Closure of Simple English Wikiquote , 19 12 Toolserver/New accounts , 20 11 Requests for new languages/Wikipedia Montenegrin 2 , 21 11 Proposals for closing projects/Closure of Venda Wikipedia , 22 10 Requests for new languages/Wikipedia Insubric , 23 10 Requests for new languages/Wikiversity Italian 2 , 24 10 Translation of the week/2007 translations/Archive , 25 10 Wikimedia chapters

Mar 2007: 1 84 Steward requests/Permissions , 2 43 Planet Wikimedia/New language , 3 35 Wikimedia Norge , 4 33 Planet Wikimedia , 5 26 Wikimedia News , 6 23 OTRS/Volunteering , 7 22 Proposals for closing projects/Closure of Siberian Wikipedia , 8 22 List of Wikipedias , 9 21 Requests for new languages/Wikipedia Ottoman Turkish 2 , 10 20 Ignore all rules , 11 20 Steward requests/Bot status , 12 19 Request for an account on the Foundation wiki , 13 19 Steward requests/Checkuser , 14 18 Proposals for new projects , 15 17 OTRS/Personnel , 16 16 Wikimedia Vatican , 17 16 Toolserver/New accounts , 18 13 Staff , 19 13 Translation requests/WMF/Staff/en , 20 12 Office actions , 21 12 Translation of the week/2007 translations/Archive , 22 11 Foundation wiki feedback , 23 11 Requests for new languages/Wikipedia Insubric , 24 11 Spam blacklist , 25 11 Wikinews/Start a new edition

Apr 2007: 1 83 Steward requests/Permissions , 2 34 Wikimedia News , 3 30 OTRS/Volunteering , 4 27 Planet Wikimedia/New language , 5 23 Steward requests/Checkuser , 6 22 Steward requests/Bot status , 7 21 OTRS/Personnel , 8 21 List of Wikipedias , 9 19 Requests for new languages/Wikipedia Classical Japanese 2 , 10 19 Toolserver/New accounts , 11 18 Wikimedia Forum , 12 18 Requests for new languages , 13 18 Proposals for new projects , 14 17 Ignore all rules , 15 16 Requests for new languages/Wikisource Tamil , 16 16 Communication Projects Group , 17 15 Requests for new languages/Wikipedia Lower Sorbian 2 , 18 15 Requests for new languages/Wikipedia Karelian 2 , 19 14 Communication Projects Group/Projects/Success stories - how has Wikimedia changed your life? , 20 14 List of Wikimedian pubs , 21 14 Open Source Toolset , 22 14 Wikimedia Norge , 23 14 Requests for new languages/Wikipedia American Sign Language 2 , 24 14 Translation of the week/Translation candidates , 25 13 OTRS

May 2007: 1 108 Steward requests/Permissions , 2 55 Wikimedia Česká republika/cs , 3 47 Ignore all rules , 4 37 Steward requests/Checkuser , 5 34 Wikimedia brand survey , 6 32 Wikimedia News , 7 31 Steward requests/Bot status , 8 31 List of Wikipedias , 9 27 Make sure you have a password , 10 25 OTRS/Volunteering , 11 19 Wikimedia Forum , 12 18 Translation of the week/Translation candidates , 13 16 OTRS/Personnel , 14 15 GDJ 2007 , 15 15 Spam blacklist , 16 15 Proposals for new projects , 17 15 IRC/Channels , 18 14 Requests for new languages/Wiktionary Upper Sorbian , 19 14 Toolserver/New accounts , 20 13 Deceased editors , 21 12 OTRS , 22 12 Wikimedia chapters , 23 11 FireWiki Proposal , 24 11 Requests for new languages/Wikipedia Karelian 2 , 25 10 Proposals for closing projects/Closure of Swati Wikipedia

Jun 2007: 1 380 Wikimedia Foundation elections/Board elections/2007/Endorsements/Submission , 2 105 Steward requests/Permissions , 3 57 Wikimedia brand survey , 4 56 Wikimedia Foundation elections/Board elections/2007/Candidates/Danny/questions , 5 44 Wikimedia Foundation elections/Board elections/2007/Candidates/WarX/questions , 6 43 Wikimedia Foundation elections/Board elections/2007/Candidates/Kate/questions , 7 42 Steward requests/Checkuser , 8 40 Wikimedia Foundation elections/Board elections/2007/Candidates/Eloquence/questions , 9 40 Wikimedia Foundation elections/Board elections/2007/Candidates/Mindspillage/questions , 10 39 Wikimedia Foundation elections/Board elections/2007/Candidates/Michael Snow/questions , 11 37 Wikimedia Foundation elections/Board elections/2007/Candidates/DragonFire1024/questions , 12 36 Wikimedia Foundation elections/Board elections/2007/Candidates/^demon/questions , 13 36 Wikimedia Foundation elections/Board elections/2007/Candidates/Oscar/questions , 14 34 Wikimedia Foundation elections/Board elections/2007/Candidates/Yann/questions , 15 33 Wikimedia Foundation elections/Board elections/2007/Candidates/Ausir/questions , 16 33 Wikimedia News , 17 32 Wikimedia Foundation elections/Board elections/2007/Candidates/UninvitedCompany/questions , 18 29 Wikimedia Foundation elections/Board elections/2007/Candidates/Kim Bruning/questions , 19 29 Board elections/2007/Translations , 20 24 Ignore all rules , 21 23 Wikimedia Foundation elections/Board elections/2007/Candidates/Kingboyk/questions , 22 22 Steward requests/Bot status , 23 21 Wikipedia.de , 24 21 Wikimedia Foundation elections/Board elections/2007/Candidates/SarekOfVulcan/questions , 25 20 Requests for permissions/Yiddish Wikipedia

Jul 2007: 1 98 Steward requests/Permissions , 2 49 Steward requests/Checkuser , 3 36 OTRS/Volunteering , 4 32 Ignore all rules , 5 32 Wikimedia Foundation elections/Board elections/2007/Results/status , 6 28 OTRS/Personnel , 7 26 List of Wikipedias , 8 25 Steward requests/Bot status , 9 23 Wikimedia News , 10 21 Wikibooks/Logo/Archive 5 , 11 21 Toolserver/New accounts , 12 18 Requests for new languages/Wikipedia Aeres , 13 17 Critiques papier étudiants Sciences Po , 14 17 Wikimedia Pennsylvania , 15 16 Wikimedia Foundation elections/Board elections/2007/Candidates/Danny/questions , 16 15 Translation of the week/Translation candidates , 17 14 Steward requests/Username changes , 18 14 Translation requests/Eleccom mail, 07-05/status , 19 14 Wikimedia Foundation elections/Board elections/2007/Vote , 20 14 OTRS , 21 14 Wikimedia chapters , 22 13 Wikimedia Forum , 23 13 Requests for comment/Board Election 2007 , 24 13 Wikimedia Foundation elections/Board elections/2007/Candidates/^demon/questions , 25 13 Translation of the week/2007 translations/Archive

Aug 2007: 1 91 Steward requests/Permissions , 2 38 Requests for new languages/Wikipedia Latinized Russian , 3 26 Steward requests/Bot status , 4 24 OTRS/Volunteering , 5 24 Proposals for new projects , 6 23 Ignore all rules , 7 23 Steward requests/Checkuser , 8 21 Steward requests/Username changes , 9 21 Wikimedia News , 10 19 Requests for new languages/Wikipedia Pre-reform Russian , 11 18 Wikimania 2008/Bids , 12 17 Wikimania 2008/Wishlist , 13 17 Toolserver/New accounts , 14 16 Wikimania 2008/Bids/Atlanta , 15 16 Wikimedia Japan/Archives/20110819 , 16 16 Multilingual error messages/Translations , 17 15 List of Wikipedias , 18 14 Wikimedia Forum , 19 14 Requests for new languages , 20 13 Requests for new languages/Wikiquote Limburgish , 21 13 Requests for new languages/Wikisource Bengali 2 , 22 12 GDJ 2007 , 23 12 Spam blacklist , 24 11 Proposals for closing projects/Closure of Simple English Wikiquote , 25 11 Wikimania 2008/Bids/Toronto

Sep 2007: 1 90 Steward requests/Permissions , 2 49 Proposals for closing projects/Closure of Volapük Wikipedia , 3 40 Fundraising 2007/web buttons , 4 40 OTRS/Volunteering , 5 26 GDJ 2007 , 6 24 Steward requests/Checkuser , 7 24 Steward requests/Bot status , 8 22 Wikimedia Forum , 9 21 Proposals for new projects , 10 20 Ignore all rules , 11 20 Wikimania 2008/Bids/Alexandria , 12 20 List of Wikipedias , 13 18 Wikimedia Australia , 14 17 Translation of the week/Translation candidates , 15 16 Multilingual error messages/Draft , 16 16 OTRS/Personnel , 17 15 Toolserver/New accounts , 18 15 Wikimedia chapters , 19 15 Wikimedia News , 20 14 Betawiki being hosted by Wikimedia , 21 13 Wikimania 2008/Bids/Alexandria/Q&A , 22 13 Wikimania 2008/Bids/Atlanta/Southeast team , 23 12 Wikimedia New York City , 24 11 Wikimania 2008/Bids/Cape Town , 25 11 Steward requests/Username changes

Oct 2007: 1 102 Steward requests/Permissions , 2 99 Fundraising 2007/Text for sitenotice , 3 67 Proposals for closing projects/Closure of Volapük Wikipedia , 4 47 Proposals for closing projects/Deletion of Siberian Wikipedia , 5 44 Fundraising 2007/Video with Jimmy subtitles/Translations/status , 6 40 Fundraising 2007/Landing page/Translations/status , 7 33 Fundraising 2007/Donate form/Translations/status , 8 32 Wikimania 2008/Bids/Alexandria , 9 28 Fundraising 2007/Core interface , 10 26 Steward requests/Bot status , 11 25 Fundraising 2007/Landing page testimonials/Translations/status , 12 25 Wikimedia News , 13 24 Fundraising 2007/web buttons , 14 22 Fundraising 2007/Fundraising FAQ/Translation , 15 21 Wikimania 2008/Bids/Alexandria/Volunteers , 16 21 OTRS/Volunteering , 17 21 Steward requests/Checkuser , 18 20 Fundraising 2007/Landing page/Translations , 19 18 Wikimedia Forum , 20 18 Toolserver/New accounts , 21 17 OTRS/Personnel , 22 17 List of Wikipedias , 23 16 Steward requests/Username changes , 24 16 Wikimedia chapters , 25 14 Ignore all rules

Nov 2007: 1 189 Stewards/elections 2007/statements/Aphaia , 2 131 Stewards/elections 2007/statements/Lar , 3 130 Stewards/elections 2007/statements/DerHexer , 4 125 Stewards/elections 2007/statements/Dmcdevit , 5 119 Stewards/elections 2007/statements/.anaconda , 6 109 Stewards/elections 2007/statements/Majorly , 7 105 Steward requests/Permissions , 8 104 Stewards/elections 2007/statements/Thogo , 9 92 Stewards/elections 2007/statements/Nick1915 , 10 87 Stewards/elections 2007/statements/Spacebirdy , 11 85 Proposals for closing projects/Closure of Lombard Wikipedia , 12 84 Stewards/elections 2007/statements/Wpedzich , 13 84 Fundraising 2007/Text for sitenotice , 14 81 Stewards/elections 2007/statements/Dungodung , 15 69 Stewards/elections 2007/statements/Andre Engels , 16 68 Stewards/confirm/2009/mul , 17 66 Stewards/elections 2007/statements/Jusjih , 18 64 Stewards/elections 2007/statements/Fabexplosive , 19 63 Wikimedia Forum , 20 63 Stewards/elections 2007/statements/.snoopy. , 21 61 Stewards/elections 2007/statements/Hillgentleman , 22 59 Stewards/elections 2007/statements/Bèrto 'd Sèra , 23 56 Stewards/elections 2007/statements/Millosh , 24 54 Stewards/elections 2007/statements/Zirland , 25 48 Stewards/elections 2007

Dec 2007: 1 113 Stewards/elections 2007/statements/Dmcdevit , 2 93 Stewards/elections 2007/statements/Lar , 3 90 Stewards/elections 2007/statements/DerHexer , 4 83 Steward requests/Permissions , 5 74 Proposals for closing projects/Radical cleanup of Volapük Wikipedia , 6 68 Stewards/elections 2007/statements/Majorly , 7 64 Proposals for closing projects/Closure of Lombard Wikipedia , 8 63 Stewards/confirm/2009/mul , 9 59 Stewards/elections 2007/statements/Nick1915 , 10 53 Stewards/elections 2007/statements/Thogo , 11 53 Stewards/elections 2007/statements/.anaconda , 12 44 Stewards/elections 2007/statements/Millosh , 13 43 Stewards/elections 2007/statements/Spacebirdy , 14 43 Stewards/elections 2007/statements/Andre Engels , 15 39 Wikimedia Forum , 16 35 Stewards/elections 2007/statements/Edmundwoods , 17 34 Stewards/elections 2007/statements/Dungodung , 18 33 Steward requests/Bot status , 19 30 Stewards/elections 2007/statements/.snoopy. , 20 30 Stewards/elections 2007/statements/Fabexplosive , 21 28 Stewards/elections 2007/statements/Wpedzich , 22 26 Stewards/elections 2007/statements/Jusjih , 23 26 Translation of the week/Translation candidates , 24 25 Stewards/elections 2007/statements/Hillgentleman , 25 24 Stewards/elections 2007/statements/Zirland

Jan 2008: 1 110 Steward requests/Permissions , 2 53 Proposals for closing projects/Radical cleanup of Volapük Wikipedia , 3 49 Wikimedia Forum , 4 32 Proposal for Policy on overuse of bots in Wikipedias , 5 30 Fundraising 2007/Text for sitenotice , 6 29 Fundraising 2007/Thank you , 7 29 Steward requests/Bot status , 8 24 Ignore all rules , 9 22 OTRS/Volunteering , 10 22 Requests for new languages , 11 21 Wikimedia News , 12 18 List of Wikipedias/Table , 13 18 Proposals for new projects , 14 17 Toolserver/New accounts , 15 16 Wikimedia Canada/Meetings/2008-01-30 , 16 16 Requests for new languages/Wikipedia Karakalpak 3 , 17 15 Requests for comment/Ramir on Russian Wikibooks , 18 15 Translation of the week/Translation candidates , 19 13 Steward requests/Checkuser , 20 13 Wikimedia chapters , 21 12 Wikimedia Canada/Steering Committee , 22 12 Migration to the new preprocessor , 23 12 Requests for new languages/Wikipedia Gagauz 2 , 24 12 Requests for new languages/Wikinews Hungarian , 25 12 List of Wikipedias

Feb 2008: 1 89 Steward requests/Permissions , 2 46 Requests for new languages/Wikiversity Japanese 2 , 3 44 OTRS/Volunteering , 4 26 Steward requests/Bot status , 5 19 Wikimedia Forum , 6 18 Requests for new languages , 7 17 Ignore all rules , 8 17 Wikimedia News , 9 15 Village stocks , 10 15 Translation of the week/Translation candidates , 11 14 Wiki Wall Photo Contest , 12 14 Steward requests/Checkuser , 13 13 Toolserver/New accounts , 14 12 Translation teams/zh , 15 12 Wikimedia Canada/Meetings/2008-02-06 , 16 12 OTRS/Personnel , 17 11 Wikimania 2009/Bids/Toronto , 18 11 Requests for new languages/Wikinews Hungarian , 19 11 Steward requests/Username changes , 20 11 Wikimania 2009/Bids/Buenos Aires , 21 11 Spam blacklist , 22 11 Wikimedia chapters , 23 10 Wikimedia Foundation elections/Board elections/2008/Committee/en , 24 10 Wikimania 2009/Bids/Toronto/Q&A , 25 10 Wikimania 2009/Bids/Buenos Aires/Q&A

Mar 2008: 1 93 Steward requests/Permissions , 2 84 Steward requests/SUL requests , 3 59 OTRS/Volunteering , 4 31 Steward requests/Bot status , 5 28 Wikibooks/Logo/Archive 7 , 6 27 Steward requests/Username changes , 7 25 Ignore all rules , 8 22 Wikimedia São Paulo/Interessados , 9 22 Toolserver/New accounts , 10 22 Non-free content , 11 21 Translation requests/Wikimania/Sitenotice 2008 , 12 20 Request for an account on the Foundation wiki , 13 20 Wikimedia chapters , 14 18 Proposals for closing projects/Closure of Tatar Wikipedia , 15 18 Wikimedia Australia/Incorporation , 16 17 Mutirões pelo Conhecimento Livre/Participantes , 17 17 Unified login , 18 17 Translation of the week/Translation candidates , 19 16 OTRS/Personnel , 20 16 Wikimedia News , 21 15 Steward requests/SUL requests/2008-03 , 22 15 Top Ten Wikipedias , 23 15 Steward requests/Checkuser , 24 14 Requests for comment/-jkb- , 25 12 Requests for new languages/Wikipedia Silesian

Apr 2008: 1 91 Steward requests/Permissions , 2 69 Steward requests/SUL requests , 3 39 Community petition/sign , 4 37 Community petition , 5 34 OTRS/Volunteering , 6 32 Wikibooks/Logo/Archive 7 , 7 29 Steward requests/Username changes , 8 28 Requests for new languages , 9 26 Wikimedia News , 10 24 Steward requests/Bot status , 11 23 Wikimedia Foundation elections/Board elections/2008/Translation , 12 23 Steward requests/Checkuser , 13 22 Wikimedia Forum , 14 21 Requests for new languages/Wikipedia Egyptian Arabic , 15 21 Translation requests/Wikimania/Sitenotice 2008 , 16 21 OTRS/Personnel , 17 20 Translation of the week/Translation candidates , 18 19 Toolserver/New accounts , 19 18 Wikimedia chapters , 20 17 Requests for new languages/Wikiversity Czech , 21 17 Spam blacklist , 22 14 Communication Projects Group/Membership/Roll-call , 23 14 Wikimedia Australia , 24 13 Wikijunior/Logo/Archive 2 , 25 13 Top Ten Wikipedias

May 2008: 1 144 Steward requests/SUL requests , 2 103 Steward requests/Permissions , 3 60 Community petition/sign , 4 50 Wikimedia Foundation elections/Board elections/2008/Translation , 5 45 OTRS/Volunteering , 6 44 Steward requests/Bot status , 7 41 Wikimedia Foundation elections/Board elections/2008/Candidates/Questions , 8 34 Steward requests/Checkuser , 9 29 Proposals for closing projects/Closure of Beta Wikiversity , 10 26 Wikimedia Forum , 11 23 Proposals for closing projects/Closure of Incubator Wikimedia , 12 22 Steward requests/Username changes , 13 21 Wikimedia Foundation elections/Board elections/2008/Candidates/Questions/2 , 14 21 Wikimedia Foundation elections/Board elections/2008/Candidates/Submissions , 15 20 Wikibooks/Logo/Proposal/D , 16 18 List of Wikipedias/Table , 17 18 Wikimedia chapters , 18 17 Translation of the week/Translation candidates , 19 14 Wikimedia News , 20 13 Wikimedia Foundation elections/Board elections/2008/Candidates/ru , 21 13 Chapter-selected Board seats , 22 12 Translation requests/Wikimania/Sitenotice 2008 , 23 12 Translation of the week/2008 translations/Archive , 24 12 Unified login , 25 12 Toolserver/New accounts

Jun 2008: 1 458 Wikimedia Forum , 2 219 Steward requests/SUL requests , 3 91 Steward requests/Permissions , 4 56 OTRS/Volunteering , 5 43 Steward requests/Bot status , 6 28 Wikimedia Foundation elections/Board elections/2008/Candidates/Questions/3 , 7 27 Steward requests/Checkuser , 8 25 Requests for new languages/Wikipedia Moldavian-Romanian , 9 24 Wikimedia Foundation elections/Board elections/2008/Candidates/Questions/2 , 10 23 Wikimedia Foundation nomail list , 11 23 Steward requests/Username changes , 12 22 Steward requests/SUL requests/Bug 14330 , 13 22 Global sysops/2008 proposal , 14 22 Wikimedia Foundation elections/Board elections/2008/Translation , 15 18 Proposals for closing projects/Closure of Incubator Wikimedia , 16 17 Proposals for closing projects/Closure of Beta Wikiversity , 17 17 Wikimedia News , 18 16 Wikibooks/Logo/Proposal/D , 19 15 Ignore all rules , 20 15 OTRS/Personnel , 21 14 Foundation wiki feedback , 22 14 Steward requests/Permissions/Approved temporary , 23 13 Mutirões pelo Conhecimento Livre/Participantes , 24 13 List of Wikipedias/Table , 25 13 Vandalism reports

Jul 2008: 1 411 Top Ten Wikipedias/poll , 2 123 Steward requests/Permissions , 3 103 Steward requests/SUL requests , 4 51 Wikimania 2010/Bids/Copenhagen , 5 50 Wikimedia Forum , 6 31 Steward requests/Checkuser , 7 30 Steward requests/Bot status , 8 29 IRC/Group Contacts/Meetings/July 2008 , 9 27 OTRS/Volunteering , 10 27 Toolserver/New accounts , 11 22 Steward requests/Username changes , 12 20 List of Wikipedias/Table , 13 19 Translation of the week/Translation candidates , 14 16 GDJ 2008 , 15 16 IRC/wikipedia-fr/extraits choisis , 16 15 Top Ten Wikipedias , 17 15 Wikimedia News , 18 14 Requests for new languages/Wikipedia Teochew , 19 14 Vandalism reports , 20 12 Ignore all rules , 21 12 Proposals for closing projects/Closure of Beta Wikiversity , 22 12 Translation of the week/2008 translations/Archive , 23 12 OTRS/Personnel , 24 11 Steward requests/Permissions/Approved temporary , 25 11 List of articles every Wikipedia should have

Aug 2008: 1 109 Steward requests/Permissions , 2 62 Wikimedia Forum , 3 51 Steward requests/SUL requests , 4 45 Wikimania 2010/Bids/Copenhagen , 5 44 IRC/Guidelines/Public logging , 6 38 Steward requests/Bot status , 7 35 Steward requests/Checkuser , 8 34 OTRS/Volunteering , 9 28 Request for an account on the Foundation wiki , 10 24 Wikimedia UK , 11 21 Toolserver/New accounts , 12 20 List of Wikipedias/Table , 13 20 Steward requests/Username changes , 14 19 Tell us about your Wikipedia , 15 19 Why Wikimedians edit , 16 19 Translation of the week/Translation candidates , 17 18 Translation of the week/2008 translations/Archive , 18 18 Wikimedia News , 19 17 Wikimania 2010/Bids/Oxford , 20 16 GDJ 2008 , 21 16 Bot policy/Implementation , 22 16 Requests for new languages , 23 16 Steward requests/Miscellaneous , 24 15 Steward requests/Global , 25 15 OTRS/Personnel

