Estatísticas da  outreach

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: janeiro 2013
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
Jan 2013+1%   +1%   -77%+2%+2%+1%+2%+2%+5%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
Jan 11, 201320016 1,5 k115,838711658,1 Mb908 k2,6 k2,7 k2,6 k5,2 k363
Dec 201219921611,5 k115,838287137,9 Mb892 k2,6 k2,7 k2,6 k4,9 k363
Nov 201219729 1,4 k 15,838432777,7 Mb867 k2,5 k2,6 k2,5 k4,7 k355
Oct 2012195417 1,4 k115,838626207,6 Mb864 k2,5 k2,6 k2,4 k4,5 k347
Sep 2012191925 1,4 k115,738876067,5 Mb846 k2,4 k2,5 k2,4 k4,4 k342
Aug 2012182619 1,3 k115,738867337,3 Mb826 k2,4 k2,3 k2,4 k4,1 k321
Jul 201217682411,3 k215,738518007,0 Mb788 k2,3 k2,1 k2,3 k3,9 k318
Jun 201216831621,2 k415,738609916,7 Mb756 k2,2 k2,0 k2,2 k3,6 k291
May 201216583011,1 k316,441109296,4 Mb732 k2,2 k2,0 k2,1 k3,5 k287
Apr 2012157521 1,0 k116,842375276,0 Mb699 k2,1 k1,7 k2,0 k3,3 k255
Mar 20121521129 996116,841367415,7 Mb660 k2,0 k1,7 k1,7 k3,2 k251
Feb 20121419292960116,741441,0 k5,5 Mb637 k1,9 k1,5 k1,7 k2,9 k243
Jan 20121326251917216,341471,0 k5,3 Mb608 k1,9 k1,4 k1,6 k2,7 k225
Dec 201112610242864216,240177814,8 Mb556 k1,8 k1,1 k1,4 k2,4 k220
Nov 201111610222812216,235129124,0 Mb465 k1,7 k9101,4 k2,1 k197
Oct 20111067281758216,234199883,7 Mb423 k1,6 k8411,3 k1,9 k163
Sep 201199419 70511634564133,5 Mb398 k1,5 k7231,2 k1,7 k160
Aug 2011956201665216,335227843,3 Mb383 k1,5 k7101,1 k1,6 k160
Jul 201189721 607116,634474563,0 Mb343 k1,3 k6851,1 k1,5 k122
Jun 201182317 585116,534565422,9 Mb332 k1,3 k6501,1 k1,4 k114
May 20117910293545416,734671,2 k2,7 Mb311 k1,2 k6131,0 k1,3 k108
Apr 2011694263429318,438081,0 k2,2 Mb269 k9885248711,2 k83
Mar 20116511263333320,640841,1 k1,8 Mb224 k76142168983553
Feb 2011548211246323,647457711,4 Mb194 k55134264974540
Jan 201146518 174 28,956613751,2 Mb165 k38220956165337
Dec 20104149 175 26,656303611,2 Mb165 k31519751260427
Nov 20103727 164 26,255261861,1 Mb153 k29118543954522
Oct 201035513 156 26,45203358987 kb137 k29111436652421
Sep 2010307141147 25,54534567816 kb113 k2699920844518
Aug 2010232111139 22,94283444723 kb101 k2319413937413
Jul 201021482129 21,33769629604 kb84 k195891113269
Jun 201017182127 16,73600518556 kb78 k17986893238
May 20101619 113 14,13583226486 kb69 k15884653016
Apr 20101547 105 13,13435171439 kb62 k17780622726
Mar 201011 3 91 13,2352036387 kb56 k15171582214
Feb 201011 5 88 13,2359675381 kb55 k14771532134
Jan 20101115 84 13359772363 kb53 k14147471863
Dec 20091058179112,93255452310 kb45 k13645451583
Nov 2009517157 9,92224280150 kb20 k984321781
Oct 200943324716,11898262104 kb15 k80241533 
Sep 20091   1 23461544,7 kb8181    
Aug 20091   1 19380013,9 kb6731    
Jul 20091   1 183800 3,8 kb6731    
Jun 20091   1 18380023,8 kb6731    
May 2009112 1 163738163,8 kb662     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  1  3  5  10  25  5  10  1  3  5  10  25  100  5  10 
Jun 2013                      
May 2013                      
Apr 2013                      
Mar 2013                      
Feb 2013                      
Jan 2013                      
Dec 201256231610511  831  11288531   
Nov 20124117961   25511 1120511    
Oct 201258241797 1115511 1129141262   
Sep 2012753825157   23731 213814851 1 
Aug 2012663019127   26963111277631 1 
Jul 20129236241561   22431   45137211  
Jun 201273281612322  2432  1131119621  
May 201273373016811  24722   491610663  
Apr 2012733921115   2182  1134126321  
Mar 20121125329156   361261 115717104  1 
Feb 201210442291892   34532111511242    
Jan 20128137251991   338411  3773     
Dec 20116534241262   286331  36832    
Nov 201166302215112   4112652  4011441   
Oct 20119942281551   3611621  58221491 1 
Sep 201176291985   2774    4511731   
Aug 20116928201571   28103    5410631   
Jul 2011612921133   301021 1 3912763 11
Jun 201172301795   401271   651410841  
May 201162382921123   3219136   6330191052  
Apr 201181342618103   4111103   58211164 1 
Mar 20117036261873   361274   551812103   
Feb 20116927211081   367641  57151353   
Jan 2011442218113   23982   4715831   
Apr 2013                      
Jan 2013                      
Oct 201258241797 1115511 1129141262   
Jul 20129236241561   22431   45137211  
Apr 2012733921115   2182  1134126321  
Jan 20128137251991   338411  3773     
Oct 20119942281551   3611621  58221491 1 
Jul 2011612921133   301021 1 3912763 11
Apr 201181342618103   4111103   58211164 1 
Jan 2011442218113   23982   4715831   
Oct 201041191395   318441  50171122   
Jul 2010181186421  188311  3641     
Apr 2010197743   1354    35931    
Jan 201014553    721    17411    
Oct 2009743332   6221   2776311  
Jul 2009              113      