Sep 2008: 1 96 Steward requests/Permissions , 2 90 Wikimedia Forum , 3 66 Wikimedia Forum/On disbanding Wikiquote , 4 58 OTRS/Volunteering , 5 41 Wikimedia UK , 6 41 IRC/Guidelines/Public logging , 7 41 Steward requests/SUL requests , 8 38 GDJ 2008 , 9 30 Steward requests/Checkuser , 10 30 Steward requests/Bot status , 11 27 Requests for comment/Poetlister and Cato , 12 22 Tell us about Italian Wikipedia , 13 22 Wikimedia News , 14 21 Why Wikimedians edit , 15 19 Requests for comment/Lombard wikipedia, urgent desysoping and unblock requests , 16 19 Wikimedia chapters , 17 18 List of Wikipedias/Table , 18 17 Toolserver/New accounts , 19 17 OTRS/Personnel , 20 16 Translation of the week/Translation candidates , 21 14 Wikimedia UK v2.0/Candidate statements , 22 14 Steward requests/Global , 23 13 Wikimania 2010/Bids/Copenhagen , 24 13 Steward requests/Username changes , 25 13 Planet Wikimedia

Oct 2008: 1 70 Steward requests/Permissions , 2 55 Mutirões pelo Conhecimento Livre/Projetos/WikiBrasil/Inscrição , 3 47 Wikimedia Forum , 4 45 Steward requests/SUL requests , 5 41 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 6 37 Steward requests/Global , 7 37 Steward requests/Bot status , 8 31 Mutirões pelo Conhecimento Livre/Participantes , 9 28 OTRS/Volunteering , 10 19 Arbitration Committee/Election processes , 11 19 Toolserver/New accounts , 12 18 Steward requests/Checkuser , 13 18 Translation of the week/Translation candidates , 14 18 Wikimedia chapters , 15 18 Wikimedia News , 16 17 Translation of the week/2008 translations/Archive , 17 14 IRC/wikipedia/Guidelines/Public logging/Roll call , 18 14 Wikimania 2010/Bids/Amsterdam , 19 14 List of Wikipedias/Table , 20 14 Steward requests/Username changes , 21 14 Proposals for new projects , 22 13 Why Wikimedians edit , 23 12 Requests for new languages/Wikipedia Xiang , 24 11 Requests for comment/Sysop abuse on Greek Wikipedia , 25 11 Requests for comment/Lombard wikipedia, urgent desysoping and unblock requests

Nov 2008: 1 287 Wikibooks/Logo/Archive 8 , 2 81 Steward requests/Permissions , 3 62 Wikimedia Forum , 4 49 Translation requests/quick translation , 5 47 Mutirões pelo Conhecimento Livre/Participantes , 6 34 OTRS/Volunteering , 7 34 Steward requests/Checkuser , 8 29 Requests for comment/Canopus Kilya Blocking , 9 28 Steward requests/SUL requests , 10 27 Steward requests/Global , 11 27 Wikimedia News , 12 23 Steward requests/Bot status , 13 22 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 14 21 Toolserver/New accounts , 15 19 Wikimedia UK v2.0/Newsletter/Subscribers , 16 18 List of Wikipedias/Table , 17 17 Proposals for closing projects/Closure of Simple English Wiktionary (2) , 18 17 Translation of the week/Translation candidates , 19 17 Proposals for new projects , 20 15 Translation of the week/2008 translations/Archive , 21 14 Synchbot , 22 14 Wikimedia chapters , 23 13 Wikivoices/ACE2008 Special , 24 13 Mutirões pelo Conhecimento Livre/Projetos/WikiBrasil/Inscrição , 25 13 Request for an account on the Foundation wiki

Dec 2008: 1 92 Steward requests/Permissions , 2 72 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 3 57 Wikibooks/Logo/Archive 9 , 4 53 Wikibooks/Logo/Archive 10 , 5 49 Wikimedia Forum , 6 31 Steward requests/Checkuser , 7 28 Steward requests/Bot status , 8 22 List of Wikipedias/Table , 9 21 OTRS/Volunteering , 10 19 Foundation wiki feedback , 11 19 Steward requests/SUL requests , 12 18 Proposals for closing projects/Closure of Simple English Wiktionary (2) , 13 17 Steward requests/Global , 14 17 Mutirões pelo Conhecimento Livre/Participantes , 15 17 Wikimedia News , 16 16 Toolserver/New accounts , 17 16 OTRS/Personnel , 18 14 Fundraising 2008/appeal/ru , 19 14 Proposals for new projects , 20 13 Requests for comment/Canopus Kilya Blocking , 21 13 IRC/wikipedia-en-admins/Policy ratification , 22 12 Requests for new languages/Wikipedia Mandarin , 23 12 FLOSS-Exchange , 24 12 Translation of the week/Translation candidates , 25 11 Licensing update/Questions and Answers

Jan 2009: 1 167 Stewards/elections 2009 , 2 106 Stewards/elections 2009/Translation/CentralNotice , 3 90 Steward requests/Permissions , 4 74 Stewards/elections 2009/Introduction , 5 40 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 6 40 Wikimedia Forum , 7 36 Steward requests/Bot status , 8 32 Stewards/confirm/2009/mul , 9 31 Wikibooks/Logo/Archive 10 , 10 30 Wikimedia chapters , 11 28 Steward requests/Checkuser , 12 24 Wishes 2009 , 13 24 Steward requests/SUL requests , 14 22 Stewards/elections 2009/statements/Alexanderps , 15 22 OTRS/Volunteering , 16 22 Translation of the week/Translation candidates , 17 21 Stewards/elections 2009/statements/Cometstyles , 18 21 Stewards/elections 2009/statements/EVula , 19 21 Stewards/elections 2009/statements/Meno25 , 20 21 Steward requests/Global , 21 20 Translation of the week/2009 translations , 22 19 Stewards/elections 2009/statements/Mike.lifeguard , 23 18 Restoration.wikimedia.org , 24 18 Wikimania 2010/Bids/Amsterdam , 25 18 Toolserver/New accounts

Feb 2009: 1 305 Stewards/elections 2009/statements/Mardetanha , 2 303 Stewards/elections 2009/statements/Mike.lifeguard , 3 228 Stewards/elections 2009/statements/putnik , 4 227 Stewards/elections 2009/statements/Kylu , 5 221 Stewards/elections 2009/statements/Erwin , 6 211 Stewards/elections 2009/statements/Avraham , 7 206 Stewards/elections 2009/statements/Dorgan , 8 190 Stewards/elections 2009/statements/Alexanderps , 9 176 Stewards/elections 2009/statements/Al Lemos , 10 176 Stewards/elections 2009/statements/EVula , 11 175 Stewards/elections 2009/statements/Meno25 , 12 173 Stewards/elections 2009/statements/Leinad , 13 161 Stewards/elections 2009/statements/Fabexplosive , 14 151 Stewards/elections 2009/statements/SpeedyGonsales , 15 143 Stewards/elections 2009/statements/Cometstyles , 16 139 Stewards/elections 2009/statements/Apteva , 17 137 Stewards/elections 2009/statements/Laaknor , 18 117 Stewards/elections 2009/statements/PhiLiP , 19 113 Stewards/elections 2009/statements/avjoska , 20 107 Stewards/elections 2009/statements/Mywood , 21 106 Stewards/elections 2009/statements/Jredmond , 22 101 Steward requests/Permissions , 23 88 Wikimedia Forum , 24 85 Stewards/elections 2009/statements/Fadesga , 25 78 Stewards/elections 2009/statements/Loco085

Mar 2009: 1 166 Wikimania 2009/CentralNotice , 2 102 Steward requests/Permissions , 3 76 Wikimania 2010/Bids/Gdańsk , 4 61 Licensing update/CentralNotice , 5 39 Steward requests/Bot status , 6 38 Wikimedia Forum , 7 32 Wikimania 2010/Bids/Amsterdam , 8 30 Steward requests/Global , 9 26 Toolserver/New accounts , 10 25 OTRS/Volunteering , 11 23 Licensing update/Options and suffrage , 12 23 Amical Wikimedia/Members and Supporters , 13 23 Wikimedia Danmark , 14 22 Wiktionary/logo/refresh , 15 21 Steward requests/SUL requests , 16 20 Wikimania 2010/Bids/Oxford , 17 19 Steward requests/Checkuser , 18 18 Wikimedia chapters , 19 17 List of Wikipedias/Table , 20 17 Wikimedia News , 21 16 Foundation wiki feedback , 22 16 Chapters meeting 2009/Committees , 23 15 Book tool/Feedback , 24 15 Steward requests/Permissions/2009-03 , 25 14 Proposals for closing projects/Closure of Simple English Wikipedia (2)

Apr 2009: 1 144 Licensing update/CentralNotice , 2 132 Wikimania 2009/CentralNotice , 3 86 Steward requests/Permissions , 4 79 April 2009 Wikimedia Conference/Pictures , 5 59 Proposals for closing projects/Closure of English Wikipedia , 6 56 Wiktionary/logo/refresh , 7 56 Wikimedia Forum , 8 52 Licensing update/Options and suffrage , 9 44 OTRS/Volunteering , 10 41 Licensing update/Header and jump text , 11 37 Steward requests/Checkuser , 12 30 Steward requests/Bot status , 13 27 Licensing update/Questions and Answers/Oppositional arguments , 14 27 Steward requests/Global , 15 25 Steward requests/SUL requests , 16 24 Licensing update/Header tracking , 17 19 Wikimania 2010/Bids/Gdańsk , 18 18 Requests for new languages/Wikipedia Kurdish (Sorani) , 19 18 Wikimedia chapters , 20 17 Wikimania 2010/Bids/Oxford/Team , 21 16 Toolserver/New accounts , 22 15 Licensing update/Translation , 23 15 Wikimedia News , 24 14 Proposals for closing projects/Closure of Wikimedia Quality , 25 14 OpenStreetMap

May 2009: 1 98 Steward requests/Permissions , 2 94 Licensing update/CentralNotice , 3 52 OTRS/Volunteering , 4 39 Wikimedia Forum , 5 35 Wiktionary/logo/refresh/proposals , 6 28 Steward requests/Checkuser , 7 26 Steward requests/Bot status , 8 21 Steward requests/Global , 9 19 Wiktionary/logo/refresh , 10 17 Steward requests/SUL requests , 11 16 Licensing update/Result , 12 16 Wikimedia News , 13 15 Huggle/Wine , 14 15 List of Wikipedias/Table , 15 14 Licensing update/Result/es , 16 14 Planet Wikimedia , 17 14 Translation of the week/Translation candidates , 18 13 Викимедија Македонија , 19 12 Licensing update/Result/de , 20 12 Spam blacklist/Log/2009/05 , 21 12 Licensing update , 22 12 Spam blacklist , 23 11 Licensing update/Outreach , 24 11 Toolserver/New accounts , 25 11 Wikimedia chapters

Jun 2009: 1 75 Steward requests/Permissions , 2 58 Wiktionary/logo/refresh/proposals , 3 45 Fundraising 2009/Donation buttons upgrade/Round1 , 4 40 Steward requests/Checkuser , 5 32 Steward requests/Bot status , 6 29 Wikimedia Forum , 7 28 OTRS/Volunteering , 8 23 Wikimedia News , 9 21 Requests for new languages/Wikisource Georgian , 10 20 Steward requests/Global , 11 17 Translation of the week/Translation candidates , 12 14 List of Wikipedias/Table , 13 14 Toolserver/New accounts , 14 13 Wikimedia Foundation elections/Board elections/2009/Translation , 15 13 Wikimedia Conference Japan 2009 , 16 13 Steward requests/Username changes , 17 13 OTRS/Personnel , 18 12 Foundation wiki feedback , 19 11 Free Travel-Shirt/White T-Shirt , 20 11 Steward requests/SUL requests , 21 11 Steward requests/Permissions/Approved temporary , 22 10 Steward requests/Permissions/2009-06 , 23 10 Translation of the week/2009 translations , 24 10 Spam blacklist , 25 9 IRC/wikipedia-fr/extraits choisis/signatures

Jul 2009: 1 128 Wikimedia Foundation elections/Board elections/2009/Translation , 2 93 Steward requests/Permissions , 3 89 Wikimedia Foundation elections/Board elections/2009/CentralNotice , 4 58 Wiktionary/logo/refresh/proposals , 5 55 Wikimedia Foundation elections/Board elections/2009/Candidates/en , 6 46 Proposals for closing projects/Closure of Dutch Wikinews , 7 40 Wikimedia Forum , 8 38 Wikimedia Foundation elections/Board elections/2009/Candidates/Questions/1 , 9 38 Steward requests/Global , 10 35 CentralNotice/Downtime , 11 35 Proposals for closing projects/Closure of Simple English Wikibooks (3) , 12 31 Wikimedia Foundation elections/Board elections/2009/Candidates/es , 13 26 IRC/Group Contacts/Meetings/August 2009 , 14 24 Fundraising 2009/Donation buttons upgrade/Round1 , 15 23 Wikimedia Foundation elections/Board elections/2009/Candidates/de , 16 23 Steward requests/Checkuser , 17 23 Steward requests/Bot status , 18 20 OTRS/Personnel , 19 19 GDJ 2009 , 20 18 Wikimedia Foundation elections/Board elections/2009/Candidates/fr , 21 18 OTRS/Volunteering , 22 17 Steward requests/SUL requests , 23 17 Wikimedia chapters , 24 16 Wikimedia Foundation elections/Board elections/2009/Candidates/ru , 25 15 Wikimedia Foundation elections/Board elections/2009/Candidates/it

Aug 2009: 1 122 Steward requests/Permissions , 2 94 CentralNotice/Strategic Planning , 3 83 Wikimania 2009/CentralNotice , 4 67 Wikimedia Foundation nomail list , 5 38 Wikimedia Forum , 6 33 GDJ 2009 , 7 31 OTRS/Volunteering , 8 28 Wiktionary/logo/refresh , 9 26 Wikimedia Foundation elections/Board elections/2009/Translation , 10 25 Wiktionary/logo/refresh/proposals , 11 22 Steward requests/SUL requests , 12 22 Wikimedia News , 13 21 Steward requests/Checkuser , 14 21 Steward requests/Bot status , 15 18 Wikimedia Belgium/Members , 16 17 Public speakers , 17 16 Wikimedia Foundation elections/Board elections/2009/Candidates/Questions/2 , 18 16 Proposals for closing projects/Closure of Dutch Wikinews , 19 14 Interwiki synchronization/Open source vs Open source software , 20 14 CentralNotice/Downtime , 21 13 IRC/Group Contacts/Meetings/August 2009 , 22 13 Wikimedia Foundation elections/Board elections/2009/Candidates/Questions/1 , 23 13 Proposals for closing projects/Closure of Simple English Wikibooks (3) , 24 13 Translation of the week/2009 translations , 25 12 Foundation wiki feedback

Sep 2009: 1 105 Steward requests/Permissions , 2 32 Wiktionary/logo/refresh , 3 32 Steward requests/Global , 4 32 Steward requests/Bot status , 5 28 GDJ 2009 , 6 28 Wikimedia Forum , 7 28 OTRS/Volunteering , 8 25 Steward requests/Checkuser , 9 22 Wikimedia News , 10 20 Public speakers , 11 19 Improving Foundation-l , 12 15 Steward requests/SUL requests , 13 15 List of Wikipedias/Table , 14 15 Translation of the week/Translation candidates , 15 13 Wikimedia chapters , 16 12 Translation of the week/2009 translations , 17 11 Synchbot , 18 11 IRC/Channels , 19 10 Foundation wiki feedback , 20 10 Proposals for new projects , 21 9 Steward requests/Permissions/2009-09 , 22 9 Bot policy/Implementation , 23 9 OTRS/Personnel , 24 9 Editing , 25 8 Spam blacklist/Log/2009/09

Oct 2009: 1 106 Steward requests/Permissions , 2 41 Proposals for closing projects/Closure of Simple English Wikiquote (3) , 3 41 Steward requests/Global , 4 37 OTRS/Volunteering , 5 28 Multimedia Usability Project Meeting France/Members , 6 25 Steward requests/Bot status , 7 22 Steward requests/Checkuser , 8 19 IRC/wikimedia-admin/User list , 9 18 CentralNotice/Global sysops , 10 18 OTRS/Personnel , 11 17 Wiktionary/logo/refresh , 12 17 Steward requests/SUL requests , 13 16 Wikimedia News , 14 14 Fundraising 2009/core messages/ru , 15 14 Proposals for closing projects/Closure of Simple English Wikibooks (3) , 16 14 Translation of the week/2009 translations , 17 14 Wikimedia Forum , 18 14 List of Wikipedias/Table , 19 14 Translation of the week/Translation candidates , 20 13 Multimedia Usability Project Meeting France/Schedule , 21 13 Request for an account on the Foundation wiki , 22 11 Steward requests/Username changes , 23 10 Foundation wiki feedback , 24 10 Mutirões pelo Conhecimento Livre/Mutirões/Planejamento Estratégico/Sesc Pompéia , 25 10 Steward requests/Permissions/2009-10

Nov 2009: 1 102 Steward requests/Permissions , 2 89 Fundraising 2009/Launch Feedback , 3 79 Fundraising 2009/Alternative banners , 4 49 Amical Wikimedia/Members and Supporters , 5 34 Steward requests/Checkuser , 6 31 Steward requests/Global , 7 25 Wikimedia Forum , 8 25 Steward requests/SUL requests , 9 23 Foundation wiki feedback , 10 21 Proposals for closing projects/Closure of Simple English Wikiquote (3) , 11 18 Wiktionary/logo/refresh , 12 18 Steward requests/Bot status , 13 18 Wikimedia News , 14 17 Translation of the week/Translation candidates , 15 16 List of Wikipedias/Table , 16 15 Improving Foundation-l , 17 12 Translation of the week/2009 translations , 18 12 Request for an account on the Foundation wiki , 19 12 OTRS/Volunteering , 20 11 Fundraising 2009/core messages/de , 21 10 Free Travel-Shirt/White T-Shirt , 22 10 Steward requests/Username changes , 23 9 Spam blacklist/Log/2009/11 , 24 9 Spam blacklist , 25 9 Proposals for new projects

Dec 2009: 1 484 Wiktionary/logo/refresh/voting/tally , 2 110 Steward requests/Permissions , 3 59 Fundraising 2009/Launch Feedback , 4 37 Foundation wiki feedback , 5 29 Steward requests/Global , 6 28 Translation of the week/Translation candidates , 7 26 Amical Wikimedia/Members and Supporters , 8 26 OTRS/Volunteering , 9 23 Steward requests/Checkuser , 10 21 Steward requests/SUL requests , 11 21 Wikimedia España , 12 19 Wiktionary/logo/refresh/voting , 13 19 Wikimedia Forum , 14 19 Steward requests/Bot status , 15 16 Wikimedia News , 16 14 Fundraising 2009/appeal/fr , 17 14 List of Wikipedias/Table , 18 12 Steward requests/Username changes , 19 11 List of Wikimedians by birthday , 20 10 Spam blacklist/Log/2009/12 , 21 10 Museums and the Web 2010 , 22 10 Spam blacklist , 23 9 Steward requests/Permissions/2009-12 , 24 9 Translation of the week/2009 translations , 25 9 Proposals for closing projects/Closure of Ndonga Wikipedia

Jan 2010: 1 2145 Global sysops/Vote , 2 571 Wiktionary/logo/refresh/voting/tally1 , 3 461 Wiktionary/logo/refresh/voting/tally2 , 4 119 CentralNotice/Global sysops , 5 107 Steward requests/Permissions , 6 84 Stewards/elections 2010/Questions , 7 59 Global sysops/Vote/Introduction , 8 52 Stewards/elections 2010 , 9 48 Steward requests/Global , 10 46 CentralNotice/Wiktionary logo vote , 11 41 Stewards/elections 2010/Introduction , 12 38 Stewards/elections 2010/statements , 13 38 Translation of the week/Translation candidates , 14 31 Steward requests/Checkuser , 15 29 Synchbot , 16 26 CentralNotice/Strategic Planning , 17 26 OTRS/Volunteering , 18 25 Steward requests/SUL requests , 19 24 Wikimedia Forum , 20 22 Fundraising 2009/Launch Feedback , 21 21 Requests for new languages/MediaWiki Russian , 22 19 Stewards/elections 2010/Translation/CentralNotice , 23 18 Stewards/elections 2010/Entirety , 24 18 Wikimedia News , 25 17 Steward requests/Username changes

Feb 2010: 1 306 Stewards/elections 2010/votes/J.delanoy , 2 251 Stewards/elections 2010/votes/Dferg , 3 249 Stewards/elections 2010/votes/Avraham , 4 240 Stewards/elections 2010/votes/Wutsje , 5 210 Stewards/elections 2010/votes/Annabel , 6 188 Stewards/elections 2010/votes/Thekohser , 7 185 Stewards/elections 2010/votes/Mercy , 8 185 Stewards/elections 2010/votes/Melos , 9 169 Stewards/elections 2010/votes/Mentifisto , 10 150 Stewards/confirm/2010/Lar , 11 145 Stewards/elections 2010/votes/Billinghurst , 12 136 Stewards/elections 2010/votes/EivindJ , 13 131 Stewards/elections 2010/votes/Sir Lestaty de Lioncourt , 14 127 Stewards/elections 2010/votes/Jyothis , 15 120 Stewards/elections 2010/votes/Jamesofur , 16 105 Stewards/elections 2010/votes/Bletilla , 17 104 Stewards/elections 2010/votes/Carkuni , 18 103 Stewards/elections 2010/votes/Fail , 19 96 Stewards/confirm/2010/DerHexer , 20 86 Stewards/confirm/2010/Pathoschild , 21 86 Stewards/elections 2010/votes/Evalowyn , 22 84 Stewards/elections 2010/votes/Razorflame , 23 84 Steward requests/Permissions , 24 82 Stewards/elections 2010/votes/Damërung , 25 81 Stewards/elections 2010/votes/Krinkle

Mar 2010: 1 96 Steward requests/Permissions , 2 92 Steward requests/Global , 3 86 Steward requests/Global permissions , 4 85 Wikimania 2010/CentralNotice , 5 66 Requests for comment/Remove Founder flag , 6 44 Steward requests/Checkuser , 7 31 OTRS/Volunteering , 8 31 Steward requests/Bot status , 9 30 Wikimedia Forum , 10 29 Wikimedia Conference 2010/Developers' Workshop/Attendees , 11 24 List of Wikipedias/Table , 12 23 Requests for comment/Croatian Wikipedia-misuse of admin tools by User:Kubura , 13 23 Requests for new languages/Wikipedia Montenegrin 3 , 14 22 Steward requests/SUL requests , 15 22 Wikimedia News , 16 18 Translation of the week/Translation candidates , 17 17 Chapters meeting 2010/Brainstorming , 18 16 Wikimania 2011/Bids/Haifa , 19 15 Wikimedia Conference 2010/Developers' Workshop/Topic brainstorms , 20 15 Translation of the week/2010 translations/Archive , 21 13 Steward requests/Miscellaneous , 22 11 Foundation wiki feedback , 23 11 Wikimedia chapters , 24 10 Spam blacklist/Log/2010/03 , 25 10 Spam blacklist

Apr 2010: 1 94 Wikimania 2010/CentralNotice , 2 76 Steward requests/Permissions , 3 62 Requests for comment/Shut down Wikiversity , 4 59 Proposals for closing projects/Closure of French Wikipedia , 5 48 Wikimedia Forum , 6 38 Steward requests/Checkuser , 7 36 Wikimedia España/Votaciones 2010 , 8 32 Chapters meeting 2010/Participants , 9 29 OTRS/Volunteering , 10 24 Steward requests/Global permissions , 11 24 Translation of the week/Translation candidates , 12 23 Steward requests/Username changes , 13 22 Steward requests/Global , 14 19 Steward requests/SUL requests , 15 18 Chapters meeting 2010/Schedule , 16 18 Steward requests/Bot status , 17 18 Wikimedia News , 18 16 Wikimedia chapters , 19 15 Spam blacklist/Log/2010/04 , 20 15 Requests for comment/Remove Founder flag , 21 15 Spam blacklist , 22 14 Wikimedia España , 23 12 Vector , 24 12 List of Wikipedias/Table , 25 11 Wikimedia España/Votaciones 2010/Alegaciones

May 2010: 1 493 Requests for comment/Remove Founder flag , 2 368 Petition to Jimbo , 3 109 Steward requests/Permissions , 4 71 Wikimania 2010/CentralNotice , 5 51 Wikimedia Forum , 6 42 Steward requests/Global permissions , 7 40 Requests for comment/Restore Founder flag , 8 24 Steward requests/SUL requests , 9 23 Steward requests/Global , 10 21 OTRS/Volunteering , 11 21 Steward requests/Checkuser , 12 19 Steward requests/Bot status , 13 19 Translation of the week/Translation candidates , 14 17 Wikimedia España , 15 17 Wikimedia News , 16 13 Translation of the week/2010 translations/Archive , 17 13 Wikimedia chapters , 18 11 Stewards' noticeboard , 19 11 Amical Wikimedia/Members and Supporters , 20 10 Foundation wiki feedback , 21 10 Wikimedia California , 22 10 Steward requests/Username changes , 23 10 Public speakers , 24 10 Spam blacklist , 25 9 Spam blacklist/Log/2010/05

Jun 2010: 1 118 Amical Wikimedia/Members and Supporters , 2 101 Steward requests/Permissions , 3 54 Proposals for closing projects/Closure of Samogitian Wikipedia , 4 41 Wikimania Chapter Gathering , 5 31 Steward requests/Global permissions , 6 26 Steward requests/SUL requests , 7 23 Wikimedia Forum , 8 22 Wikimedia News , 9 20 OTRS/Volunteering , 10 19 Steward requests/Username changes , 11 17 Steward requests/Checkuser , 12 16 Synchbot , 13 16 Translation of the week/Translation candidates , 14 15 Steward requests/Global , 15 15 Steward requests/Bot status , 16 14 Meetup/London/34 , 17 14 Foundation wiki feedback , 18 14 Wikimedia chapters , 19 13 2010 Wikimedia design and feature change/Feedback , 20 12 Meetup/Montréal/2 , 21 12 Vandalism reports , 22 12 Requests for new languages , 23 11 2010 Wikimedia design and feature change/Bug reports , 24 11 Requests for new languages/Wikipedia Simple German 3 , 25 11 Proposals for closing projects/Closure of Fulan Wikipedia

Jul 2010: 1 93 CentralNotice/Work at Wikimedia , 2 73 Steward requests/Permissions , 3 58 Steward requests/Global permissions , 4 52 Requests for comment/ace.wikipedia and Prophet Muhammad images , 5 36 Steward requests/Global , 6 33 OTRS/Volunteering , 7 30 Wikimedia Forum , 8 29 Amical Wikimedia/Members and Supporters , 9 29 Steward requests/Checkuser , 10 28 Fundraising 2010/Committee , 11 28 Steward requests/SUL requests , 12 21 Requests for new languages/Wikipedia Banjar , 13 19 Steward requests/Username changes , 14 18 2010 Wikimedia design and feature change/Feedback , 15 18 Wikimedia News , 16 16 Requests for comment/Locally indef-blocked global sysops , 17 16 Proposals for closing projects/Closure of Samogitian Wikipedia , 18 15 Foundation wiki feedback , 19 15 Requests for new languages/Wikinews Korean , 20 14 Steward requests/Bot status , 21 14 Translation of the week/Translation candidates , 22 13 Proposals for closing projects/Closure of Acehnese Wikipedia , 23 13 Requests for comment/Prophet Muhammad images around Wikimedia projects , 24 13 List of Wikipedias/Table , 25 10 Requests for comment/Global arbitration and dispute resolution

Aug 2010: 1 80 Steward requests/Permissions , 2 68 Requests for comment/Global banners , 3 57 MaxMindCityTesting , 4 43 Steward requests/Global permissions , 5 43 Steward requests/Global , 6 40 CentralNotice/Usability Initiative , 7 37 Amical Wikimedia/Members and Supporters , 8 35 Steward requests/Bot status , 9 32 OTRS/Volunteering , 10 28 Fundraising 2010/Messages , 11 27 Steward requests/SUL requests , 12 27 Wikimedia News , 13 26 Steward requests/Checkuser , 14 25 Wikimedia Forum , 15 24 Sabat , 16 21 CentralNotice/Work at Wikimedia , 17 21 Foundation wiki feedback , 18 20 Wikimedia chapters , 19 17 Translation of the week/Translation candidates , 20 16 Fundraising 2010/Committee , 21 16 Steward requests/Miscellaneous , 22 15 GDJ 2010/Lista uczestników , 23 14 Steward requests/Username changes , 24 12 Wikimedia Foundation contractors , 25 11 Wikimedia South Africa

Sep 2010: 1 88 Fundraising 2010/Messages/New , 2 71 Steward requests/Permissions , 3 40 Steward requests/Checkuser , 4 35 Steward requests/Global permissions , 5 33 Wikimedia Forum , 6 26 Fundraising 2010/Messages/Funny , 7 26 OTRS/Volunteering , 8 25 Global message delivery/Targets/Signpost , 9 23 Wikimedia chapters , 10 22 Fundraising 2010/Messages/Language , 11 20 Fundraising 2010/Messages/Language/fr , 12 20 Steward requests/Global , 13 20 Steward requests/Bot status , 14 19 GDJ 2010/Lista uczestników , 15 17 Sabat , 16 17 Translation of the week/Translation candidates , 17 15 Fundraising 2010/Messages/Project specific , 18 15 Requests for comment/fi.wikipedia and community action missing in problem solving , 19 15 Wikimedia News , 20 14 Fundraising 2010/Messages , 21 13 Fundraising 2010/Messages/Language/de , 22 12 Fundraising 2010/Committee , 23 12 Meetup/London/37 , 24 12 Amical Wikimedia/Members and Supporters , 25 11 Fundraising 2010/Messages/Language/ru

Oct 2010: 1 87 Fundraising 2010/Messages/Language/pl , 2 85 Fundraising 2010/Messages/New , 3 82 Steward requests/Permissions , 4 41 Fundraising 2010/Messages/Language/fr , 5 41 Fundraising 2010/Messages/Language/ru , 6 32 Steward requests/Global permissions , 7 24 Wikimedia Forum , 8 23 Steward requests/SUL requests , 9 22 OTRS/Volunteering , 10 22 Translation of the week/Translation candidates , 11 21 Steward requests/Global , 12 21 Steward requests/Bot status , 13 20 Steward requests/Checkuser , 14 19 Wikimedia News , 15 18 Fundraising 2010/Messages/Language/he , 16 18 Fundraising 2010/Messages/Language/it , 17 18 GDJ 2010/Lista uczestników , 18 16 Requests for comment/User:Ottava Rima , 19 16 Fundraising 2010/Messages/BeatJimmy , 20 16 Meetup/London/38 , 21 15 Proposals for closing projects/Closure of Korean Wikinews , 22 13 Foundation wiki feedback , 23 13 Request for an account on the Foundation wiki , 24 12 List of Wikipedias/Table , 25 12 List of Wikipedias

Nov 2010: 1 114 Steward requests/Permissions , 2 111 Amical Wikimedia/en/Survey , 3 40 Fundraising 2010/Graphic Banners/Proposals , 4 37 Foundation wiki feedback , 5 36 Wikimedia Forum , 6 35 Steward requests/Global permissions , 7 31 Steward requests/Checkuser , 8 30 Steward requests/Global , 9 30 Steward requests/Bot status , 10 27 OTRS/Volunteering , 11 24 Fundraising 2010/Messages/New , 12 23 Proposals for closing projects/Closure of Hungarian Wikinews , 13 23 Translation of the week/Translation candidates , 14 20 Steward requests/SUL requests , 15 20 List of Wikipedias/Table , 16 18 Wikimedia News , 17 17 Fundraising 2010/Write An Appeal , 18 17 OTRS/Personnel , 19 16 Sabat/Lista uczestników , 20 14 Proposals for closing projects/Closure of Norwegian (Nynorsk) Wikipedia , 21 14 Meetup/London/39 , 22 14 Steward requests/Username changes , 23 13 Meetup/London/40 , 24 12 Fundraising 2010/FAQ/it , 25 11 Requests for comment/Chapters. Proposal to give transparency and voice to the communities/Comments against

Dec 2010: 1 89 Steward requests/Permissions , 2 57 Steward requests/Global permissions , 3 46 Wikimedia Forum , 4 37 Steward requests/Global , 5 31 Steward requests/Username changes , 6 29 Steward requests/Checkuser , 7 28 OTRS/Volunteering , 8 28 Steward requests/Bot status , 9 24 Foundation wiki feedback , 10 19 Wikimedia News , 11 16 Amical Wikimedia/Members and Supporters , 12 16 List of Wikipedias/Table , 13 16 Translation of the week/Translation candidates , 14 15 Steward requests/SUL requests , 15 13 Proposals for closing projects/Closure of Kannada Wikiquote , 16 13 Fundraising 2010/Write An Appeal , 17 13 Wikimedia chapters , 18 12 Fundraising 2010/Graphic Banners/Proposals , 19 11 Requests for new languages/Wikinews Sinhala , 20 11 Steward requests/Miscellaneous , 21 10 Requests for comment/Chapters. Proposal to give transparency and voice to the communities/Comments against , 22 10 List of Wikipedias , 23 9 Proposals for closing projects/Closure of Hungarian Wikinews , 24 9 Fundraising 2010/Updates , 25 9 CentralNotice/Log

Jan 2011: 1 105 Wikimania 2011/CentralNotice , 2 97 Steward requests/Permissions , 3 65 Stewards/elections 2011/Questions , 4 59 Steward requests/Checkuser , 5 57 Steward requests/Global permissions , 6 52 Stewards/elections 2011/Translation/CentralNotice , 7 46 Wikimedia Forum , 8 45 Steward requests/Bot status , 9 37 Stewards/elections 2011/Introduction , 10 34 Steward requests/SUL requests , 11 32 Stewards/elections 2011 , 12 30 Stewards/elections 2011/Guidelines , 13 28 Steward requests/Global , 14 28 Steward requests/Username changes , 15 27 Stewards/elections 2011/statements , 16 27 OTRS/Volunteering , 17 24 Wikimedia News , 18 21 Foundation wiki feedback , 19 20 Translation of the week/Translation candidates , 20 19 Stewards/elections 2011/statements/Barras , 21 19 Wikimedia Conference 2011/Participants , 22 18 Stewards/elections 2011/statements/מתניה , 23 18 List of Wikipedias/Table , 24 17 Amical Wikimedia/Members and Supporters , 25 15 Stewards/elections 2011/statements/Bhawani Gautam Rhk

Feb 2011: 1 274 Stewards/elections 2011/votes/מתניה , 2 271 Stewards/elections 2011/votes/Barras , 3 270 Stewards/elections 2011/votes/PeterSymonds , 4 232 Stewards/elections 2011/votes/wpedzich , 5 203 Stewards/elections 2011/votes/Manuelt15 , 6 194 Stewards/elections 2011/votes/Bsadowski1 , 7 188 Stewards/elections 2011/votes/Beria , 8 183 Stewards/elections 2011/votes/Jafeluv , 9 176 Stewards/elections 2011/votes/Swatjester , 10 163 Stewards/elections 2011/votes/WizardOfOz , 11 160 Stewards/elections 2011/votes/Ruslik0 , 12 148 Stewards/elections 2011/votes/Mentifisto , 13 146 Stewards/elections 2011/votes/Fr33kman , 14 133 Stewards/elections 2011/votes/Bennylin , 15 130 Stewards/elections 2011/votes/Eptalon , 16 113 Stewards/elections 2011/votes/Cekli829 , 17 111 Stewards/confirm/2011/DerHexer , 18 108 Stewards/elections 2011/votes/Kameraad Pjotr , 19 103 Stewards/elections 2011/votes/Mayur , 20 99 Steward requests/Permissions , 21 94 Stewards/elections 2011/votes/Djsasso , 22 94 Stewards/elections 2011/votes/Bhawani Gautam Rhk , 23 89 Stewards/confirm/2011/Pathoschild , 24 80 CentralNotice/MediaWiki 1.17 deployment , 25 80 Stewards/confirm/2011/Dferg

Mar 2011: 1 150 CentralNotice/March 2011 Update , 2 88 Steward requests/Permissions , 3 67 Steward requests/Global permissions , 4 46 Wikimedia Forum , 5 44 Steward requests/Username changes , 6 43 Foundation wiki feedback , 7 35 Steward requests/SUL requests , 8 31 Wikimedia Conference 2011/Schedule , 9 29 Steward requests/Checkuser , 10 27 Steward requests/Global , 11 24 OTRS/Volunteering , 12 24 Steward requests/Bot status , 13 23 Wikimedia Conference 2011/Participants , 14 18 Wikimania 2012/Bids/Washington, D.C. , 15 18 List of Wikipedias/Table , 16 18 Wikimedia News , 17 15 Wikimedia Brasil/Interessados , 18 15 Amical Wikimedia/Members and Supporters , 19 14 Requests for new languages , 20 14 Wikimedia chapters , 21 13 Chapter agreements , 22 12 Requests for new languages/Wikinews Croatian , 23 12 Requests for new languages/Wikisource Belarusian 2 , 24 12 Wikimania 2011/CentralNotice , 25 12 Translation of the week/Translation candidates

Apr 2011: 1 69 Steward requests/Permissions , 2 63 Steward requests/Global permissions , 3 38 Foundation wiki feedback , 4 35 Steward requests/Checkuser , 5 32 Wikimedia Foundation elections/Board elections/2011/Translation , 6 32 Proposals for closing projects/Move Servers to Canada , 7 30 Wikimedia Forum , 8 27 Steward requests/Global , 9 26 GLAMcamp NYC , 10 25 Requests for new languages/Wikinews Vietnamese , 11 23 Wikimania 2011/CentralNotice , 12 23 Steward requests/Bot status , 13 22 Wikimedia chapters , 14 21 Wikimedia Foundation elections/Board elections/2011/CentralNotice , 15 20 Steward requests/SUL requests , 16 18 Steward requests/Username changes , 17 15 Wikimedia Venezuela/Votaciones 2011 , 18 15 Wikimedia Venezuela/Propuesta de camisetas institucionales , 19 15 Reports , 20 14 Wikimedia Venezuela/Junta Directiva , 21 14 Wikimedia Venezuela , 22 14 Wikimedia News , 23 13 Encuentro Wikimedia Iberoamericano 2011/Participantes , 24 13 List of Wikipedias/Table , 25 13 Requests for new languages

May 2011: 1 166 CentralNotice/May 2011 Update , 2 102 Wikimedia Foundation elections/Board elections/2011/Translation , 3 94 Steward requests/Permissions , 4 59 Steward requests/Global permissions , 5 53 Wikimedia Foundation elections/Board elections/2011/Candidates/en , 6 46 Wikimedia Forum , 7 43 Steward requests/Checkuser , 8 39 Foundation wiki feedback , 9 34 OTRS/Volunteering , 10 32 Wikimedia Foundation elections/Board elections/2011/Candidates/Questions/1 , 11 29 Wikimedia Foundation elections/Board elections/2011/Candidates/es , 12 28 Steward requests/Global , 13 26 Wikimedia Foundation elections/Board elections/2011/Candidates/Questions/2 , 14 26 GLAMcamp NYC , 15 23 Wikimedia Foundation elections/Board elections/2011/CentralNotice , 16 18 CentralNotice/Generic maintenance notice , 17 17 Wikimedia Foundation elections/Board elections/2011/Candidates/Template/en , 18 17 Steward requests/Bot status , 19 16 Wikimedia Foundation elections/Board elections/2011/Candidates/fr , 20 15 Wikimedia Foundation elections/Board elections/2011/Candidates/ja , 21 15 CentralNotice/Log , 22 15 Wikimedia Venezuela , 23 15 Steward requests/Username changes , 24 14 Wikimedia Foundation elections/Board elections/2011/es , 25 14 Reports

Jun 2011: 1 99 Wikimedia Foundation nomail list , 2 79 Steward requests/Permissions , 3 56 Steward requests/Global permissions , 4 54 Wikimedia Forum , 5 45 Steward requests/Checkuser , 6 42 Steward requests/Global , 7 39 Foundation wiki feedback , 8 35 OTRS/Volunteering , 9 28 Steward requests/SUL requests , 10 22 Steward requests/Bot status , 11 20 Wikimedia Foundation elections/Board elections/2011/Candidates/Questions/2 , 12 20 Requests for new languages/Wikipedia Bahrani Arabic , 13 19 Requests for comment/Oppression in zh wikipedia , 14 19 Requests for new languages/Wikipedia Mingrelian , 15 18 WikiConference India 2011 , 16 18 Brazil Catalyst Project/Agenda June 2011 , 17 18 Steward requests/Miscellaneous , 18 16 Wikimedia Foundation elections/Board elections/2011/Post mortem , 19 16 Requests for comment/ПешСай@mhr.wikipedia , 20 16 Translation of the week/Translation candidates , 21 15 Global message delivery/Targets/Signpost , 22 15 Steward requests/Username changes , 23 15 Wikimedia chapters , 24 14 OTRS/Personnel , 25 13 Fundraising 2011/Fundraising Summit/Official List of Participants

Jul 2011: 1 85 Steward requests/Permissions , 2 58 Steward requests/Global , 3 54 Steward requests/Global permissions , 4 44 Proposals for closing projects/Closure of Old English Wikipedia , 5 43 Wikimedia Forum , 6 38 Image filter referendum/Translation , 7 38 Steward requests/Checkuser , 8 35 Requests for comment/Global ban for Poetlister , 9 34 Foundation wiki feedback , 10 26 Proposals for closing projects/Closure of Inuktitut Wikipedia (2) , 11 23 Requests for comment/Abigor , 12 19 Steward requests/Bot status , 13 18 Steward requests/SUL requests , 14 18 Steward requests/Miscellaneous , 15 17 Meetup/Hong Kong/55 , 16 17 WikiConference India 2011 , 17 17 Requests for comment/Global banners , 18 17 Wikimedia News , 19 15 Image filter referendum/Announcement/Locations , 20 15 OTRS/Volunteering , 21 15 MediaWiki FAQ , 22 14 Translation of the week/Translation candidates , 23 14 Wikimedia chapters , 24 13 Meetup/London/47 , 25 13 Global message delivery/Targets/Signpost

Aug 2011: 1 357 Wikimedia Foundation nomail list , 2 88 Image filter referendum/CentralNotice , 3 86 Image filter referendum/Translation , 4 82 Steward requests/Permissions , 5 63 Wikimedia Forum , 6 56 Stewards/elections 2011-2/Translation/CentralNotice , 7 38 Steward requests/Checkuser , 8 34 Image filter referendum/en , 9 34 Fundraising 2011/Translation/Old , 10 34 Steward requests/Global , 11 33 Foundation wiki feedback , 12 32 Steward requests/Global permissions , 13 29 Image filter referendum/de , 14 27 Steward requests/Username changes , 15 26 Proposed letter of agreement between Wikimedia Foundation and Brazilian volunteers/Signers , 16 26 Wikimedia News , 17 22 Steward requests/SUL requests , 18 21 Steward requests/Bot status , 19 20 Proposals for closing projects/Closure of Scots Wikipedia , 20 19 Stewards/elections 2011-2/Introduction , 21 19 Meetup/Hong Kong/56 , 22 19 Image filter referendum/es , 23 19 Vandalism reports , 24 19 Reports , 25 18 Image filter referendum/fr

Sep 2011: 1 193 Stewards/elections 2011-2/votes/Wikitanvir , 2 178 Stewards/elections 2011-2/votes/Axpde , 3 166 Stewards/elections 2011-2/votes/Vituzzu , 4 150 Stewards/elections 2011-2/votes/Ezarate , 5 147 Stewards/elections 2011-2/votes/Trijnstel , 6 145 Stewards/elections 2011-2/votes/Quentinv57 , 7 138 Stewards/elections 2011-2/votes/Bencmq , 8 133 Stewards/elections 2011-2/votes/Teles , 9 133 Stewards/elections 2011-2/votes/Quadell , 10 132 Stewards/elections 2011-2/votes/Cekli829 , 11 127 Stewards/elections 2011-2/votes/Bennylin , 12 113 Stewards/elections 2011-2/votes/WilliamH , 13 105 Stewards/elections 2011-2/votes/Ruy Pugliesi , 14 100 Stewards/elections 2011-2/votes/Glavkos , 15 93 Stewards/elections 2011-2/votes/Arbitrarily0 , 16 84 Stewards/elections 2011-2/votes/Mikheil88 , 17 68 Stewards/elections 2011-2/votes/Mys 721tx , 18 67 Steward requests/Permissions , 19 58 Steward requests/Global permissions , 20 46 Steward requests/Checkuser , 21 45 OTRS/Volunteering , 22 44 Steward requests/Global , 23 40 Stewards/elections 2011-2/Questions , 24 39 Wikimedia Forum , 25 37 Fundraising 2011/Translation/CentralNotice

Oct 2011: 1 86 Wikimedia Forum , 2 83 Steward requests/Permissions , 3 60 GLAMcamp Amsterdam , 4 53 Steward requests/Checkuser , 5 45 Steward requests/Global permissions , 6 41 Steward requests/Global , 7 40 Foundation wiki feedback , 8 38 Stewards/elections 2011-2/votes/Trijnstel , 9 38 Stewards/elections 2011-2/votes/Teles , 10 34 Stewards/elections 2011-2/votes/Axpde , 11 34 Stewards/elections 2011-2/votes/Vituzzu , 12 32 Controversial content/Brainstorming , 13 31 Stewards/elections 2011-2/votes/Quentinv57 , 14 30 Stewards/elections 2011-2/votes/Quadell , 15 29 Stewards/elections 2011-2/votes/Wikitanvir , 16 25 Wikimedia News , 17 24 Steward requests/Bot status , 18 23 OTRS/Volunteering , 19 22 Stewards/elections 2011-2/votes/Arbitrarily0 , 20 21 Stewards/elections 2011-2/votes/Ruy Pugliesi , 21 21 Stewards/elections 2011-2/votes/Bencmq , 22 20 Stewards/elections 2011-2/votes/Bennylin , 23 19 Fundraising 2011/brazilargentinastorytelling , 24 19 Stewards/elections 2011-2/votes/Ezarate , 25 19 Steward requests/Username changes