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
1770100.0%20,875100.0%
332842.6%20,19096.7%
1020026.0%19,44093.1%
329011.7%17,57684.2%
100364.7%14,59069.9%
316141.8%10,77251.6%
100020.3%3,39616.3%

 

41 autores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Frank SchulenburgUC1 01,84926032May 05, 200913461061--
Rock drumUC2 01,5473490-Dec 11, 2010761166---
Sage Ross (WMF)UC3 0971103766Jun 09, 2010946138---
Daniel MietchenUC5+17154235-Jan 13, 2012363363--
Ldavis (WMF)UC7 06601038526Jun 29, 2010926582--
HstryQTUC10 0518158-Jan 13, 2011728211--
RomaineUC12+148056727Jan 23, 2012353183--
ThelmadatterUC16+326030131Apr 08, 2011643429--
MonoUC20 019753648Jan 08, 201173317---
Esh77UC25 015819-Oct 08, 20114604---
PeteforsythUC28 0154152-Feb 25, 20116857---
JmathewsonUC31 0137318-Nov 03, 201143411---
BluerasberryUC38+13972944-Jan 23, 201235341--
Another BelieverUC39 0951323Aug 24, 2012139----
VarnentUC43 091343-Apr 06, 2012279----
Andrew GrayUC46-184210-May 05, 201225011--
LeighblackallUC49+170214-Oct 31, 201143741--
ElitreUC66 047222-Dec 13, 2010759121--
Jane023UC67+54656-Oct 24, 20114446---
PierreSelimUC106+325281Mar 08, 201167421--
DvdgmzUC110+572411163Dec 04, 20123751--
AubreyUC136+31716-Mar 19, 20116632---
JohnbodUC147+31512-Jan 25, 20117161---
EzalvarengaUC149+61513-Jun 07, 20122171---
BrestUC164+4513452Nov 20, 2011417----
GauravUC173+61213-Nov 25, 20114121---
SpinsterUC215+43931-Dec 06, 20123511--
Sophie Österberg (WMSE)UC242...77--Jan 03, 20137----
CharboothUC243...7733Jan 06, 20134----
LpagolaUC290+419541-Jun 22, 2012202----
Daria CybulskaUC292+28511-Aug 07, 2012156----
PsubhashishUC303+44413-Apr 19, 2011632----
Magnus ManskeUC383+99311-May 13, 2012242----
DjembayzUC393+35432--Oct 05, 201297----
YakooUC397...33--Dec 14, 201227----
RastrojoUC502...22--Dec 29, 20121211--
Michael BareraUC766...1111Dec 15, 201226----
Shaun9876UC767...11452Dec 21, 201220----
TimboliuUC768...116-Dec 24, 201217----
Ktr101UC769...111-Dec 28, 201213----
TptUC770...11--Jan 06, 20134----