Nov 2011: 1 72 Steward requests/Permissions , 2 58 Steward requests/Global permissions , 3 51 Steward requests/Global , 4 43 WikiConference India 2011/Attendees , 5 43 Foundation wiki feedback , 6 38 Steward requests/Checkuser , 7 37 Wikimedia Forum , 8 31 Steward requests/Bot status , 9 29 Fundraising 2011/Translation/Banner , 10 26 GLAMcamp Amsterdam , 11 24 Meetup/London/51 , 12 22 Fundraising 2011/Jimmy Letter 002/ru , 13 21 OTRS/Volunteering , 14 20 Meetup/Sue Gardner at Imperial College London , 15 20 Steward requests/Username changes , 16 19 Fundraising 2011/Translation/Past donors mail , 17 17 Controversial content/Brainstorming , 18 15 Wikimedia chapters , 19 14 Global message delivery/Targets/Signpost , 20 13 Proposals for closing projects/Closure of Fiji Wikipedia 2 , 21 13 Wikimedia News , 22 12 Fundraising 2011/Jimmy Letter 002/es , 23 12 Synchbot , 24 12 List of Wikipedias/Table , 25 12 Vandalism reports

Dec 2011: 1 77 Steward requests/Permissions , 2 46 Wikimedia Forum , 3 35 Steward requests/Global permissions , 4 33 Steward requests/Checkuser , 5 29 Steward requests/Global , 6 28 Steward requests/Bot status , 7 25 Foundation wiki feedback , 8 21 GLAMcamp DC , 9 20 What Gender Is Wikipedia , 10 19 GLAMcamp Amsterdam , 11 18 Steward requests/Username changes , 12 16 OTRS/Volunteering , 13 15 WikiWomenCamp/FAQ , 14 14 Wikimedia Venezuela/Elección del Portavoz , 15 14 Wikimedia News , 16 12 Mobile projects/WikipediaMobileAndroidFeedback , 17 12 List of Wikipedias/Table , 18 10 Wikimedians in Thailand/Wikiclubs in schools/members , 19 10 Global message delivery/Targets/GLAM , 20 10 Steward requests/Miscellaneous , 21 10 Wikimedia chapters , 22 9 Meetup/Hong Kong/60 , 23 9 Requests for new languages/Wikipedia Kildin Sami , 24 9 Meetup/London/52 , 25 9 Distribution list/Global message delivery

Jan 2012: 1 103 Steward requests/Permissions , 2 53 English Wikipedia anti-SOPA blackout/Congress data , 3 48 Steward requests/Global permissions , 4 47 Wikimedia Forum , 5 41 Steward requests/Global , 6 40 Wikimedia Conference 2012/Participants , 7 39 Foundation wiki feedback , 8 35 Finance meeting 2012 , 9 34 Wikimania 2012/CentralNotice , 10 31 Huggle/Members , 11 31 OTRS/Volunteering , 12 30 Wikimedia chapters/Existing chapters , 13 30 Steward requests/Checkuser , 14 27 Stewards/Elections 2012/Translation/CentralNotice , 15 26 English Wikipedia anti-SOPA blackout/Post-mortem , 16 25 English Wikipedia anti-SOPA blackout/Media , 17 25 Steward requests/Bot status , 18 23 Stewards/Elections 2012/Questions , 19 21 Stewards/Elections 2012/Introduction , 20 21 Stewards/Confirm/Introduction12 , 21 21 Wikimedia News , 22 19 English Wikipedia anti-SOPA blackout/Technical FAQ , 23 19 Steward requests/Username changes , 24 16 Stewards/Elections 2012 , 25 16 Wikimania 2013 bids

Feb 2012: 1 341 Stewards/Elections 2012/Votes/Billinghurst , 2 289 Stewards/Elections 2012/Votes/Snowolf , 3 284 Stewards/Elections 2012/Votes/Elfix , 4 282 Stewards/Elections 2012/Votes/MBisanz , 5 261 Stewards/Elections 2012/Votes/Pundit , 6 252 Stewards/Elections 2012/Votes/Teles , 7 236 Stewards/Elections 2012/Votes/Nihonjoe , 8 234 Stewards/Elections 2012/Votes/Tegel , 9 234 Stewards/Elections 2012/Votes/Luckas Blade , 10 148 Stewards/Elections 2012/Votes/Cekli829 , 11 104 Stewards/Confirm/2012/Magister Mathematicae , 12 95 Stewards/Confirm/2012/DerHexer , 13 91 Steward requests/Permissions , 14 83 Stewards/Confirm/2012/MarcoAurelio , 15 72 Stewards/Confirm/2012/Barras , 16 72 Stewards/Confirm/2012/PeterSymonds , 17 68 Stewards/Confirm/2012/Quentinv57 , 18 68 Wikimedia Forum , 19 63 Stewards/Confirm/2012/Matanya , 20 62 Stewards/Confirm/2012/Dungodung , 21 60 Steward requests/Global permissions , 22 59 Wikimania 2012/CentralNotice , 23 58 Requests for comment/Meta-wiki requests for comment on users , 24 58 Stewards/Confirm/2012/Pathoschild , 25 57 Stewards/Confirm/2012/Darkoneko

Mar 2012: 1 93 Steward requests/Permissions , 2 80 Steward requests/Global permissions , 3 51 Steward requests/Checkuser , 4 48 Wikimedia Forum , 5 42 Chapters Council/Chapter Support , 6 42 Steward requests/Global , 7 35 Wikimania 2013 bids/Hong Kong , 8 35 Steward requests/Bot status , 9 30 Requests for comment/Userrights on Hindi Wikipedia , 10 25 Proposals for closing projects/Closure of Buryat Wikipedia , 11 24 Requests for new languages/Wikipedia Paxto , 12 21 Meetup/London/55 , 13 21 Steward requests/Username changes , 14 19 Steward requests/SUL requests , 15 19 Wikimedia News , 16 16 Synchbot , 17 15 Meetup/Monmouth/1 , 18 15 Wikimedia Conference 2012/Participants , 19 15 Foundation wiki feedback , 20 15 OTRS/Volunteering , 21 14 WikiWomenCamp/Participation , 22 13 Wikimedia Conference 2012/WLM , 23 13 Meetup/Manchester/12 , 24 12 Turkic Wikimedia Conference 2012/Participants , 25 12 Requests for new languages/Wikipedia Talysh

Apr 2012: 1 88 Steward requests/Permissions , 2 57 Steward requests/Global , 3 56 Steward requests/Global permissions , 4 55 Funds Dissemination Committee Advisory Group/Formation , 5 42 Foundation wiki feedback , 6 41 Wikivoyage/Supporters , 7 40 Steward requests/Checkuser , 8 29 Wikidata/Volunteers , 9 29 Wikimedia Forum , 10 29 OTRS/Volunteering , 11 26 Steward requests/Bot status , 12 18 Stewards' noticeboard , 13 18 Steward requests/Username changes , 14 17 Sister Projects Committee/Members , 15 17 Proposals for closing projects/Closure of Buryat Wikipedia , 16 14 Sister Projects Committee , 17 14 Wikimedistas de Costa Rica/es , 18 14 CentralNotice/Generic maintenance notice , 19 14 Steward requests/Miscellaneous , 20 13 Meetup/Monmouth/1 , 21 13 Wikimania 2013 bids/London , 22 13 Synchbot , 23 13 Steward requests/SUL requests , 24 12 Wikidata , 25 12 Requests for new languages/Wikipedia Tuvan

May 2012: 1 81 Steward requests/Permissions , 2 54 Wikimedia Forum , 3 51 Foundation wiki feedback , 4 50 Steward requests/Global permissions , 5 47 Steward requests/Global , 6 39 Steward requests/Checkuser , 7 32 OTRS/Volunteering , 8 30 Steward requests/Bot status , 9 29 Requests for comment/Disable local uploads on smaller wikis , 10 28 Steward requests/Username changes , 11 20 Wikimania 2014 bids/London , 12 19 Steward requests/Miscellaneous , 13 18 Huggle/Members , 14 18 Wikimedia News , 15 16 WikiWomenCamp/Participation , 16 16 Requests for new languages/Wikipedia Talysh , 17 15 Synchbot , 18 13 IRC office hours , 19 11 Meetup/Cambridge/15 , 20 11 Spam blacklist , 21 10 Spam blacklist/Log/2012/05 , 22 10 List of Wikipedias/Table , 23 10 Steward requests/Miscellaneous/Bot-reported , 24 9 Wikimedia Blog/Calendar , 25 9 Meetup/Hong Kong/65

Jun 2012: 1 82 Steward requests/Permissions , 2 71 Steward requests/Global permissions , 3 54 Steward requests/Global , 4 43 Requests for comment/Internet Defense League , 5 36 Wikimedia Forum , 6 31 Steward requests/Checkuser , 7 23 Steward requests/Bot status , 8 22 Requests for comment/Global bans , 9 21 OTRS/Volunteering , 10 16 Steward requests/Username changes , 11 15 Foundation wiki feedback , 12 14 Wikimedia Blog/Calendar , 13 13 Synchbot , 14 13 Steward requests/Miscellaneous , 15 12 Spam blacklist , 16 11 Meetup/London/59 , 17 11 Spam blacklist/Log/2012/06 , 18 10 IRC/Hosts , 19 10 Wikidata/Development , 20 10 Global message delivery/Targets/Signpost , 21 10 Steward requests/SUL requests , 22 9 Wikimedia Chapters Association/Membership , 23 9 Cascadia Wikimedians , 24 9 Requests for new languages/Wikiversity Korean , 25 9 Reports

Jul 2012: 1 576 Requests for comment/Travel Guide , 2 123 Requests for comment/Global bans , 3 80 Steward requests/Permissions , 4 43 Steward requests/Checkuser , 5 39 Wikimedia Forum , 6 38 Steward requests/Bot status , 7 37 Steward requests/Global , 8 33 Requests for comment/Sysop abuse on the Turkish Wikipedia , 9 33 CentralNotice/Travel Guide , 10 31 Steward requests/Global permissions , 11 27 Requests for comment/Internet Defense League , 12 23 Foundation wiki feedback , 13 23 OTRS/Volunteering , 14 21 Wikimedia Chapters Association/Membership , 15 20 Wikidata/Logo voting , 16 19 Wikivoyage , 17 18 Requests for comment/Wiki mobbing on de.wikipedia , 18 18 Stewards' noticeboard , 19 17 Requests for new languages/Wikiversity Tamil , 20 17 Wikidata/Volunteers , 21 16 Wikivoyage/Supporters , 22 15 Synchbot , 23 15 Steward requests/SUL requests , 24 14 IRC office hours , 25 13 Wikimedia Chapters Association/Meetings/First Meeting

Aug 2012: 1 85 Requests for comment/Travel Guide , 2 67 Steward requests/Permissions , 3 58 Funds Dissemination Committee/Nominations/Archive/2012 , 4 55 Wikivoyage/New language versions , 5 50 Steward requests/Checkuser , 6 43 Global message delivery/Targets/Wikidata , 7 43 Steward requests/Global permissions , 8 42 Steward requests/Global , 9 35 Wikimedia Forum , 10 33 OTRS/Volunteering , 11 27 Wikimedia Fellowships/Project Ideas/The Wikipedia Library , 12 24 Steward requests/Bot status , 13 20 Proposals for closing projects/Closure of Strategy Wiki , 14 17 Funds Dissemination Committee/Call for Volunteers , 15 16 Proposals for closing projects/Closure of Simple English Wiktionary (3) , 16 16 OTRS/Personnel , 17 15 Requests for comment/Global bans , 18 15 Steward requests/Username changes , 19 14 Meetup/London/60 , 20 14 Foundation wiki feedback , 21 14 Synchbot , 22 14 Reports , 23 13 Requests for comment/Sysop abuse on the Turkish Wikipedia , 24 13 Wiki Project Med , 25 13 Wikimedia News

Sep 2012: 1 98 Request for comment/Legal Fees Assistance Program/Option1 , 2 80 Steward requests/Permissions , 3 78 Wikivoyage/Naming straw poll , 4 40 Steward requests/Global , 5 38 Wikimedia Forum , 6 29 Wikivoyage/Migration/New policies/Cross-identification of accounts/Verify , 7 26 Steward requests/Checkuser , 8 25 Request for comment/Legal Fees Assistance Program/Option2 , 9 24 Wikivoyage/New language versions , 10 24 Wikimedia Indigenous Languages/Participants , 11 24 Steward requests/Global permissions , 12 23 Global message delivery/Targets/Wikidata , 13 22 Requests for comment/Sysop abuse on the Zazaki Wikipedia , 14 21 Steward requests/Bot status , 15 20 OTRS/Volunteering , 16 17 Reports , 17 16 Foundation wiki feedback , 18 15 Wikimania 2014 bids/Bukittinggi , 19 14 Steward requests/Username changes , 20 13 Wikivoyage/Migration/New policies , 21 13 Wikimania/Scholarships/2012 , 22 13 Steward requests/Miscellaneous , 23 12 Meetup/London/62 , 24 12 Requests for new languages/Wikipedia South Azerbaijani , 25 11 Requests for comment/Global bans

Oct 2012: 1 240 Wikivoyage/Naming Process/ProposedNames , 2 70 Steward requests/Permissions , 3 68 Wikivoyage/Logo/Round 1 , 4 51 Steward requests/Global permissions , 5 44 Steward requests/Global , 6 39 Wikimedia Forum , 7 34 Steward requests/Checkuser , 8 30 IRC/Group Contacts/Meetings/October 2012 , 9 29 Planet Wikimedia/Names , 10 24 Wiki Project Med , 11 24 OTRS/Volunteering , 12 23 Steward requests/Username changes , 13 22 Wikivoyage/New language versions , 14 22 Global message delivery/Targets/Wikidata , 15 22 Foundation wiki feedback , 16 20 Steward requests/Bot status , 17 18 Wikimedia Chapters Association/Resolutions/2012 SG recruitment , 18 18 Wikimedia Deutschland/Offener Sonntag November 2012 , 19 17 Wikimedia CEE Meeting 2012/Attendees , 20 17 Steward requests/SUL requests , 21 17 Steward requests/Miscellaneous , 22 15 Wikivoyage/Migration/New policies/Cross-identification of accounts/Verify , 23 15 Wikimedia Chapters Association/Resolutions/2012 Office location , 24 14 Reports , 25 12 Wikidata/Main Page draft

Nov 2012: 1 290 Wikivoyage/Logo/Round 1 , 2 88 Steward requests/Permissions , 3 60 Steward requests/Global permissions , 4 41 Wikivoyage/Logo , 5 40 Wikivoyage/For naming Russian Wikivoyage \"Викигид\" , 6 37 Wikivoyage/Launch , 7 36 Wikimedia Forum , 8 34 OTRS/Volunteering , 9 32 Proposals for closing projects/Closure of English Wikinews , 10 32 Global message delivery/Targets/Wikidata , 11 32 Steward requests/Checkuser , 12 31 Wikivoyage/For naming Russian Wikivoyage \"Викивояж\" , 13 30 Wikimedia Deutschland/Offener Sonntag November 2012 , 14 30 Steward requests/Global , 15 29 Steward requests/Username changes , 16 28 Democratizing the Wikimedia Foundation , 17 25 Foundation wiki feedback , 18 25 Steward requests/Miscellaneous , 19 24 Glossary , 20 22 Requests for new languages/Wikivoyage Spanish , 21 21 GDJ 2012/Lista uczestników , 22 21 Steward requests/Bot status , 23 19 Wikimedia Chapters Association/Resolutions/2012 WCA place of registration , 24 18 Steward requests/SUL requests , 25 17 Wikivoyage/New language versions

Dec 2012: 1 153 Wikivoyage/Logo , 2 79 Steward requests/Permissions , 3 48 Steward requests/Global permissions , 4 39 Wikimedia Forum , 5 36 Steward requests/Global , 6 27 Steward requests/Bot status , 7 24 Requests for new languages/Wikipedia Minangkabau , 8 23 WikiFocus , 9 23 OTRS/Volunteering , 10 23 Steward requests/Checkuser , 11 21 Global message delivery/Targets/Wikidata , 12 20 Concise Wikipedia , 13 20 Foundation wiki feedback , 14 17 Steward requests/Username changes , 15 16 Concise Wikipedia/supporters , 16 15 Steward requests/Miscellaneous , 17 14 Proposals for new projects/WikiFocus/supporters , 18 13 Ombudsman commission/reform proposals , 19 13 Wiki Project Med , 20 13 Steward requests/SUL requests , 21 12 Wikimedia monthly activities meetings/2012-12 , 22 12 Reports , 23 11 Wikimedia News , 24 10 Individual Engagement Grants , 25 10 Wikikultur/supporters

Jan 2013: 1 113 Steward requests/Permissions , 2 83 Steward requests/Global permissions , 3 58 Wikimania 2013/CentralNotice , 4 47 Steward requests/Global , 5 35 Steward requests/Checkuser , 6 35 Steward requests/Bot status , 7 34 Wikivoyage 2013/CentralNotice , 8 33 Wikimedia Forum , 9 31 Foundation wiki feedback , 10 28 Global message delivery/Targets/Wikidata , 11 28 OTRS/Volunteering , 12 27 Stewards/Elections 2013/Questions , 13 23 Steward requests/Username changes , 14 18 CentralNotice/Generic maintenance notice , 15 18 Steward requests/SUL requests , 16 18 OTRS/Personnel , 17 18 Steward requests/Miscellaneous , 18 16 Stewards/Elections 2013 , 19 16 Wikivoyage/Lounge , 20 14 CentralNotice/Calendar , 21 14 Wikimedia News , 22 13 Global message delivery/Targets/Grants News , 23 13 Wikimedia monthly activities meetings/2013-01 , 24 13 Wikimedia Blog/Calendar , 25 12 Wikimedia Blog/Drafts/Your First Million Is Never Forgotten

Feb 2013: 1 335 Stewards/Elections 2013/Votes/MF-Warburg , 2 288 Stewards/Elections 2013/Votes/Jon Harald Søby , 3 258 Stewards/Elections 2013/Votes/Mathonius , 4 247 Stewards/Elections 2013/Votes/Amqui , 5 210 Stewards/Elections 2013/Votes/BRUTE , 6 193 Stewards/Elections 2013/Votes/QuiteUnusual , 7 190 Stewards/Elections 2013/Votes/Ezarate , 8 182 Stewards/Elections 2013/Votes/Cekli829 , 9 150 Stewards/Elections 2013/Votes/Arbitrarily0 , 10 143 Stewards/Elections 2013/Votes/Bletilla , 11 121 WebCite/supporters , 12 97 Stewards/Confirm/2013/Vituzzu , 13 95 Steward requests/Permissions , 14 87 Wikimania 2013/CentralNotice , 15 85 Stewards/Confirm/2013/DerHexer , 16 83 Stewards/Confirm/2013/Snowolf , 17 76 Stewards/Confirm/2013/Trijnstel , 18 75 Stewards/Confirm/2013/Barras , 19 73 Stewards/Confirm/2013/PeterSymonds , 20 72 Stewards/Confirm/2013/Quentinv57 , 21 71 Stewards/Confirm/2013/MarcoAurelio , 22 68 Stewards/Confirm/2013/Billinghurst , 23 62 Global message delivery/Targets/Wikidata , 24 61 WebCite , 25 60 Stewards/Confirm/2013/Wikitanvir

Mar 2013: 1 114 Steward requests/Permissions , 2 67 Global message delivery/Targets/Wikidata , 3 63 Wikimania 2013/CentralNotice , 4 61 Amical Wikimedia/Members and Supporters , 5 48 Wikimedia Conference 2013/Participants , 6 44 WebCite/supporters , 7 44 Steward requests/Global , 8 43 Lua deployments/Localization of Module , 9 40 Steward requests/Checkuser , 10 35 Requests for comment/Adopt OmegaWiki , 11 34 Stewards' noticeboard , 12 33 Wikimedia Forum , 13 28 Steward requests/Global permissions , 14 27 Steward requests/Bot status , 15 26 Requests for comment/Wikidata rollout and interwiki bots , 16 24 OTRS/Volunteering , 17 23 Foundation wiki feedback , 18 22 Requests for comment/Approval of the rewritten Meta-Steward relationship document as policy/Vote , 19 22 Steward requests/SUL requests , 20 21 WebCite , 21 20 Wikivoyage/Lounge , 22 20 Wikimedia News , 23 19 Steward requests/Username changes , 24 19 Steward requests/Miscellaneous , 25 15 EU policy/Big Fat Brussels Meeting

Apr 2013: 1 123 Requests for comment/Activity levels of advanced administrative rights holders , 2 93 Amical Wikimedia/Members and Supporters , 3 77 Wikimedia Conference 2013/Saturday dinner , 4 77 Steward requests/Permissions , 5 75 Wikimedia Conference 2013/Welcome event , 6 61 Steward requests/Global permissions , 7 56 Wikimedia Forum , 8 46 Global message delivery/Targets/Wikidata , 9 45 Steward requests/Global , 10 44 Requests for comment/Interproject links interface , 11 43 The Wikinewsie Group , 12 38 OTRS/Volunteering , 13 38 Steward requests/Checkuser , 14 25 Fundraising 2012/Translation/Drop down banner/tr , 15 25 Fundraising 2012/Translation/Drop down banner/it , 16 25 Steward requests/SUL requests , 17 24 Wikimedia Conference 2013/Cultural Walk , 18 23 Wikimedia Deutschland/Offener Sonntag 2013/1 , 19 23 Steward requests/Bot status , 20 22 Steward requests/Username changes , 21 21 Rename practices , 22 21 Wikimedia Conference 2013/Schedule/Friday , 23 21 Proposals for closing projects/Closure of Norwegian Wikinews 2 , 24 21 Fundraising 2012/Translation/Drop down banner/es , 25 20 Requests for comment/Musical score transcription project proposal

May 2013: 1 117 Global message delivery/Targets/Tech ambassadors , 2 94 Steward requests/Permissions , 3 74 Wikimedia Forum , 4 48 Steward requests/Global , 5 47 Wikimedia Uruguay , 6 43 Requests for comment/Scope of Ombudsman Commission , 7 41 Steward requests/Global permissions , 8 35 Steward requests/Checkuser , 9 34 OTRS/Volunteering , 10 31 Wikimedia Foundation elections/Board elections/2013/Questions/1 , 11 31 Steward requests/Username changes , 12 30 Wikimedia Deutschland/Offener Sonntag 2013/1 , 13 29 Global message delivery/Targets/Wikidata , 14 28 Proposals for new projects/WikiLang/supporters , 15 27 Rename practices , 16 26 Wikimedia Foundation elections/Board elections/2013/Candidates , 17 25 Requests for comment/Activity levels of advanced administrative rights holders , 18 24 Learning and Evaluation/News/June 2013 Workshop in Budapest , 19 22 Steward requests/SUL requests , 20 22 Wikimedia News , 21 21 Foundation wiki feedback , 22 21 Stewards' noticeboard , 23 19 Wiki Project Med , 24 17 Wikimedia Foundation elections/Board elections/2013/Questions/3 , 25 17 Wikimedia exit interview/Sue Gardner