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AradhanarUC4888Apr 16, 20101000Sep 24, 2010839
RdunicanUC6711Apr 12, 20101004Jul 22, 2012172
LauraHaleUC8585Oct 02, 2011466Mar 01, 2012315
AlinUC9547Jun 29, 2010926Oct 31, 201271
HannibalUC11484Jun 01, 2010954Sep 23, 2012109
MissvainUC13428Jan 24, 2011717Oct 08, 201294
ArielGlennUC14389May 05, 20091346May 08, 2011613
ΑχρήστηςUC15305Mar 12, 2011670Oct 25, 2011443
WolliffUC17255Apr 29, 2011622Jan 05, 2012371
ChvazaUC18237Jun 30, 2010925Sep 30, 2010833
Pete Forsyth (WMF)UC19234Oct 29, 20091169Dec 18, 2010754
PigsonthewingUC21190Oct 10, 2011458Dec 07, 201234
Witty lamaUC22177Nov 27, 20091140Jun 01, 2011589
Rob Schnautz (WMF)UC23166Mar 02, 2012314Jul 25, 2012169
Sky2105UC24165Nov 05, 2011432Dec 01, 2011406
IopensaUC26155Mar 18, 2011664Dec 10, 201231
AwadewitUC27154Oct 27, 2010806Dec 20, 2010752
MarlitaUC29147Oct 28, 20091170Jan 16, 20101090
Jan eissfeldtUC30140Oct 29, 20091169Sep 24, 2011474
GlavkosUC32126Feb 23, 2011687Nov 18, 201253

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
216.38.130.16174
216.38.130.16654
216.38.133.25449
77.49.103.2933
195.251.28.19730
97.122.224.23727
72.77.0.15627
213.130.115.16225
216.38.130.16323
76.102.51.18722

No total 2.190 edições foram feitas por usuários anônimos, de um total de 23.134 edições ( 9e %)
  


1 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
RomaineBotUC135Oct 09, 201293Oct 09, 201293--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgOgvPdfPng
Jan 11, 20132,4 k1,1 k1537547731396      1431111024
Dec 20122,3 k1,1 k1537547731396      6921111024
Nov 20122,3 k1,0 k1537537671390      2171111024
Oct 20122,2 k1,0 k1537537661389      5441111024
Sep 20122,2 k1,0 k1537537271385      5601111024
Aug 20122,1 k1,0 k1537537221342      6171111024
Jul 20122,1 k9691537537171342      7471111024
Jun 20122,0 k9361537527051333      9491111024
May 20121,7 k9161537526891279      8941111024
Apr 20121,5 k8011537516131216      4701111024
Mar 20121,4 k7291537515961216      6791111024
Feb 20121,4 k6851337515701214      9521111024
Jan 20121,3 k6471337505681203      8371111024
Dec 20111,2 k6241337505631201      7201111024
Nov 20111,1 k6041237505461200      7931111024
Oct 20111,0 k5831137505401199      7711111024
Sep 20119655481137505061193      3901111024
Aug 20119155191037504981192      6841111024
Jul 20118264881037504791176      3911111024
Jun 2011786466937504391176      4631111024
May 2011729422837454111175      11171111024
Apr 2011579371737403881172      9351111024
Mar 2011444336537303731164      9901111024
Feb 201132629843719339 143      7061111024
Jan 20112402593379309 112      3401111024
Dec 20102072303378288 108      2941111024
Nov 20101902123376277 108      1591111024
Oct 20101831932376270 107      3161111024
Sep 20101691692343263 107      541  1924
Aug 2010156148 253252 102      416  1618
Jul 2010142126 233236 96      604  1418
Jun 2010137109 173234 95      478  1214
May 201012099 153224 90      217   213
Apr 201011392 153223 88      160   213
Mar 20109680 122219 84      32   111
Feb 20109276 122217 84      60   111
Jan 20108769 112213 83      60    11
Dec 20098266 112211 82      414    11
Nov 20095835  2208 80      247     
Oct 20094716  2197 49      257     
Sep 20091   1126 1      4     
Aug 20091   1125 1      1     
Jul 20091   1124 1            
Jun 20091   1124 1      2     
May 20091   1124 1      16     