Jun 2013: 1 380 Requests for comment/X!'s Edit Counter , 2 87 Wikimedia Foundation nomail list , 3 80 Steward requests/Permissions , 4 61 Steward requests/Global permissions , 5 58 Steward requests/Global , 6 49 Global message delivery/Targets/Tech ambassadors , 7 42 Wikimedia Forum , 8 29 OTRS/Volunteering , 9 28 Steward requests/Checkuser , 10 26 Wikimedistas de Ecuador , 11 23 PED/Introductions , 12 21 Wikimedia News , 13 20 Wikimedia Deutschland/Tacheles 2013 , 14 17 Wikivoyage/Lounge , 15 17 Global message delivery/Targets/Wikidata , 16 14 Wikimedia Foundation elections/Board elections/2013/Questions/3 , 17 14 Wikimedia Foundation elections 2013/Post mortem , 18 14 Global message delivery/Spam , 19 14 Translation of the week/Translation candidates , 20 13 Spam blacklist/Log/2013/06 , 21 13 Steward requests/Miscellaneous , 22 12 World War I edit-a-thons/Australia , 23 12 Global message delivery/Status , 24 12 Steward requests/SUL requests , 25 11 Synchbot

Jul 2013: 1 177 Wikivoyage/Logo/2013/R1/v/Wikivoyage logo idea - Geographical zones with arrow 2.svg , 2 143 Wikivoyage/Logo/2013/R1/v/WV-Logo Proposal AleXXw.svg , 3 138 Requests for comment/X!'s Edit Counter , 4 109 Wikivoyage/Logo/2013/R1/v/Wikivoyage logo idea - Geographical zones with two arrows and axial tilt 2.svg , 5 93 Wikivoyage/Logo 2013/Submissions , 6 85 Wikivoyage/Logo/2013/R1/v/WV logo v25 v2.png , 7 83 Wikivoyage/Logo/2013/R1/v/Wv logo proposal flying plane.png , 8 77 Wikivoyage/Logo/2013/R1/v/Wikivoyage0.4 Proposed by Dyolf77.svg , 9 63 Wikivoyage/Logo/2013/R1/v/Wikivoyage fantasy balloon logo3.svg , 10 61 Steward requests/Permissions , 11 59 Wikivoyage/Logo/2013/R1/v/Wikivoyage-1en-Mmxx.png , 12 57 Wikivoyage/Logo/2013/R1/v/Wikivoyage-3en-Mmxx.png , 13 52 Wikivoyage/Logo/2013/R1/v/Travel boat blue logo.svg , 14 51 Planet Wikimedia , 15 43 Wikimedia Forum , 16 40 Wikivoyage/Logo/2013/R1/v/Wikivoyage0.3 Proposed By Dyolf77-edit.svg , 17 39 Steward requests/Global permissions , 18 37 Wikivoyage/Logo/2013/R1/v/Wikivoyage-giweddah-takeoff4.svg , 19 36 Steward requests/Global , 20 35 Global message delivery/Targets/Tech ambassadors , 21 33 Wikivoyage/Logo/2013/R1/v/Logo entry shyamal2.svg , 22 32 Wikivoyage/Logo/2013/R1/v/HugoWikiVoyage2Mountain.png , 23 30 Steward requests/Checkuser , 24 28 Wikivoyage/Logo/2013/R1/v/Proposed logo wikivoyages 1.svg , 25 28 Wikivoyage/Logo/2013/R1/v/WikiVoyage-logo.svg

Aug 2013: 1 283 Wikivoyage/Logo/2013/R2/v/WV-Logo Proposal AleXXw 3.0 var4 (Icon).svg , 2 214 Wikivoyage/Logo/2013/R2/v/Wikivoyage fantasy balloon logo 5 lenka stabilo favicon.svg , 3 147 Wikivoyage/Logo/2013/R2/v/WV-Logo Proposal AleXXw 3.0 var4 (Icon) tgb.svg , 4 132 Wikivoyage/Logo/2013/R2/v/Wv logo proposal flying plane contorted.png , 5 125 Wikivoyage/Logo/2013/R2/v/WV-Logo Proposal AleXXw (Elements) Danapit blue.svg , 6 100 Wikivoyage/Logo/2013/R2/v/Wv logo proposal flying plane wo text favicon.png , 7 85 Wikivoyage/Logo/2013/R2/v/Wikivoyage balloon cropped.png , 8 80 Steward requests/Permissions , 9 64 Wikivoyage/Logo/2013/R2/v/Wv logo proposal flying plane.png , 10 62 Wikivoyage/Logo 2013/Finalist review/WV-Logo Proposal AleXXw , 11 58 Requests for comment/Global ban for Ottava Rima , 12 51 Steward requests/Global permissions , 13 50 Wikivoyage/Logo 2013/Finalist review/Fantasy Balloon logo3 , 14 40 Wikimedia Diversity Conference 2013 , 15 39 CIS-A2K/Events/Konkani Wikipedia workshop 21-24 August2013 , 16 39 CentralNotice/Generic maintenance notice , 17 36 HTTPS , 18 36 Boards training workshop March 2014 , 19 35 Wikimedia Forum , 20 32 Steward requests/Global , 21 27 Massively-Multiplayer Online Bibliography , 22 24 Wikivoyage/Logo 2013/Finalist review/Flying plane , 23 22 Lilavati's Daughters Edit-a-thon , 24 21 Wikivoyage/Lounge , 25 19 Wikimedia Asia Project/Cultural Content Exchange

Sep 2013: 1 77 Requests for comment/2013 issues on Croatian Wikipedia , 2 72 Steward requests/Permissions , 3 58 Community Logo/Request for consultation , 4 53 Steward requests/Global permissions , 5 41 Wikimedia Forum , 6 30 Steward requests/Global , 7 27 OTRS/Volunteering , 8 25 Synchbot , 9 24 Community Logo/Reclaim the Logo , 10 21 Wikivoyage/Lounge , 11 20 Global message delivery/Targets/Wikidata , 12 20 Wikimedia News , 13 19 Privacy policy , 14 19 Foundation wiki feedback , 15 17 Stewards' noticeboard , 16 15 Steward requests/Miscellaneous , 17 14 Wikifiction (In-universe encyclopedia)/supporters , 18 14 Wikivoyage/Summit , 19 14 IRC office hours , 20 13 Steward requests/SUL requests , 21 13 Steward requests/Checkuser , 22 12 Privacy policy/nl , 23 12 Wikimedia Diversity Conference 2013/Participants , 24 12 Steward requests/Username changes , 25 11 Global-Wiki/supporters

Oct 2013: 1 86 Steward requests/Permissions , 2 53 Steward requests/Global permissions , 3 40 Community Logo/Request for consultation , 4 37 CIS-A2K/Events/Konkani Vishwakosh Digitization , 5 36 Steward requests/Global , 6 30 Wikimedia Forum , 7 27 Steward requests/Checkuser , 8 25 Learning and Evaluation/Archive/Connect/Questions , 9 21 Requests for comment/2013 issues on Croatian Wikipedia/Evidence/Conduct , 10 18 Global message delivery/Targets/Tech ambassadors , 11 18 Foundation wiki feedback , 12 17 Requests for comment/2013 issues on Croatian Wikipedia/Evidence/Content , 13 16 Meetup/Cardiff/2 , 14 16 Steward requests/Username changes , 15 15 Global message delivery/Targets/Wikidata , 16 14 Wikimedia Diversity Conference 2013/Schedule , 17 14 CIS-A2K/Events/Train the Trainer Program , 18 14 Proposals for closing projects/Move Beta Wikiversity to Incubator , 19 13 October 2013 private data security issue , 20 13 Wikimedia monthly activities meetings/2013-10 , 21 13 Synchbot , 22 13 Steward requests/Miscellaneous , 23 12 Global message delivery/Spam , 24 11 Meetup/London/74 , 25 11 IRC office hours

Nov 2013: 1 67 Steward requests/Permissions , 2 40 Wikimedia Forum , 3 35 Wikimedia Diversity Conference 2013/Participants , 4 35 Steward requests/Global permissions , 5 34 Steward requests/Global , 6 33 Trademark policy , 7 28 Wikimedia Deutschland/Offener Sonntag 2013/2 , 8 23 Global message delivery/Targets/Tech ambassadors , 9 20 Wikimedia LGBT+/Participants , 10 20 OTRS/Volunteering , 11 19 Wikimedia Conference 2014/Programme review , 12 19 Requests for comment/2013 issues on Croatian Wikipedia , 13 18 Stewards' noticeboard , 14 17 Wikimedia Diversity Conference 2013/Documentation , 15 17 Global message delivery/Targets/Wikidata , 16 15 Meetup/London/75 , 17 15 Steward requests/Username changes , 18 14 Wikimedia Botswana Translation Sprint Hack-a-thon , 19 14 Foundation wiki feedback , 20 12 Trademark policy/fr , 21 12 Trademark policy/FAQ , 22 12 Wikimedia Diversity Conference 2013/Schedule , 23 12 Tech , 24 12 Steward requests/Checkuser , 25 11 Roundtables/Roundtable 4

Dec 2013: 1 72 Steward requests/Permissions , 2 43 Steward requests/Global permissions , 3 42 Wikimedia Forum , 4 39 Steward requests/Global , 5 28 Steward requests/Username changes , 6 26 Community Logo/Request for consultation , 7 22 Steward requests/Checkuser , 8 21 OTRS/Volunteering , 9 19 Trademark policy , 10 17 Global message delivery/Targets/Wikidata , 11 17 Foundation wiki feedback , 12 15 Steward requests/SUL requests , 13 14 Steward requests/Miscellaneous , 14 13 Global message delivery/Targets/Tech ambassadors , 15 12 Wikimedia News , 16 11 Requests for comment/Acquisition of the Boarische Wikipedia by Sockpuppets , 17 11 Wikimedia monthly activities meetings/2013-12 , 18 11 Learning and Evaluation/Archive/Connect/Questions , 19 9 Learning and Evaluation/Events/2014/Learning patterns hackathon , 20 9 Global message delivery/Targets/Signpost , 21 9 Stewards' noticeboard , 22 8 Tech/News/2013/51 , 23 8 Wikimedia Highlights, November 2013/fr , 24 8 Fundraising/Translation/Thank you email 20131202/fr , 25 8 Trademark policy/summary

Jan 2014: 1 113 Steward requests/Permissions , 2 56 Steward requests/Global , 3 45 Global message delivery/Targets/Tech ambassadors , 4 41 Steward requests/Global permissions , 5 36 Wikimedia Forum , 6 28 Stewards/Elections 2014/Questions , 7 21 Reasonator/interface , 8 21 Stewards' noticeboard , 9 21 Steward requests/Miscellaneous , 10 20 Global message delivery/Targets/Wikidata , 11 20 Steward requests/Username changes , 12 19 Foundation wiki feedback , 13 19 Steward requests/Checkuser , 14 18 Requests for new languages/Wikipedia Northern Luri , 15 16 Stewards/Elections 2014 , 16 15 Wikimedia Foundation Board noticeboard , 17 15 Steward requests/SUL requests , 18 15 OTRS/Volunteering , 19 15 Steward requests/Bot status , 20 14 Wikimedia monthly activities meetings/2014-01 , 21 14 Wikimania 2015 bids/Cape Town/Our Team , 22 13 Trademark policy , 23 13 IRC office hours , 24 12 Proposals for closing projects/Deletion of Moldovan Wikipedia 2 , 25 12 European Commission copyright consultation/Term

Feb 2014: 1 262 Stewards/Elections 2014/Votes/Hoo man , 2 246 Stewards/Elections 2014/Votes/Rschen7754 , 3 224 Stewards/Elections 2014/Votes/Savh , 4 217 Stewards/Elections 2014/Votes/Tar Lócesilion , 5 205 Stewards/Elections 2014/Votes/Meno25 , 6 203 Stewards/Elections 2014/Votes/Ajraddatz , 7 200 Stewards/Elections 2014/Votes/Shanmugamp7 , 8 196 Stewards/Elections 2014/Votes/Cekli829 , 9 194 Stewards/Elections 2014/Votes/SPQRobin , 10 172 Stewards/Elections 2014/Votes/Risker , 11 172 Stewards/Elections 2014/Votes/TBloemink , 12 103 Stewards/Confirm/2014/DerHexer , 13 98 Requests for comment/Wikimedia Commons interwiki prefix , 14 97 Stewards/Elections 2014/Votes/Techman224 , 15 91 Stewards/Confirm/2014/Barras , 16 90 Stewards/Confirm/2014/Snowolf , 17 89 Stewards/Confirm/2014/Billinghurst , 18 86 Stewards/Confirm/2014/Vituzzu , 19 84 Stewards/Confirm/2014/Trijnstel , 20 83 Stewards/Confirm/2014/MF-Warburg , 21 82 Steward requests/Permissions , 22 80 Stewards/Confirm/2014/Quentinv57 , 23 74 Stewards/Confirm/2014/Mathonius , 24 68 Stewards/Confirm/2014/Tegel , 25 66 Stewards/Confirm/2014/Matanya

Mar 2014: 1 87 Steward requests/Permissions , 2 67 Steward requests/Global permissions , 3 59 Steward requests/Global , 4 37 Wikimedia Forum , 5 36 Requests for comment/Wikimedia Commons interwiki prefix , 6 35 Stewards' noticeboard , 7 33 Steward requests/Username changes , 8 30 Global message delivery/Targets/Tech ambassadors , 9 29 Steward requests/SUL requests , 10 27 Requests for comment/Creation of a Global Wikimedia Commons , 11 23 OTRS/Volunteering , 12 22 CIS-A2K/Events/Wiki Women's Day at CBIT , 13 22 Global message delivery/Targets/This Month in Education , 14 21 Foundation wiki feedback , 15 20 Wikimedia genealogy project , 16 20 Terms of use/Paid contributions amendment , 17 19 Steward requests/Checkuser , 18 18 Steward requests/Miscellaneous , 19 12 Requests for comment/Global Interface editors group policy , 20 12 Wikimedia Conference 2014/Participants , 21 12 Wikimania 2015 bids/Monastir , 22 12 Cunningham's Law , 23 12 IRC office hours , 24 12 Vandalism reports , 25 12 Reports

Apr 2014: 1 75 Steward requests/Permissions , 2 62 Steward requests/Global , 3 46 Stewards' noticeboard , 4 40 Steward requests/Global permissions , 5 34 Foundation wiki feedback , 6 28 Wikimedia Forum , 7 27 Global message delivery/Targets/Tech ambassadors , 8 21 Wikimedians in Thailand/Members , 9 17 Steward requests/Checkuser , 10 16 Meetup/London/80 , 11 16 Wikimedia User Group China , 12 16 OTRS/Volunteering , 13 15 Global message delivery/Targets/Wikidata , 14 15 Steward requests/SUL requests , 15 14 Wikimedia Conference 2014/Programme , 16 13 UserWiki , 17 13 Steward requests/Username changes , 18 12 Wikimedia genealogy project , 19 12 Wikimedia Conference 2014/Social events , 20 12 NonFreeWiki , 21 12 Learning and Evaluation/Events/2014/Wikimedia Conference 2014 Open Thursday Sessions , 22 12 IRC office hours , 23 11 EU policy/Big Fat Brussels Meeting Vol. 2 , 24 10 Assessment of Belfer Center Wikipedian in Residence program , 25 10 Tech/News/2014/17

May 2014: 1 78 Steward requests/Permissions , 2 45 Steward requests/Global , 3 43 Umepedia Challenge/participants , 4 38 Global message delivery/Targets/Tech ambassadors , 5 36 Steward requests/Global permissions , 6 31 Wikimedia Forum , 7 29 OTRS/Volunteering , 8 21 Foundation wiki feedback , 9 17 Wikimedia exit interview/Sue Gardner , 10 16 Steward requests/Username changes , 11 16 Steward requests/Miscellaneous , 12 15 UserWiki , 13 13 A bunch of nobodies , 14 12 Meetup/London/81 , 15 12 Wikimedia France/Micro-financement/2017-2018 , 16 12 Wikimedia News , 17 11 Affiliations Committee/RFCs/Wikimedia user group logos/Content , 18 11 Steward requests/Checkuser , 19 10 Privacy policy , 20 10 Global message delivery/Targets/Wikidata , 21 10 IRC office hours , 22 9 Connecting knowledge to power: the future of digital democracy in the UK (Archive 1) , 23 9 Affiliate-selected Board seats/2014/Questions , 24 9 Wiki Borregos CCM Student User Group/Spring Semester 2014 , 25 9 Stewards' noticeboard

Jun 2014: 1 53 Steward requests/Permissions , 2 36 Steward requests/Global , 3 29 Wikimedia Forum , 4 27 Global message delivery/Targets/Tech ambassadors , 5 21 Stewards' noticeboard , 6 21 Steward requests/SUL requests , 7 19 Wiki Borregos CCM Student User Group/Summer session 2014 , 8 17 Steward requests/Global permissions , 9 17 Steward requests/Username changes , 10 15 OTRS/Volunteering , 11 13 Wikimedia Ghana/Events/Info Sessions , 12 13 Foundation wiki feedback , 13 13 Steward requests/Checkuser , 14 12 Alternative paid contribution disclosure policies , 15 11 Programa Catalisador do Brasil/Consulta sobre como fortalecer a Wikimedia no Brasil , 16 11 Wikimedia monthly activities meetings/2014-06 , 17 11 Wikimedia LGBT+/Participants , 18 10 Wiki Borregos CCM User Group/Summer session 2014 , 19 10 Fundraising/Translation/Thank you email 20140606/es , 20 10 Tech/News/2014/24 , 21 10 Egypt Wikimedians , 22 10 Meetup/London/82 , 23 10 CentralNotice/Calendar , 24 10 IRC office hours , 25 10 Translation of the week/Translation candidates

Jul 2014: 1 75 Steward requests/Permissions , 2 56 Steward requests/Username changes , 3 43 Steward requests/Global permissions , 4 40 CIS-A2K/Events/Wiki Loves Pride 2014 , 5 34 Global message delivery/Targets/Tech ambassadors , 6 34 Stewards' noticeboard , 7 30 Wikimedia Forum , 8 26 Wiki Borregos CCM User Group/Summer session 2014 , 9 25 Wikimedia Brazilian Group of Education and Research/User Group Proposal , 10 24 Steward requests/Global , 11 23 Foundation wiki feedback , 12 21 Reports , 13 19 Steward requests/SUL requests , 14 18 Steward requests/Checkuser , 15 15 OTRS/Volunteering , 16 13 Wikimedia Israel/Strategic Planning , 17 13 Wikimedia Foundation Board noticeboard , 18 12 Wikimedia genealogy project , 19 12 Global message delivery/Targets/Wikidata , 20 11 Wikimedia New York City/July 2014 , 21 10 Tech/News/2014/30 , 22 10 Tech/News/2014/29 , 23 10 IRC office hours , 24 10 OTRS/Personnel , 25 9 Wikimedia monthly activities meetings/2014-08

Aug 2014: 1 708 Letter to Wikimedia Foundation: Superprotect and Media Viewer/sig , 2 122 Requests for comment/Superprotect rights , 3 91 Steward requests/Username changes , 4 64 Steward requests/Permissions , 5 59 Steward requests/Global permissions , 6 41 GlobalCssJs , 7 39 Community Liaisons/Process ideas , 8 36 Steward requests/Global , 9 34 Wikimedia Forum , 10 29 Requests for comment/Distinguishing Wikimedia Foundation staff accounts for official actions and personal use , 11 29 Global message delivery/Targets/Tech ambassadors , 12 26 Wishes 2014 , 13 25 Foundation wiki feedback , 14 21 Stewards' noticeboard , 15 19 Wikimedia Foundation Board noticeboard , 16 18 Wiki Borregos CCM User Group/Fall semester 2014 , 17 18 OTRS/Volunteering , 18 17 Requests for comment/On a scale of billions , 19 15 Wikivoyage/Lounge , 20 14 Community Liaisons/Media Viewer consultation , 21 12 Wikimedians of Bulgaria , 22 12 Steward requests/Bot status , 23 11 CentralNotice/Calendar , 24 11 Reports , 25 11 Wikimedia News

Sep 2014: 1 195 Letter to Wikimedia Foundation: Superprotect and Media Viewer/sig , 2 166 Steward requests/Global permissions , 3 124 Steward requests/Username changes , 4 69 Steward requests/Permissions , 5 38 India Community Consultation 2014 , 6 37 Steward requests/Global , 7 30 Wikimedia Forum , 8 26 Requests for comment/Privacy violation by TBloemink and JurgenNL , 9 24 Monuments of Spain Challenge/Participantes , 10 24 Requests for comment/Superprotect rights , 11 24 Synchbot , 12 23 Global message delivery/Targets/Tech ambassadors , 13 23 Stewards' noticeboard , 14 22 Requests for comment/Creation of a global OTRS-permissions user group , 15 21 Foundation wiki feedback , 16 21 OTRS/Volunteering , 17 19 Gender gap strategy , 18 18 Tech , 19 17 Steward requests/Checkuser , 20 16 Community Liaisons/Media Viewer consultation , 21 16 Community Liaisons/Process ideas , 22 16 Request for an account on the Foundation wiki , 23 13 위키미디어 대한민국/창립 총회 , 24 13 Requests for comment/On a scale of billions , 25 13 IRC office hours

Oct 2014: 1 115 Steward requests/Username changes , 2 92 Steward requests/Permissions , 3 72 Steward requests/Global permissions , 4 66 Requests for comment/Global file deletion review , 5 54 Wikimedia Forum , 6 47 Monuments of Spain Challenge/Participantes , 7 41 Steward requests/Global , 8 36 Global message delivery/Targets/Structured Data on Commons , 9 35 Requests for comment/Creation of a global OTRS-permissions user group , 10 28 OTRS/Volunteering , 11 27 Global message delivery/Targets/Tech ambassadors , 12 27 Steward requests/Miscellaneous , 13 26 위키미디어 대한민국/창립 총회 , 14 22 Letter to Wikimedia Foundation: Superprotect and Media Viewer/sig , 15 18 Tech , 16 17 Request for an account on the Foundation wiki , 17 16 VisualEditor/Newsletter , 18 16 Steward requests/Checkuser , 19 15 Foundation wiki feedback , 20 14 Global message delivery/Targets/Learning Quarterly , 21 14 Stewards' noticeboard , 22 14 Steward requests/Bot status , 23 13 Wikimedia News , 24 12 File metadata cleanup drive , 25 12 Global message delivery/Targets/Wikidata

Nov 2014: 1 126 Steward requests/Username changes , 2 81 Steward requests/Permissions , 3 50 Steward requests/Global permissions , 4 40 Wikimedia Forum , 5 33 Steward requests/Global , 6 28 Requests for comment/Global file deletion review , 7 25 OTRS/Volunteering , 8 20 Foundation wiki feedback , 9 19 Wikimania 2016 bids/Manila/Local team , 10 19 Meetup/English South Coast 1 , 11 19 Stewards' noticeboard , 12 19 Request for an account on the Foundation wiki , 13 18 Wikimedia CEE Meeting 2014/Questions&Needs , 14 15 Global message delivery/Targets/Tech ambassadors , 15 15 Tech , 16 14 Requests for comment/Global AbuseFilter , 17 14 Requests for comment/Creation of a global OTRS-permissions user group , 18 13 Bengali Wikipedia 10th Anniversary Celebration Kolkata/Scholarships , 19 12 Global message delivery/Targets/Wikidata , 20 12 Synchbot , 21 11 Wikimedia CEE Meeting 2014/Programme , 22 11 Requests for comment/Inactive Global bot accounts , 23 11 Wikimedia monthly activities meetings/2014-11 , 24 11 Requests for new languages/Wikipedia Doteli , 25 10 Amical Wikimedia/October 2014

Dec 2014: 1 130 Steward requests/Username changes , 2 69 Steward requests/Global permissions , 3 66 Steward requests/Permissions , 4 42 OTRS/Volunteering , 5 41 Steward requests/Global , 6 35 Wikimedia Forum , 7 29 Steward requests/Checkuser , 8 27 Requests for new languages/Wikivoyage Arabic , 9 26 Wikimedia genealogy project , 10 23 WikiArabia/Agenda WikiArabia 2015 , 11 21 Tech , 12 20 Request for an account on the Foundation wiki , 13 18 Global message delivery/Targets/Tech ambassadors , 14 17 Bengali Wikipedia 10th Anniversary Celebration Kolkata/Scholarships , 15 13 CIS-A2K/Requests/Swatantra 2014 , 16 13 Wikimedia CEE Meeting 2014/Programme , 17 13 Foundation wiki feedback , 18 13 Translation of the week/Translation candidates , 19 12 Requests for comment/Jerks vs dicks , 20 12 Meetup/London/88 , 21 12 Global message delivery/Targets/Wikidata , 22 12 Steward requests/Bot status , 23 11 Wikimedia CEE Spring 2015/Contacts , 24 11 Wikimedia CEE Meeting 2014/Participants , 25 11 Steward requests/Miscellaneous

Jan 2015: 1 126 Steward requests/Username changes , 2 81 Steward requests/Global permissions , 3 58 Steward requests/Permissions , 4 56 Steward requests/Global , 5 48 CIS-A2K/Events/Train the Trainer Program/2015 , 6 44 Requests for new languages/Wikivoyage Arabic , 7 37 Stewards/Elections 2015/Questions , 8 34 Steward requests/Checkuser , 9 32 Wikimedia Forum , 10 29 OTRS/Volunteering , 11 26 Global message delivery/Targets/Tech ambassadors , 12 23 Stewards/Elections 2015 , 13 19 Stewards' noticeboard , 14 19 Steward requests/Bot status , 15 18 Wikimedia Community User Group Georgia , 16 17 Tech , 17 17 Foundation wiki feedback , 18 17 Steward requests/Miscellaneous , 19 15 Stewards/Elections 2015/Statements , 20 15 Global message delivery/Targets/Wikidata , 21 15 Synchbot , 22 13 Wikimedians of Latvia User Group , 23 13 Meetup/London/89 , 24 13 WikiArabia/Agenda WikiArabia 2015 , 25 12 Requests for new languages/Wikivoyage Urdu

Feb 2015: 1 395 Stewards/Elections 2015/Votes/MarcoAurelio , 2 318 Stewards/Elections 2015/Votes/DidiWeidmann , 3 311 Stewards/Elections 2015/Votes/Stryn , 4 310 Stewards/Elections 2015/Votes/Einsbor , 5 305 Stewards/Elections 2015/Votes/Avjoska , 6 303 Stewards/Elections 2015/Votes/Cekli829 , 7 303 Stewards/Elections 2015/Votes/Natuur12 , 8 290 Stewards/Elections 2015/Votes/Linedwell , 9 286 Stewards/Elections 2015/Votes/Ruy Pugliesi , 10 257 Stewards/Elections 2015/Votes/Pmlineditor , 11 257 Stewards/Elections 2015/Votes/Taketa , 12 254 Stewards/Elections 2015/Votes/Jusjih , 13 222 Stewards/Elections 2015/Votes/Vodomar , 14 219 Stewards/Elections 2015/Votes/Mys 721tx , 15 136 Stewards/Confirm/2015/DerHexer , 16 103 Stewards/Confirm/2015/Trijnstel , 17 101 Stewards/Confirm/2015/Elfix , 18 101 Steward requests/Username changes , 19 98 Stewards/Confirm/2015/billinghurst , 20 95 Stewards/Confirm/2015/Ajraddatz , 21 92 Stewards/Confirm/2015/Hoo man , 22 92 Synchbot , 23 90 Stewards/Confirm/2015/Vituzzu , 24 90 Stewards/Confirm/2015/Savh , 25 89 Stewards/Confirm/2015/MF-Warburg

Mar 2015: 1 169 Steward requests/Username changes , 2 125 Wikimedia Forum , 3 105 Steward requests/Global permissions , 4 66 Steward requests/Permissions , 5 56 Steward requests/Global , 6 35 100wikidays , 7 34 Steward requests/Miscellaneous , 8 33 OTRS/Volunteering , 9 26 Synchbot , 10 24 Global message delivery/Targets/Tech ambassadors , 11 24 Stewards' noticeboard , 12 23 Women and gender diversity on Wikimedia , 13 22 Proposals for closing projects/Closure of Siberian Tatar Wikipedia , 14 19 Wikimedia Conference 2015/Participants , 15 18 Requests for new languages/Wikipedia Goan Konkani , 16 18 Steward requests/Checkuser , 17 17 Women's History Month, India-2015/Events/Women's Day, Bangalore , 18 16 Steward requests/Bot status , 19 16 Vandalism reports , 20 15 Foundation wiki feedback , 21 15 OTRS/Personnel , 22 14 Address the gender gap/FAQ , 23 14 Wikimedia CEE Spring 2015/Structure , 24 13 Requests for comment/Removal of permanent access of admins in small wikis , 25 12 VisualEditor/Survey list 8

Apr 2015: 1 132 Steward requests/Username changes , 2 87 Steward requests/Permissions , 3 84 Steward requests/Global permissions , 4 59 Requests for comment/Confirmation of stewards/Comments , 5 54 Wikimedia Forum , 6 43 OTRS/Volunteering , 7 41 Steward requests/Global , 8 33 100wikidays , 9 32 Stewards' noticeboard , 10 30 Meetup/UNC/Women in Science , 11 26 Wikimedia Foundation elections/Board elections/2015/Candidates , 12 25 Merchandise giveaways/Nominations , 13 24 Steward requests/Checkuser , 14 22 Steward requests/Miscellaneous , 15 20 Foundation wiki feedback , 16 19 Requests for comment/Removal of bureaucrats in small wikis , 17 19 Global message delivery/Targets/Tech ambassadors , 18 19 Tech , 19 18 Wikimedia Foundation elections/FDC elections/2015/Candidates , 20 16 Reports , 21 14 Synchbot , 22 13 WikiConference Australia 2015 , 23 13 Steward requests/Bot status , 24 12 Amical Wikimedia/March 2015 , 25 12 CentralNotice/Calendar

May 2015: 1 205 Merchandise giveaways/Nominations , 2 98 Steward requests/Permissions , 3 78 Wikimedia Foundation nomail list , 4 77 Steward requests/Username changes , 5 63 Steward requests/Global , 6 58 Steward requests/Global permissions , 7 48 Wikimedia Forum , 8 37 100wikidays , 9 31 Community Tech/Project ideas , 10 31 Wikimedia Foundation elections/Board elections/2015/Questions/1 , 11 30 Wikimedia Foundation elections/Board elections/2015/Questions/2 , 12 29 Wikimedia Conference 2015/Social events , 13 29 Steward requests/Miscellaneous , 14 28 Wikimedia Foundation elections/Board elections/2015/Questions/3 , 15 28 Wikimedia Foundation elections/Board elections/2015/Candidates , 16 28 OTRS/Volunteering , 17 25 Wikimedia Foundation elections/Board elections/2015/Questions/4 , 18 23 Global message delivery/Targets/Tech ambassadors , 19 21 Steward requests/Checkuser , 20 19 Wikimedia Foundation elections/FDC elections/2015/Questions/1 , 21 16 Wikimedia Foundation elections/Board elections/2015/Candidates/ShortStatement , 22 16 Wikimedia Conference 2015/Programme/12 , 23 16 Wikimedia Conference 2015/Schedule , 24 16 Reports , 25 16 Wikimedia News

Jun 2015: 1 91 Steward requests/Global permissions , 2 86 Steward requests/Username changes , 3 82 Merchandise giveaways/Nominations , 4 79 Steward requests/Permissions , 5 52 Steward requests/Global , 6 41 100wikidays , 7 31 Wikimedia Forum , 8 25 Wikimedia Deutschland/PP16 , 9 24 Freedom of Panorama in Europe in 2015 , 10 24 Wikimedia Foundation elections 2015/Post mortem , 11 22 Community Tech/Project ideas , 12 21 OTRS/Volunteering , 13 19 Requests for comment/Neutrality of Wikipedia , 14 19 Global message delivery/Targets/Tech ambassadors , 15 17 CEE WikiCamp 2015/Participants , 16 15 WikiMedi , 17 14 Foundation wiki feedback , 18 14 Steward requests/Checkuser , 19 13 Stewards' noticeboard , 20 13 Synchbot , 21 13 Steward requests/Bot status , 22 12 Wikidata Community User Group , 23 10 Freedom of Panorama in Europe in 2015/Learn more , 24 10 Requests for comment/cs.wikisource admins , 25 10 Global message delivery/Targets/Wikidata

Jul 2015: 1 78 Steward requests/Username changes , 2 70 Steward requests/Global , 3 61 Steward requests/Permissions , 4 56 WikiWomen's User Group , 5 53 Wikimedia Forum , 6 52 Steward requests/Global permissions , 7 32 Wikimedia CEE Meeting 2015/Questions&Needs , 8 30 Wikimedia Deutschland/PP16/Ideen , 9 30 100wikidays , 10 23 OTRS/Volunteering , 11 20 Community Tech/Project ideas , 12 19 Freedom of Panorama in Europe in 2015/Banner , 13 19 Wikimedia Foundation Board noticeboard , 14 19 Global message delivery/Targets/Tech ambassadors , 15 19 Foundation wiki feedback , 16 17 Merchandise giveaways/Nominations , 17 16 Steward requests/Miscellaneous , 18 15 Tech/Ambassadors/List/2015 , 19 15 Steward requests/Checkuser , 20 13 Tech , 21 12 Wikipedia Asian Month/2015 Edition , 22 11 Stewards' noticeboard , 23 10 Freedom of Panorama in Europe in 2015 , 24 10 Requests for new languages/Wikipedia Southern Luri , 25 10 Wikimedia France/Micro-financement/2017-2018

Aug 2015: 1 103 Steward requests/Username changes , 2 92 Steward requests/Permissions , 3 82 Steward requests/Global permissions , 4 80 WikiConference India 2016/Community and Team/Volunteer Registration , 5 59 Steward requests/Global , 6 55 Learning and Evaluation/Community Health learning campaign/Questions , 7 55 Wikimedia Forum , 8 45 Requests for comment/Fundraising banner or Wiki Loves Monuments banner , 9 33 OTRS/Volunteering , 10 28 Merchandise giveaways/Nominations , 11 27 100wikidays , 12 27 Foundation wiki feedback , 13 25 Steward requests/Checkuser , 14 24 Learning and Evaluation/Community Health learning campaign/Participants , 15 23 Steward requests/Miscellaneous , 16 22 Global message delivery/Targets/Tech ambassadors , 17 18 Wikisource Community User Group/Wikisource Conference 2015/Participants , 18 14 Requests for comment/Global ban for Tobias Conradi , 19 14 WikiConference India 2016/Community and Team/Call for Volunteer Support , 20 13 Wikipedia for Peace 2015/Participants , 21 12 Wikimedia Argentina/Planificación Estratégica 2017-2018 , 22 12 Wikimedia Foundation Board noticeboard , 23 11 Global message delivery/Targets/Community Capacity Development , 24 11 Wikipedia for Peace 2015/Results , 25 11 Global message delivery/Targets/Wikidata

Sep 2015: 1 76 Steward requests/Username changes , 2 68 Steward requests/Permissions , 3 46 Steward requests/Global permissions , 4 45 Wikimedia Forum , 5 45 OTRS/Volunteering , 6 40 Merchandise giveaways/Nominations , 7 38 Steward requests/Global , 8 29 Global message delivery/Targets/Tech ambassadors , 9 23 100wikidays , 10 21 Tech , 11 19 The Wikipedia Library/OA week , 12 18 Wikipedia 15/Events/List , 13 16 Wikisource Community User Group/Wikisource Conference 2015/Participants , 14 16 Wikimedia CEE Meeting 2015/Programme , 15 16 Steward requests/Checkuser , 16 15 Wikimedians in Thailand/2015 Smithsonian APA , 17 15 Wikimedistas de Ecuador , 18 15 Foundation wiki feedback , 19 14 Requests for comment/Fundraising banner or Wiki Loves Monuments banner , 20 12 Global message delivery/Targets/Community Capacity Development , 21 12 Synchbot , 22 11 Iraqi Wikimedians , 23 11 Global message delivery/Targets/Wikidata , 24 11 Vandalism reports , 25 10 Steward requests/Bot status

Oct 2015: 1 77 Steward requests/Permissions , 2 71 Steward requests/Username changes , 3 54 Wikipedia Asian Month/Participants , 4 54 The Wikipedia Library/OA week , 5 41 Steward requests/Global , 6 39 WikiConference India 2016/City/First Bids , 7 38 Wikipedia Asian Month/2015 Edition , 8 35 Steward requests/Global permissions , 9 33 The Wikipedia Library/OA week/Progress/List , 10 32 Wikimedia Forum , 11 30 Tech , 12 26 Requests for comment/Global ban for Tobias Conradi , 13 26 Global message delivery/Targets/Tech ambassadors , 14 26 OTRS/Volunteering , 15 24 100wikidays , 16 21 CIS-A2K/Events/2015/Global Congress on Intellectual Property and the Public Interest , 17 20 Merchandise giveaways/Nominations , 18 20 Global message delivery/Targets/Wikidata , 19 19 Wikipedia Asian Month/Organizers , 20 18 Wikisource Community User Group/Wikisource Conference 2015/Participants , 21 16 EU policy/Big Fat Brussels Meeting - Episode 3 , 22 16 Steward requests/Checkuser , 23 15 Wiki labels/Interface translation/Edit quality , 24 15 Wikimedia News , 25 13 Steward requests/Miscellaneous

Nov 2015: 1 230 Community Wishlist Survey 2015 , 2 167 Bassel Khartabil/Banner/Straw poll/In favour , 3 100 Wikipedia Asian Month/Participants , 4 98 Bassel Khartabil/Banner/Straw poll/Against , 5 77 Steward requests/Permissions , 6 69 Steward requests/Global permissions , 7 57 Steward requests/Username changes , 8 53 Steward requests/Global , 9 48 Wikimedia Forum , 10 32 Community Wishlist Survey 2015/Editing , 11 31 Bassel Khartabil/Banner/Straw poll/Discussion , 12 31 Tech , 13 29 Community Wishlist Survey 2015/Watchlists , 14 27 Community Wishlist Survey 2015/Miscellaneous , 15 24 Community Wishlist Survey 2015/Moderation and admin tools , 16 22 Community Wishlist Survey 2015/Bots and gadgets , 17 22 Archives Challenge , 18 22 100wikidays , 19 20 Community Wishlist Survey 2015/Talk pages , 20 20 Wikisource Community User Group/Wikisource Conference 2015/Participants , 21 20 Stewards' noticeboard , 22 19 Community Wishlist Survey 2015/Notifications , 23 19 Wikipedia Asian Month/2015 Edition , 24 18 Community Wishlist Survey 2015/Templates , 25 18 Wikipedia Asian Month/Data

Dec 2015: 1 177 Community Wishlist Survey 2015/Editing , 2 149 Community Wishlist Survey 2015/Commons , 3 141 Requests for comment/Password policy for users with certain advanced permissions/support , 4 138 Community Wishlist Survey 2015/Bots and gadgets , 5 128 Community Wishlist Survey 2015/Watchlists , 6 122 Community Wishlist Survey 2015/Miscellaneous , 7 113 Community Wishlist Survey 2015/Moderation and admin tools , 8 102 Community Wishlist Survey 2015/Categories , 9 100 Community Wishlist Survey 2015/Wikisource , 10 100 Steward requests/Permissions , 11 89 Community Wishlist Survey 2015/Templates , 12 84 Community Wishlist Survey 2015/Talk pages , 13 83 Steward requests/Global , 14 80 Community Wishlist Survey 2015/Wikidata , 15 71 Wikipedia 15/Events/List , 16 68 Steward requests/Username changes , 17 67 Steward requests/Global permissions , 18 58 Community Wishlist Survey 2015/Multimedia , 19 58 Community Wishlist Survey 2015/Notifications , 20 57 Community Wishlist Survey 2015/Search , 21 43 Community Wishlist Survey 2015/Reading , 22 37 Wikimedia Forum , 23 35 Requests for comment/Password policy for users with certain advanced permissions/oppose , 24 31 GLAMing Madrid Challenge/Participants , 25 31 Community Wishlist Survey 2015/Special pages

Jan 2016: 1 317 Requests for comment/Vote of no confidence on Arnnon Geshuri/sig , 2 159 Requests for comment/Global ban request for Messina , 3 102 Steward requests/Permissions , 4 91 CIS-A2K/Events/Geographical Indications in India Edit-a-thon/Participants , 5 89 There is also a Wikipedia in your language , 6 86 Wikipedia 15/Events/List , 7 75 Steward requests/Global permissions , 8 66 Steward requests/Global , 9 64 Steward requests/Username changes , 10 46 Requests for comment/Vote of no confidence on Arnnon Geshuri , 11 43 CIS-A2K/Events/Geographical Indications in India Edit-a-thon/Articles , 12 40 Wikimedia Forum , 13 29 Stewards/Elections 2016/Questions , 14 29 Foundation wiki feedback , 15 27 Wikipedia 15/Events/Mumbai, India , 16 27 Wikipedia 15/Events/Bangalore , 17 26 Wikipedia Goa Village Poject , 18 26 Wikimedia CEE Spring 2016 , 19 26 Saanjh , 20 26 Learning and Evaluation/News/Pre-conference for Wikimedia Conference 2016 , 21 25 Global message delivery/Targets/Tech ambassadors , 22 25 Tech , 23 24 Merchandise giveaways/Nominations , 24 23 Requests for comment/Turkish Wikipedia blocking policy violation , 25 23 Wikimedia Conference 2016/Participants' List

Feb 2016: 1 362 Stewards/Elections 2016/Votes/Masti , 2 359 Stewards/Elections 2016/Votes/BlackBeast , 3 345 Stewards/Elections 2016/Votes/Cekli829 , 4 334 Stewards/Elections 2016/Votes/NahidSultan , 5 332 Stewards/Elections 2016/Votes/Hindustanilanguage , 6 313 Stewards/Elections 2016/Votes/Érico , 7 289 Stewards/Elections 2016/Votes/Rxy , 8 280 Stewards/Elections 2016/Votes/Viswaprabha , 9 269 Stewards/Elections 2016/Votes/Richwales , 10 238 Stewards/Elections 2016/Votes/MIKHEIL , 11 216 Stewards/Elections 2016/Votes/Matiia , 12 213 Stewards/Elections 2016/Votes/Syum90 , 13 197 Stewards/Confirm/2016/DerHexer , 14 153 Stewards/Elections 2016/Votes/Defender , 15 119 Stewards/Elections 2016/Votes/Tufor , 16 116 Stewards/Confirm/2016/Vituzzu , 17 112 Stewards/Confirm/2016/Hoo man , 18 109 Stewards/Confirm/2016/Barras , 19 104 Stewards/Confirm/2016/MF-Warburg , 20 102 Stewards/Confirm/2016/Ajraddatz , 21 102 Stewards/Confirm/2016/MarcoAurelio , 22 100 Stewards/Confirm/2016/Trijnstel , 23 95 Steward requests/Permissions , 24 90 Stewards/Confirm/2016/M7 , 25 85 Stewards/Confirm/2016/Mardetanha

Mar 2016: 1 77 Steward requests/Global , 2 72 Steward requests/Permissions , 3 68 Steward requests/Global permissions , 4 46 Steward requests/Username changes , 5 34 Wikimedia Forum , 6 25 Global message delivery/Targets/Tech ambassadors , 7 24 Affiliate-selected Board seats/2016/Questions , 8 22 Steward requests/Bot status , 9 21 Requests for new languages/Wikipedia Ancient Greek 4 , 10 20 Merchandise giveaways/Nominations , 11 19 Tech , 12 18 100wikidays , 13 18 OTRS/Volunteering , 14 17 Sustainability Initiative , 15 17 Proposals for closing projects/Move Beta Wikiversity to Incubator , 16 16 Wikimedia CEE Spring 2016/Local rules , 17 16 Requests for comment/Global usurpation policy 2 , 18 15 Wiki Project Med , 19 15 Steward requests/Miscellaneous , 20 14 WikiConvention francophone/2016/Participants , 21 14 Foundation wiki feedback , 22 13 Wikimania Women , 23 13 Wikimedia CEE Spring 2016/Participants , 24 13 Learning and Evaluation/News/Pre-conference for Wikimedia Conference 2016 , 25 12 Affiliate-selected Board seats/2016/Nominations/Nataliia Tymkiv

Apr 2016: 1 94 Wikipedia to the Moon/Discussion , 2 89 Steward requests/Global , 3 70 Steward requests/Permissions , 4 70 Steward requests/Global permissions , 5 46 Requests for comment/Global ban for WayneRay , 6 42 Wikimedia Forum , 7 38 Wikipedia to the Moon , 8 35 Steward requests/Username changes , 9 35 OTRS/Volunteering , 10 30 WikiCite 2016 , 11 30 WikiConvention francophone/2016/Participants , 12 28 Writing week/Brussels/Participants , 13 24 Writing week/Brussels/Contributions , 14 23 Foundation wiki feedback , 15 23 Steward requests/Miscellaneous , 16 19 Wikimedia Conference 2016/Program/28 , 17 19 Wikimedia Conference 2016/Social events , 18 19 Global message delivery/Targets/Tech ambassadors , 19 19 Steward requests/Checkuser , 20 18 Sustainability Initiative , 21 17 Wikimedia Foundation Board Governance Committee/Wikimania 2016 training , 22 17 Wikipedia to the Moon/fr , 23 17 Wikimedia Foundation Annual Plan/2016-2017/draft , 24 17 Reports , 25 15 Wikipedia to the Moon/de

May 2016: 1 76 Steward requests/Permissions , 2 66 Steward requests/Global permissions , 3 64 Steward requests/Global , 4 52 Merchandise giveaways/Nominations , 5 46 Steward requests/Username changes , 6 42 WikiConference India 2016/Logo Challenge , 7 42 Global message delivery/Targets/Tech ambassadors , 8 41 Wikimedia Forum , 9 37 Wikimedia CEE Meeting 2016/Needs , 10 34 WikiConference North America , 11 28 WikiConference India 2016/Scholarships , 12 27 IIT Bombay Pre-Hackathon Workshop 2016 , 13 24 Steward requests/Miscellaneous , 14 21 WikiConvention francophone/2016/Participants , 15 21 Steward requests/Checkuser , 16 20 WikiCite 2016 , 17 20 OTRS/Volunteering , 18 19 Meetup/London/106 , 19 19 Global message delivery/Targets/Wikidata , 20 17 Sustainability Initiative , 21 17 Foundation wiki feedback , 22 15 Steward requests/Bot status , 23 14 Affiliate-selected Board seats/2016/Voted , 24 13 Requests for comment , 25 13 Reports

Jun 2016: 1 155 Wikipedia to the Moon/Voting , 2 78 Steward requests/Global , 3 74 Steward requests/Permissions , 4 60 Steward requests/Global permissions , 5 46 Steward requests/Username changes , 6 30 Wikimedia CEE Meeting 2016/Needs , 7 30 Global message delivery/Targets/Tech ambassadors , 8 27 WikiIndaba conference 2017/Participants , 9 26 100wikidays , 10 24 Wikimedia Forum , 11 24 Steward requests/Checkuser , 12 23 Learning and Evaluation/News/Learning Day for Wikimania Esino Lario , 13 23 Wikipedia Asian Month 2016 , 14 21 Communications/Wikimania 2016 , 15 20 DARM Challenge/Participants , 16 19 Foundation wiki feedback , 17 18 Wikimedia Foundation Executive Director Transition Team/2016/Community input , 18 17 WikiConvention francophone/2016/Participants , 19 15 Wikimédia France/Documents/Communication/Le gouvernement français privatise le domaine public , 20 14 Global message delivery/Targets/Wikidata , 21 14 Vandalism reports , 22 13 Merchandise giveaways/Nominations , 23 13 Steward requests/Miscellaneous , 24 10 WMCEE Calendar 2016 , 25 10 CentralNotice/Calendar

Jul 2016: 1 74 Steward requests/Permissions , 2 72 Steward requests/Global , 3 46 100wikidays , 4 42 Steward requests/Username changes , 5 39 Steward requests/Global permissions , 6 38 Global message delivery/Targets/Tech ambassadors , 7 34 Wikimedia Forum , 8 28 WikiConference India 2016/Call for Participation , 9 28 Steward requests/Miscellaneous , 10 26 WikiConference India 2016/Punjab Edit-a-thon , 11 20 Requests for comment/Designated space for editors to give and seek advice about topic bans and other sanctions , 12 20 Steward requests/Checkuser , 13 19 Global message delivery/Targets/Wikidata , 14 18 Wikimedia Deutschland/Jahresplanung 2017/Partizipationsphase/Schwerpunkt 4/Abstimmung , 15 18 WikiConference India 2016 , 16 17 WMIN/Events/India At Rio Olympics 2016 Edit-a-thon/Participants , 17 16 WikiConference India 2016/Submissions/Education Programs in India , 18 15 WikiConference India 2016/Submissions/Bengali Wikipedia-an introspection about the relationship between Bangladesh and West Bengal, India , 19 15 Participate in communities - User Group of Belarus grant application , 20 15 Wikimedia CEE Meeting 2016/Programme , 21 15 Wikimedia CEE Meeting 2016/Needs , 22 15 Merchandise giveaways/Nominations , 23 14 Wikimedia Tunisie/Workshops/Nabeul Language Village , 24 14 Wikimedia Deutschland/Jahresplanung 2017/Partizipationsphase , 25 14 WikiConvention francophone/2016/Participants

Aug 2016: 1 89 Steward requests/Permissions , 2 87 Steward requests/Global , 3 68 Steward requests/Username changes , 4 47 Wiki Loves the Olympics/Participants , 5 46 WMIN/Events/India At Rio Olympics 2016 Edit-a-thon/Participants , 6 45 WMIN/Events/India At Rio Olympics 2016 Edit-a-thon/Articles , 7 42 100wikidays , 8 42 Steward requests/Global permissions , 9 40 Global message delivery/Targets/Tech ambassadors , 10 35 Wikimedia CEE Meeting 2016/Travel/Tours , 11 30 Wikimedia Forum , 12 28 WikiConference India 2016/Chandigarh Hackathon , 13 26 Steward requests/Miscellaneous , 14 22 WikiConvention francophone/2016/Programme/Apéro « la festicabale monte à Paris » , 15 22 Wikimedia CEE Meeting 2016/Programme , 16 19 Copyright strategy/Issues , 17 18 Stewards' noticeboard , 18 17 WikiConvention francophone/2016/Participants , 19 16 Wikipedia for Peace 2016/Participants , 20 16 Tech , 21 15 WMIN/Events/India At Rio Olympics 2016 Edit-a-thon , 22 15 Foundation wiki feedback , 23 15 OTRS/Volunteering , 24 12 WikiWomen/Mangaluru/Meetup/1 , 25 12 WikiConvention francophone/2016/Programme/Excursion photo

Sep 2016: 1 80 Steward requests/Global , 2 56 Steward requests/Username changes , 3 53 Steward requests/Permissions , 4 45 Global Collaboration/Newsletter/Subscribe , 5 44 100wikidays , 6 40 Steward requests/Global permissions , 7 28 Copyright strategy/Issues , 8 27 Steward requests/Checkuser , 9 27 Steward requests/Miscellaneous , 10 25 OTRS/Volunteering , 11 24 Whose Knowledge? , 12 24 Wikimedia Forum , 13 23 Global message delivery/Targets/Tech ambassadors , 14 21 Merchandise giveaways/Nominations , 15 17 Wiki Loves the Olympics/Participants , 16 16 Foundation wiki feedback , 17 14 Wikimedia CEE Meeting 2017/Bids , 18 13 Content Translation Workshop, Ezhimala (Kerala) , 19 13 Vandalism reports , 20 12 MassMessage/Lists/Wikimedia Norge newsletter , 21 11 Request for an account on the Foundation wiki , 22 10 Վիքիպեդիա:Համագործակցություն/Ամրոցների մրցույթ/Մասնակիցներ , 23 10 Wikimedia CEE Spring 2016/Results , 24 9 Meetup/London/111 , 25 9 Requests for comment/Bureaucrats on small wikis

Oct 2016: 1 94 Steward requests/Global , 2 70 Steward requests/Permissions , 3 56 Steward requests/Global permissions , 4 53 Wikimedia Forum , 5 45 Steward requests/Username changes , 6 36 100wikidays , 7 31 Wikipedia Asian Month 2016 , 8 31 Global message delivery/Targets/Tech ambassadors , 9 25 ItWikiCon/2017/Partecipanti , 10 25 WikiIndaba conference 2017/Questions & Needs , 11 24 Terms of use/Creative Commons 4.0 , 12 22 Wikipedia Asian Month/Status , 13 21 Wikipedia Asian Month/Participants , 14 19 Global Collaboration/Newsletter/Subscribers , 15 19 OTRS/Volunteering , 16 19 Steward requests/Bot status , 17 16 Merchandise giveaways/Nominations , 18 16 Steward requests/Miscellaneous , 19 15 Whose Knowledge? , 20 15 Tech , 21 13 Terms of use/Creative Commons 4.0/de , 22 13 Foundation wiki feedback , 23 13 Steward requests/Checkuser , 24 12 Wikimedia News , 25 11 Meetup/Cambridge/32

Nov 2016: 1 188 Community Wishlist Survey 2016/Categories/Miscellaneous , 2 126 Community Wishlist Survey 2016/Categories/Editing , 3 120 Community Wishlist Survey 2016/Categories/Bots and gadgets , 4 96 Community Wishlist Survey 2016/Categories/Wikidata , 5 84 Community Wishlist Survey 2016/Categories/Commons , 6 77 Community Wishlist Survey 2016/Categories/Watchlists , 7 70 Community Wishlist Survey 2016/Categories/Multimedia , 8 70 Steward requests/Permissions , 9 62 Community Wishlist Survey 2016/Categories/Admins and stewards , 10 62 Steward requests/Global , 11 57 Steward requests/Global permissions , 12 56 Community Wishlist Survey 2016/Categories/Reading , 13 49 Community Wishlist Survey 2016/Categories/Wikisource , 14 49 Community Wishlist Survey 2016/Categories/Search , 15 49 Community Wishlist Survey 2016/Categories/Moderation tools , 16 46 Steward requests/Username changes , 17 45 WikiIndaba conference 2017/Questions & Needs , 18 43 Wikimedia Forum , 19 39 Community Wishlist Survey 2016/Categories/Programs and events , 20 33 Merchandise giveaways/Nominations , 21 32 Wikipedia Asian Month/late submit , 22 31 OTRS/Volunteering , 23 30 Requests for comment/Abandoned Labs tools , 24 29 100wikidays , 25 27 Community Wishlist Survey 2016/Categories/WikiProjects

Dec 2016: 1 199 Community Wishlist Survey 2016/Categories/Editing , 2 190 Community Wishlist Survey 2016/Categories/Bots and gadgets , 3 186 Community Wishlist Survey 2016/Categories/Miscellaneous , 4 155 Community Wishlist Survey 2016/Categories/Wikidata , 5 131 Community Wishlist Survey 2016/Categories/Watchlists , 6 128 Community Wishlist Survey 2016/Categories/Moderation tools , 7 122 Community Wishlist Survey 2016/Categories/Multimedia , 8 120 Community Wishlist Survey 2016/Categories/Admins and stewards , 9 111 Community Wishlist Survey 2016/Categories/Commons , 10 97 Community Wishlist Survey 2016/Categories/Wikisource , 11 94 Community Wishlist Survey 2016/Categories/Reading , 12 92 Community Wishlist Survey 2016/Categories/WikiProjects , 13 91 Community Wishlist Survey 2016/Categories/Search , 14 84 Steward requests/Global , 15 74 Community Wishlist Survey 2016/Categories/Citations , 16 72 Community Wishlist Survey 2016/Categories/Mobile and apps , 17 70 Steward requests/Permissions , 18 66 Community Wishlist Survey 2016/Categories/Programs and events , 19 47 Steward requests/Username changes , 20 45 Steward requests/Global permissions , 21 42 Wikipedia Asian Month/late submit , 22 39 Wikimedians of Nepal/Wiki Gender Gap Program Nepal/BBC 100 Women Editathon , 23 35 Wikimedia Forum , 24 32 Community Wishlist Survey 2016/Categories/Wiktionary , 25 31 Sustainability Initiative

Jan 2017: 1 560 Community Engagement Insights/Thank you , 2 110 Steward requests/Global permissions , 3 92 Steward requests/Permissions , 4 74 Steward requests/Global , 5 68 Sustainability Initiative , 6 58 Steward requests/Username changes , 7 40 The Women You Have Never Met , 8 38 Merchandise giveaways/Nominations , 9 32 100wikidays , 10 31 Global message delivery/Targets/Tech ambassadors , 11 30 Learning and Evaluation/News/Learning Days for Wikimedia Conference 2017 , 12 28 Steward requests/Miscellaneous , 13 27 10 Wikiweeks/Participants , 14 24 Wikimedia Forum , 15 23 The Wikipedia Library/1Lib1Ref , 16 22 Wikimedia Conference 2017/Participants' List , 17 20 Wikimedia CEE Spring 2017/Participants , 18 18 Wikimedia Tunisie/First meeting 2017 , 19 17 Tech , 20 16 Stewards/Elections 2017/Questions , 21 15 Global message delivery/Targets/Structured Data on Commons , 22 15 Steward requests/Checkuser , 23 14 OTRS/Volunteering , 24 13 Steward requests/Bot status , 25 12 Global message delivery/Targets/Wikidata

Feb 2017: 1 358 Stewards/Elections 2017/Votes/Cekli829 , 2 326 Stewards/Elections 2017/Votes/Matiia , 3 322 Stewards/Elections 2017/Votes/HakanIST , 4 296 Stewards/Elections 2017/Votes/Sjoerddebruin , 5 290 Stewards/Elections 2017/Votes/Defender , 6 265 Stewards/Elections 2017/Votes/Ellywa , 7 257 Stewards/Elections 2017/Votes/Hindustanilanguage , 8 203 Stewards/Confirm/2017/DerHexer , 9 167 Community Engagement Insights/Thank you , 10 109 Stewards/Confirm/2017/MF-Warburg , 11 107 Stewards/Confirm/2017/Hoo man , 12 107 Stewards/Confirm/2017/Ajraddatz , 13 106 Stewards/Confirm/2017/Vituzzu , 14 99 Stewards/Confirm/2017/MarcoAurelio , 15 96 Stewards/Confirm/2017/Matanya , 16 93 Stewards/Confirm/2017/Trijnstel , 17 91 Stewards/Confirm/2017/Barras , 18 91 Steward requests/Global permissions , 19 89 Steward requests/Permissions , 20 85 Stewards/Confirm/2017/Savh , 21 85 Stewards/Confirm/2017/Avraham , 22 83 Stewards/Confirm/2017/Masti , 23 81 Stewards/Confirm/2017/Bsadowski1 , 24 81 Stewards/Confirm/2017/RadiX , 25 79 Stewards/Confirm/2017/NahidSultan

Mar 2017: 1 108 Wikimedia and Libraries User Group , 2 88 Steward requests/Permissions , 3 71 Steward requests/Global , 4 51 Wikimedia Conference 2017/Thematic, regional, language-specific meetups , 5 49 Steward requests/Username changes , 6 43 Wikimedia Forum , 7 42 Strategy/Wikimedia movement/2017/Updates/Signup , 8 41 Strategy/Wikimedia movement/2017/Outreach/List , 9 38 100wikidays , 10 36 Global message delivery/Targets/Tech ambassadors , 11 33 Marathi Wikipedia Edit-a-thon on Environment Management at CSIBER, Kolhapur, India , 12 29 Hardware donation program/Aliva Sahoo , 13 28 Hardware donation program/Moheen Reeyad , 14 25 Strategy/Wikimedia movement/2017/People/Strategy coordinators , 15 25 16 African Women Translate-a-thon/participants , 16 24 Commons Photographers User Group , 17 22 Wikimedia Conference 2017/Program/49 , 18 22 Steward requests/Global permissions , 19 21 Learning and Evaluation/News/Learning Days for Wikimedia Conference 2017/Education session , 20 20 Wikimaps User Group , 21 20 Karavali Wikimedians/Events/Tulu Wikipedia Policy Creation Workshop at Sri Ramakrishna Pre-University College , 22 19 Hardware donation program/Bodhisattwa , 23 19 Strategy/Wikimedia movement/2017/Outreach , 24 19 Learning and Evaluation/100 Words Campaign , 25 18 Wikimedia Conference 2017/Sweets of the world

Apr 2017: 1 92 Steward requests/Global , 2 82 UNESCO Challenge/Participants , 3 79 Response to 2017 ban in Turkey , 4 75 Sustainability Initiative/List of supporters , 5 75 Steward requests/Permissions , 6 54 Wikimedia Foundation elections/2017/Board of Trustees/Questions/Submitted/1 , 7 54 Steward requests/Username changes , 8 41 Strategy/Wikimedia movement/2017/Outreach/List , 9 38 WikiConvention francophone/2017/Idées/Nouveau logo , 10 38 Steward requests/Global permissions , 11 37 Wikimedia Forum , 12 31 Global message delivery/Targets/Tech ambassadors , 13 30 100wikidays , 14 29 OTRS/Volunteering , 15 28 100wikidays/CEE women , 16 25 Stewards' noticeboard , 17 24 Wikimedia and Libraries User Group , 18 23 Wikimedia Foundation elections/2017/Board of Trustees/Candidates , 19 22 Wikimédia France/Wikilettre/Numéro 81 , 20 22 Merchandise giveaways/Nominations , 21 19 Steward requests/Miscellaneous , 22 16 Foundation wiki feedback , 23 15 Wikimedia Conference 2017/Social Events/Some sights tour , 24 14 West Bengal Wikimedians/Resolutions/April 2017 , 25 14 Reports

May 2017: 1 2330 Response to 2017 ban in Turkey/Sig , 2 1130 Response to 2017 ban in Turkey , 3 68 Steward requests/Global permissions , 4 64 Steward requests/Permissions , 5 64 Steward requests/Global , 6 54 UNESCO Challenge/Participants , 7 40 WikiCite 2017/Program , 8 38 Steward requests/Username changes , 9 36 Wikimedia Forum , 10 33 Requests for comment/Global centralnotice for the blockade of the Turkish government , 11 30 Wikimedia Foundation nomail list , 12 26 Commons Photographers User Group , 13 24 100wikidays/CEE women , 14 24 Tech , 15 23 Global message delivery/Targets/Tech ambassadors , 16 21 OTRS/Volunteering , 17 20 Wikimedia Tool Developers Group , 18 20 100wikidays , 19 19 Requests for new languages/Wikipedia Atikamekw , 20 19 Foundation wiki feedback , 21 19 Steward requests/Miscellaneous , 22 18 Met Open Access Artworks Challenge/Participants , 23 18 Wikimedia Foundation elections/2017/Funds Dissemination Committee/Candidates , 24 18 Stewards' noticeboard , 25 16 Wiki Loves Africa 2016/Team survey

Jun 2017: 1 129 Wikipedia & Education User Group , 2 101 Wikimedians of Mainland China/Members , 3 65 Steward requests/Global , 4 55 Steward requests/Permissions , 5 49 Response to 2017 ban in Turkey/Sig , 6 45 Steward requests/Global permissions , 7 43 Steward requests/Username changes , 8 29 100wikidays , 9 27 WikiConvention francophone/2017/Participant-e-s , 10 24 Wikimedia GLAM User Group , 11 24 WikiWomenCamp 2017/Participants , 12 24 Wikimedia Forum , 13 23 Global message delivery/Targets/Tech ambassadors , 14 21 Wikimédia France/Wikilettre/Numéro 83/Brouillon , 15 20 Requests for comment/Global centralnotice for the blockade of the Turkish government , 16 20 Requests for comment/Global ban for Yahadzija , 17 20 Steward requests/Checkuser , 18 19 100wikidays/Levant women , 19 18 Steward requests/Miscellaneous , 20 17 Karavali Wikimedians/Events/Kannada and Tulu Editathon at Sri Ramakrishna Pre-University College , 21 17 Translating Ibero-America 2017/Participants 2017 , 22 17 Wikimedia Foundation elections/2017/Funds Dissemination Committee/Questions/Submitted/1 , 23 16 Met Open Access Artworks Challenge/Participants , 24 16 Learning and Evaluation/News/Learning Days for Wikimania Montreal , 25 15 Affiliations Committee/Candidates/June 2017

Jul 2017: 1 98 Merchandise giveaways/Nominations , 2 89 Steward requests/Global , 3 57 Steward requests/Permissions , 4 51 Steward requests/Global permissions , 5 49 Wikimedia Diversity Conference 2017/Ambassadors , 6 47 Steward requests/Username changes , 7 35 Global message delivery/Targets/Structured Data on Commons , 8 31 Wikimedia Deutschland/Planung 2018/Alpha , 9 29 Learning and Evaluation/News/Learning Days for Wikimania Montreal , 10 26 Wikimedia Forum , 11 23 Wikimedia Diversity Conference 2017/Participants , 12 21 Global message delivery/Targets/Tech ambassadors , 13 20 100wikidays , 14 19 OTRS/Volunteering , 15 19 Steward requests/Checkuser , 16 18 Hər cümə 1 saatlıq etiraz , 17 18 Wikimedians of Mainland China/Members , 18 18 Steward requests/Bot status , 19 17 Wikimedians of the Levant/2017 elections , 20 16 Wikimédia France/Assemblée générale/septembre 2017/Feuille de présence , 21 16 Wikimédia France/Assemblée générale/septembre 2017 , 22 16 Tech , 23 15 Steward requests/Miscellaneous , 24 14 Proposals for closing projects/Move Beta Wikiversity to Incubator 2 , 25 14 Wikimedia GLAM User Group

Aug 2017: 1 123 Wikimedia Cuteness Association , 2 95 Wikimédia France/Assemblée générale/septembre 2017/Points à ajouter à l'ordre du jour , 3 82 Steward requests/Global , 4 65 Wikimédia France/Assemblée générale/septembre 2017/Feuille de présence , 5 57 Requests for comment/Clarification to CU policy , 6 53 Steward requests/Permissions , 7 50 Steward requests/Global permissions , 8 47 Affiliations Committee/Candidates/June 2017 , 9 46 Wikimedia Forum , 10 45 Requests for comment/wikimedia-l-post-limits , 11 42 Global message delivery/Targets/Tech ambassadors , 12 41 Steward requests/Username changes , 13 31 Wikimedia Diversity Conference 2017/Participants , 14 29 100wikidays , 15 29 Merchandise giveaways/Nominations , 16 24 WikiConvention francophone/2017/Participant-e-s , 17 23 Wikimédia France/Assemblée générale/septembre 2017/Procurations , 18 23 Wikimedians of Mainland China/Resolutions/Logo , 19 23 Foundation wiki feedback , 20 22 Global message delivery/Targets/Structured Data on Commons , 21 22 Wikimédia France/Assemblée générale/septembre 2017 , 22 21 Hardware donation program/Ram Prasad Joshee , 23 21 Strategy/Wikimedia movement/2017/Direction , 24 21 Affiliate Chairpersons meeting August 12 2017 , 25 20 Muj(lh)eres latinoamericanas en Wikimedia

Sep 2017: 1 91 Steward requests/Global , 2 84 Requests for comment/Interlinking of accounts involved with paid editing to decrease impersonation , 3 81 Steward requests/Permissions , 4 44 Requests for comment/Interlinking of accounts involved with paid editing to decrease impersonation/Votes , 5 41 Wikimédia France/Assemblée générale/septembre 2017/Feuille de présence , 6 40 Wikimedia Cuteness Association , 7 39 Affiliations Committee/Candidates/June 2017 , 8 36 Steward requests/Global permissions , 9 34 100wikidays , 10 32 Steward requests/Username changes , 11 31 Karavali Wikimedians/Events/Tulu Wikipedia Anniversary Program and editathon at Sri Ramakrishna Pre-University College , 12 31 Wikimedia Forum , 13 26 Karavali Wikimedians/Members , 14 24 WikiConvention francophone/2017/Participant-e-s , 15 24 Global message delivery/Targets/Tech ambassadors , 16 22 Wikimédia France/Assemblée générale/octobre 2017/Feuille de présence , 17 21 Wikimédia France/Assemblée générale/octobre 2017 , 18 18 Wikimedia CEE Meeting 2017/Programme , 19 18 OTRS/Volunteering , 20 18 Steward requests/Checkuser , 21 17 WikiVolunteers User Group (proposed) , 22 17 Sustainability Initiative/List of supporters , 23 16 Wikimédia France/Assemblée générale/septembre 2017/Procurations , 24 15 Tech , 25 14 Steward requests/Miscellaneous

Oct 2017: 1 206 Strategy/Wikimedia movement/2017/Direction/Endorsement , 2 195 Bridges across Cultures/Participants/signs , 3 80 Steward requests/Global , 4 75 Steward requests/Permissions , 5 53 Bhubaneswar Heritage Edit-a-thon/Participants , 6 52 Steward requests/Username changes , 7 49 Wikipedia Asian Month 2017 , 8 48 Global message delivery/Targets/Structured Commons focus group , 9 43 Requests for comment/Global ban of INeverCry , 10 28 Wikimedia Forum , 11 25 Global message delivery/Targets/Tech ambassadors , 12 24 Wikimedia Diversity Conference 2017/Travel guide , 13 24 Global message delivery/Targets/Structured Data on Commons , 14 23 ItWikiCon/2017/Partecipanti , 15 22 Strategy/Wikimedia movement/2017/Direction/Endorsement/Concerns , 16 22 WikiConvention francophone/2017/Participant-e-s , 17 22 Steward requests/Miscellaneous , 18 21 100wikidays , 19 21 OTRS/Volunteering , 20 20 Requests for comment/Ongoing issues at Chinese Wikipedia/Previous discussion , 21 20 Steward requests/Checkuser , 22 19 Reports , 23 18 Bhubaneswar Heritage Edit-a-thon/Report contribution , 24 18 Karavali Wikimedians/Events/Tulu Wikipedia Anniversary Program editathon-2 at Sri Ramakrishna Pre-University College , 25 18 Wikimedia Sverige and Higher Education/Uppsala University/Course in Introduction to Scientific Research

Nov 2017: 1 91 Community Wishlist Survey 2017/Miscellaneous/Kartographer improvements , 2 85 Requests for comment/Global ban of INeverCry 2 , 3 76 Bridges across Cultures/Participants/signs , 4 76 Steward requests/Global , 5 63 Community Wishlist Survey 2017/Multimedia and Commons/Support 360 photo viewing , 6 61 Community Wishlist Survey 2017/Editing/Ping users from the edit summary , 7 60 Proposals for closing projects/Closure of Cebuano Wikipedia , 8 56 Wikimédia France/Assemblée générale/décembre 2017/Feuille de présence , 9 53 Community Wishlist Survey 2017/Multimedia and Commons/SVG-Translate , 10 52 Steward requests/Permissions , 11 49 Strategy/Wikimedia movement/2017/Direction/Endorsement , 12 47 Community Wishlist Survey 2017/Editing/Infobox wizard , 13 47 Community Wishlist Survey 2017/Watchlists/Multiple watchlists , 14 46 Community Wishlist Survey 2017/Search/Blame tool , 15 45 Community Wishlist Survey 2017/Admins and stewards/Make AbuseFilter easy to use for nontechnical admins by making filter editing more visual , 16 44 Community Wishlist Survey 2017/Anti-harassment/Allow a second email address , 17 43 Community Wishlist Survey 2017/Multimedia and Commons/Flickr-like uploader , 18 43 Steward requests/Username changes , 19 40 Community Wishlist Survey 2017/Admins and stewards/Allow further user block options (\"can edit XY\" etc.) , 20 39 Community Wishlist Survey 2017/Watchlists/Automatically unwatch pages after a certain, user defined, amount of time , 21 38 Community Wishlist Survey 2017/Miscellaneous/Allow 'thanks' notification for a log entry , 22 38 Community Wishlist Survey 2017/Bots and gadgets/Commons deletion notification bot , 23 38 Community Wishlist Survey 2017/Admins and stewards/Make 2FA easier to use , 24 38 Wikipedia Asian Month 2017 , 25 37 Community Wishlist Survey 2017/Editing/VisualEditor: Allow references to be named

Dec 2017: 1 86 Community Wishlist Survey 2017/Programs and events/Development of the programs and events dashboard , 2 82 Community Wishlist Survey 2017/Bots and gadgets/Deploy Article Alerts to other languages , 3 77 Community Wishlist Survey 2017/Editing/Ping users from the edit summary , 4 76 Steward requests/Permissions , 5 74 Steward requests/Global , 6 70 Community Wishlist Survey 2017/Search/Blame tool , 7 69 Community Wishlist Survey 2017/Editing/Auto-save feature in Visual Editor and WikiText Editor , 8 68 Community Wishlist Survey 2017/Miscellaneous/Kartographer improvements , 9 67 Community Wishlist Survey 2017/Editing/Infobox wizard , 10 62 Community Wishlist Survey 2017/Bots and gadgets/Commons deletion notification bot , 11 61 Community Wishlist Survey 2017/Miscellaneous/Allow 'thanks' notification for a log entry , 12 57 Community Wishlist Survey 2017/Admins and stewards/Allow further user block options (\"can edit XY\" etc.) , 13 57 Requests for new languages/Wikipedia Montenegrin 5 , 14 50 Community Wishlist Survey 2017/Miscellaneous/Use map for Nearby , 15 50 Steward requests/Username changes , 16 49 Steward requests/Global permissions , 17 48 Community Wishlist Survey 2017/Watchlists/Multiple watchlists , 18 47 Community Wishlist Survey 2017/Multimedia and Commons/SVG-Translate , 19 46 Community Wishlist Survey 2017/Anti-harassment/Smart blocking , 20 46 Community Wishlist Survey 2017/Watchlists/Automatically unwatch pages after a certain, user defined, amount of time , 21 45 Community Wishlist Survey 2017/Wikisource/Improve workflow for uploading books to Wikisource , 22 42 Community Wishlist Survey 2017/Reading/Simple diff , 23 42 Community Wishlist Survey 2017/Multimedia and Commons/Support 360 photo viewing , 24 41 Affiliations Committee/Candidates/December 2017 , 25 41 Community Wishlist Survey 2017/Anti-harassment/Per-page user blocking

Jan 2018: 1 129 Affiliations Committee/Candidates/December 2017 , 2 124 Requests for comment/Global ban for Avoided , 3 87 Steward requests/Global , 4 80 Steward requests/Permissions , 5 64 Learning and Evaluation/News/Learning Days for Wikimedia Conference 2018 , 6 48 Steward requests/Username changes , 7 40 Steward requests/Global permissions , 8 36 Merchandise giveaways/Nominations , 9 35 Wikimedia and Libraries User Group/Steering committee election 2018 , 10 34 Wikimedia Forum , 11 31 OTRS/Volunteering , 12 28 Tech/Ambassadors/List , 13 27 Stewards/Elections 2018/Questions , 14 26 Global message delivery/Targets/Tech ambassadors , 15 25 Steward requests/Checkuser , 16 22 Foundation wiki feedback , 17 20 Wikimedia Conference 2018/Participants' List , 18 16 Muj(lh)eres latinoamericanas en Wikimedia , 19 16 Wikimédia France/Wikilettre/Numéro 83/Brouillon , 20 16 100wikidays , 21 16 Request for an account on the Foundation wiki , 22 15 CentralNotice/Request/2018 Wikivoyage month , 23 15 CentralNotice/Request , 24 15 Requests for new languages/Wikipedia Montenegrin 5 , 25 15 Vandalism reports

Feb 2018: 1 354 Stewards/Elections 2018/Votes/-revi , 2 286 Stewards/Elections 2018/Votes/علاء , 3 268 IMLD-ODD 2018 Wikidata India Edit-a-thon/Participants , 4 260 Stewards/Elections 2018/Votes/Cyberpower678 , 5 251 Stewards/Elections 2018/Votes/There'sNoTime , 6 241 Stewards/Elections 2018/Votes/Rxy , 7 239 Stewards/Elections 2018/Votes/Coffee , 8 218 Stewards/Elections 2018/Votes/Green Giant , 9 203 Stewards/Elections 2018/Votes/Ciell , 10 199 Stewards/Elections 2018/Votes/Wiki13 , 11 182 Stewards/Elections 2018/Votes/Faendalimas , 12 137 Stewards/Confirm/2018/DerHexer , 13 106 Stewards/Confirm/2018/Vituzzu , 14 98 Steward requests/Global , 15 95 Stewards/Confirm/2018/MarcoAurelio , 16 93 Stewards/Confirm/2018/Trijnstel , 17 92 Stewards/Confirm/2018/Ajraddatz , 18 85 Stewards/Confirm/2018/Masti , 19 83 Stewards/Confirm/2018/Matanya , 20 82 Stewards/Confirm/2018/MF-Warburg , 21 80 Stewards/Confirm/2018/RadiX , 22 80 Stewards/Confirm/2018/Hoo man , 23 78 Stewards/Confirm/2018/Stryn , 24 77 Stewards/Confirm/2018/NahidSultan , 25 77 Steward requests/Permissions

Mar 2018: 1 282 Community Engagement Insights/Thank you , 2 88 Steward requests/Global , 3 76 Steward requests/Permissions , 4 63 Steward requests/Global permissions , 5 60 IMLD-ODD 2018 Wikidata India Edit-a-thon/Participants , 6 44 Wikimedia CEE Spring 2018/CEE Women , 7 42 Wikimedia Forum , 8 38 Steward requests/Username changes , 9 36 Steward requests/Checkuser , 10 33 Global message delivery/Targets/Tech ambassadors , 11 29 WikiWomen/Mangaluru/Editathons to bridge gender gap/Mangaluru , 12 27 WikiIndaba conference 2018/Participants , 13 27 Wikimedia Sverige and Higher Education/Uppsala University/Course in Introduction to Scientific Research , 14 25 Wikimedia CEE Spring 2018/Participants , 15 25 Wiki Loves the Olympics 2018/Participants/list , 16 23 Supporting Indian Language Wikipedias Program/Support , 17 22 Supporting Indian Language Wikipedias Program/Support/Laptops , 18 22 WikiGap/Events , 19 22 Steward requests/Miscellaneous , 20 21 Wikimedia CEE Spring 2018/Rules , 21 21 OTRS/Volunteering , 22 20 Learning and Evaluation/News/Learning Days for Wikimedia Conference 2018/Education Session , 23 20 Vandalism reports , 24 18 Hardware donation program/Jphwra , 25 17 Supporting Indian Language Wikipedias Program/Contest/Organizers

Apr 2018: 1 315 Community Engagement Insights/Thank you , 2 102 Wikimedia Cuteness Association , 3 92 Steward requests/Global , 4 82 WMDE Technical Wishes/Rollback/Feedback round , 5 62 Steward requests/Permissions , 6 59 Wikimedia Conference 2018/Thematic, regional, language-specific meetups , 7 57 Steward requests/Global permissions , 8 43 Steward requests/Checkuser , 9 42 Steward requests/Username changes , 10 36 Wikimedia Conference 2018/Social Events/Some sights tour , 11 36 Project Tiger Editathon 2018 , 12 36 Wikimedia Forum , 13 33 Global message delivery/Targets/Tech ambassadors , 14 33 Steward requests/Miscellaneous , 15 30 Wikimedia Conference 2018/Thematic, regional, language-specific meetups/Wikidata , 16 29 Affiliate Chairpersons meeting April 20 2018 , 17 29 WikiWomen/Mangaluru , 18 27 Wikimedia CEE Spring 2018/CEE Women , 19 25 GLAMTLV 2018/Scholarships , 20 25 GLAMTLV2018/Welcome , 21 22 WikiWomen/Mangaluru/Editathons to bridge gender gap/Moodabidire , 22 21 CentralNotice/Request/Danke, aber Nein Danke , 23 21 Supporting Indian Language Wikipedias Program/Support/Laptops , 24 21 Foundation wiki feedback , 25 20 Stewards' noticeboard

May 2018: 1 130 Steward requests/Global , 2 91 Steward requests/Global permissions , 3 64 Steward requests/Permissions , 4 54 Learning and Evaluation/News/Learning Days for Wikimania Cape Town , 5 47 Steward requests/Username changes , 6 38 Wikimedia Forum , 7 36 Project Tiger Editathon 2018 , 8 35 WMDE Technical Wishes/Book referencing/Call for feedback (May 2018) , 9 34 Steward requests/Miscellaneous , 10 31 Steward requests/Checkuser , 11 25 Global message delivery/Targets/The African Hour , 12 25 Merchandise giveaways/Nominations , 13 23 Wikipedia Asian Month User Group , 14 19 ESEAP Conference 2018/Report , 15 18 Vikidia User Group , 16 18 Meetup/London/130 , 17 18 Stewards' noticeboard , 18 17 Hardware donation program/Wotancito , 19 17 Hardware donation program/J ansari , 20 17 OTRS/Volunteering , 21 15 Global message delivery/Targets/Tech ambassadors , 22 15 Tech , 23 14 1Lib1Ref - Warangal and Guntur - 2018 , 24 14 Vietnam Wikimedians User Group , 25 14 Wikimedia CEE Spring 2018/CEE Women

Jun 2018: 1 125 Proposals for closing projects/Closure of Simple English Wikipedia (3) , 2 92 Steward requests/Global , 3 66 Steward requests/Permissions , 4 61 Wiki Loves Yerevan International edit-a-thon/List of participants , 5 49 Steward requests/Checkuser , 6 43 Steward requests/Global permissions , 7 36 Global message delivery/Targets/Tech ambassadors , 8 34 Steward requests/Miscellaneous , 9 31 Steward requests/Username changes , 10 26 Hardware donation program/Wotancito , 11 26 Learning and Evaluation/News/Learning Days for Wikimania Cape Town , 12 25 OTRS/Volunteering , 13 22 WikiIndaba conference 2018/Report , 14 19 Connect/IdeaLab/Members , 15 19 PP WIR 1 , 16 19 The African Hour , 17 16 Hardware donation program/محمد شعیب , 18 15 Wiki Indaba/Steering Committee (WISCom) , 19 15 WMDE Technical Wishes/Book referencing/Call for feedback (May 2018) , 20 14 Hardware donation program/Obaid Raza , 21 13 1Lib1Ref - Warangal and Guntur - 2018 , 22 13 Reports , 23 12 Hardware donation program/NehalDaveND , 24 12 Project Tiger Editathon 2018/Winners , 25 12 Wikimedia Forum

Jul 2018: 1 103 Steward requests/Global , 2 80 Steward requests/Permissions , 3 70 Steward requests/Global permissions , 4 62 Wikimedia Cuteness Association , 5 54 Wiki Project Med/Application , 6 47 Steward requests/Checkuser , 7 46 Steward requests/Username changes , 8 43 Proposals for closing projects/Closure of Simple English Wikipedia (3) , 9 43 Wiki Loves Yerevan International edit-a-thon/List of participants , 10 32 WikiConvention francophone/2018/Participant-e-s , 11 32 Wikimedia Forum , 12 26 Timeless/Newsletter , 13 25 Learning and Evaluation/News/Learning Days for Wikimania Cape Town , 14 23 Steward requests/Miscellaneous , 15 21 Gender Diversity Visibility Community User Group , 16 21 Global message delivery/Targets/Tech ambassadors , 17 21 Global message delivery/Targets/Wikidata , 18 18 OTRS/Volunteering , 19 16 Hardware donation program/Caleidoscopic , 20 15 European Parliament vote in 2018 , 21 14 Meetup/Warszawa/21 , 22 14 Muj(lh)eres latinoamericanas en Wikimedia , 23 13 Wiki Video , 24 12 VVIT WikiConnect/Activities/en WP Trg Program/2018 , 25 12 Stewards' noticeboard

Aug 2018: 1 126 Steward requests/Global , 2 101 Steward requests/Permissions , 3 91 Steward requests/Global permissions , 4 57 Global message delivery/Targets/Growth team updates , 5 45 WikiGoesACCT/Participants , 6 40 Steward requests/Username changes , 7 40 Steward requests/Miscellaneous , 8 30 WikiConvention francophone/2018/Participant-e-s , 9 28 Malayalam Wikimedians User Group/Members , 10 26 Steward requests/Checkuser , 11 24 Wikimedia Forum , 12 20 Global message delivery/Targets/Tech ambassadors , 13 20 Stewards' noticeboard , 14 19 Requests for comment/Global ban of WhenDatHotlineBling , 15 19 OTRS/Volunteering , 16 18 Wikipedia & Education User Group , 17 17 Wiki Women for Women Wellbeing 2018 , 18 16 Proposals for closing projects/Deletion of Simple English Wikiquote and Wikibooks , 19 16 Wikimedians of the Levant/2018 elections , 20 16 100wikidays , 21 14 Requests for new languages/Wiktionary Tulu , 22 12 Inter WikiWomen Collaboration , 23 12 Wikipedia for Peace Stockholm Europride/Results , 24 12 Wiki Project Med/Application , 25 12 Project Tiger Editathon 2018/Winners

Sep 2018: 1 172 Wikipedia & Education User Group/User Group election 2018-2020/Nominations , 2 99 Steward requests/Global , 3 91 Steward requests/Permissions , 4 76 Steward requests/Global permissions , 5 75 Wikipedia & Education User Group , 6 40 Steward requests/Username changes , 7 24 Wikipedia Asian Month 2018 , 8 24 Merchandise giveaways/Nominations , 9 23 Punjabi Arabic Ealaqat , 10 23 Steward requests/Miscellaneous , 11 22 Steward requests/Checkuser , 12 22 Reports , 13 21 Stewards' noticeboard , 14 20 Arabic–Bengali Cultural Exchange Program , 15 20 Wikimedia Community User Group Georgia , 16 19 Hardware donation program/Олександр Гаврик , 17 19 Wiki In Africa , 18 19 Global message delivery/Targets/Tech ambassadors , 19 18 Global message delivery/Targets/Biuletyn Wikimedia Polska , 20 17 Wikimedia Forum , 21 15 WikiIndaba conference 2019/Questions & Needs , 22 15 The AfroCine Project , 23 14 Proposals for closing projects/Deletion of Bulgarian Wikinews , 24 14 Myanmar Wikimedia Community User Group , 25 14 Community Engagement Insights/2018 Report

Oct 2018: 1 102 Steward requests/Global , 2 75 Steward requests/Global permissions , 3 60 Steward requests/Permissions , 4 57 Wikipedia Asian Month 2018 , 5 50 Wikimédia France/Assemblée générale/2018/Feuille de présence , 6 38 ItWikiCon/Selezione logo , 7 38 Steward requests/Username changes , 8 31 GLAMTLV2018/Program/Jerusalem Tour , 9 29 Steward requests/Miscellaneous , 10 28 Wikimedians of Kerala , 11 28 Global message delivery/Targets/Tech ambassadors , 12 24 Steward requests/Checkuser , 13 22 Wiki4MediaFreedom contest - II edition , 14 20 Requests for new languages/Wikipedia Atayal , 15 20 Requests for new languages/Wikipedia Sakizaya , 16 19 ItWikiCon/2018/Programma , 17 18 Wikimedia Northern Europe Meeting 2018/Documentation , 18 16 Wiki Loves Food 2018 (WLF18)/Participants , 19 16 Wikimedia Northern Europe Meeting 2018/Participants , 20 15 Meetup/London/135 , 21 15 Wikimédia France/Assemblée générale/2018 , 22 14 OTRS/Volunteering , 23 13 Community Wishlist Survey 2019/Maps/Maps Improvements: Vector Structure, Disputed Borders, Cleaner Style , 24 13 Wiki Loves Food 2018 (WLF18)2018 /list , 25 13 Requests for comment/Administrators and bureaucrats abuse in Georgian Wikipedia

Nov 2018: 1 167 Community Wishlist Survey 2019/Admins and patrollers/Page Curation and New Pages Feed improvements , 2 142 Community Wishlist Survey 2019/Reading/Night mode , 3 122 Community Wishlist Survey 2019/Anti-harassment/Add an option to require email address and username to reset password , 4 115 Community Wishlist Survey 2019/Bots and gadgets/2FA available for all concerned editors , 5 115 Community Wishlist Survey 2019/Wikisource/Improve export of electronic books , 6 111 Community Wishlist Survey 2019/Citations/VisualEditor: Allow references to be named , 7 108 Community Wishlist Survey 2019/Watchlists/Watchlist item expiration , 8 105 Community Wishlist Survey 2019/Notifications/Article reminders , 9 100 Community Wishlist Survey 2019/Editing/Keep the lightweight text editor , 10 97 Community Wishlist Survey 2019/Mobile and apps/Show categories in the Wikipedia app , 11 97 Community Wishlist Survey 2019/Editing/Include section name in the diff , 12 92 Community Wishlist Survey 2019/Miscellaneous/Global signature , 13 92 Steward requests/Global , 14 85 Community Wishlist Survey 2019/Multimedia and Commons/Support 360 photo viewing , 15 84 Community Wishlist Survey 2019/Admins and patrollers/Create an integrated anti-spam/vandalism tool , 16 83 Community Wishlist Survey 2019/Wikidata/Automatically add inverse properties , 17 81 Community Wishlist Survey 2019/Citations/Mini-editor for citations , 18 80 Community Wishlist Survey 2019/Reading/Create URL Shortener extension for Wikimedia wikis , 19 77 Community Wishlist Survey 2019/Editing/Put mw.toolbar back , 20 75 Community Wishlist Survey 2019/Admins and patrollers/Allow partial reverts for edits , 21 71 Community Wishlist Survey 2019/Mobile and apps/Add an undo/revert button to diff view , 22 71 Steward requests/Permissions , 23 70 Community Wishlist Survey 2019/Reading/Functional and beautiful math for everyone , 24 70 Steward requests/Global permissions , 25 69 Community Wishlist Survey 2019/Archive/mw.toolbar zurück

Dec 2018: 1 199 Affiliations Committee/Candidates/December 2018 , 2 139 Bridges across Cultures/Participants/signs , 3 112 Steward requests/Global , 4 92 Steward requests/Global permissions , 5 91 Steward requests/Permissions , 6 48 Wikipedia Asian Month 2018/Status , 7 44 Wikipedia Asian Month 2018/Ambassadors , 8 36 Wikipedia & Education User Group/Logo challenge , 9 34 Steward requests/Miscellaneous , 10 29 Steward requests/Username changes , 11 25 Tremendous Wiktionary User Group/Wikimedia Summit 2019 , 12 25 Wikisource Community User Group/Wikimedia Summit 2019 , 13 23 Global message delivery/Targets/Tech ambassadors , 14 23 Steward requests/Checkuser , 15 18 Sustainability Initiative/List of supporters , 16 17 OTRS/Volunteering , 17 16 Wikipedia Asian Month 2018/Late submit , 18 15 Wikimedia Forum , 19 14 Project Tiger Training 2018 , 20 13 CIS-A2K/Events/Bengaluru meetup 2018 , 21 13 Wikimedia France/Micro-financement , 22 13 Reports , 23 12 Translation of the week/Translation candidates , 24 11 Wikisangamotsavam-2018 , 25 11 Wikimédia France/Consultation:Le Fonds pour le civisme en ligne

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Friday February 1, 2019 05:59 (final run)

Dump file metawiki-20190101-stub-meta-history.xml.gz (edits only), size 901 Mb as gz -> 9.2 Gb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-15:26 after 57 min, 5 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.