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

May 2009: 1 6 Best practices in hosting an IRC open meeting

Jun 2009: 1 1 Best practices in hosting an IRC open meeting

Aug 2009: 1 1 Best practices in hosting an IRC open meeting

Sep 2009: 1 3 Best practices in hosting an IRC open meeting

Oct 2009: 1 5 Resources for the Bookshelf Project , 2 3 Overview of Deliverables (Bookshelf) , 3 2 Main Page/en , 4 2 Open Questions (Bookshelf)

Nov 2009: 1 5 GLAM/Success stories , 2 4 GLAM/Case studies/German Federal Archives , 3 3 Drawbacks , 4 3 Geschichten zur Kooperation mit dem Bundesarchiv , 5 3 Fallstudie Bundesarchiv , 6 3 Translations and Localization (Bookshelf) , 7 3 Overview of Deliverables (Bookshelf) , 8 3 Use eye-catchers to attract attention , 9 3 Best practices in assigning Wikipedia articles as coursework to students , 10 3 Best practices , 11 2 Main Page/en , 12 2 GLAM-Wiki: Finding Common Ground

Dec 2009: 1 4 Production Survey (Bookshelf) , 2 4 GLAM/Case studies/Tropenmuseum , 3 3 Main Page/en , 4 3 Interviewee from he-Wikipedia , 5 3 Life of an Article , 6 3 Open Questions (Bookshelf) , 7 3 Resources for the Bookshelf Project , 8 3 Best practices documentation team , 9 3 Bookshelf Project , 10 2 Interviewee from sv-Wikipedia , 11 2 Interviewee from fr-Wikipedia , 12 1 Bookshelf/Wikipedia

Jan 2010: 1 3 Secondary School Materials (Bookshelf) , 2 2 Main Page/en , 3 2 Evolution of an article (Muhammad al-Durrah incident) , 4 2 Interviewee from ta-Wikipedia , 5 2 Interviewee from hk-Wikipedia

Feb 2010: 1 5 GLAM/Success stories , 2 3 Main Page/en , 3 3 GLAM/Case studies/German Society for Orthopaedics and Trauma Surgery , 4 3 Fallstudie Deutsche Gesellschaft für Orthopädie und Unfallchirurgie , 5 2 Video success stories

Mar 2010: 1 2 Chapters' Activity Calendar/Archive , 2 1 Outreach team

Apr 2010: 1 5 Main Page/en , 2 4 Meeting: Using Wikipedia as a Teaching Tool , 3 4 Wikipedia for Marketing Communications Professionals (Bookshelf) , 4 3 Wiki X , 5 3 Bookshelf Project , 6 2 Using Wikipedia in secondary education , 7 2 Wikipedia for Journalists (Bookshelf) , 8 2 LiveHelp , 9 2 Live chat , 10 2 Verifiability and Neutral point of view (Transcript, sv)

May 2010: 1 8 FAQ For Librarians , 2 4 Meeting: Using Wikipedia as a Teaching Tool , 3 3 Using Wikipedia as a teaching tool in higher education (Bookshelf) , 4 3 Student Organizations/How to Start a Wikipedian Student Organization , 5 3 Wiki X planned events , 6 3 Wikipedia for Marketing Communications Professionals (Bookshelf) , 7 2 Public Policy Initiative project details , 8 1 Using Wikipedia in higher education

Jun 2010: 1 5 Welcome to Wikipedia (Bookshelf) , 2 4 Using Wikipedia as a teaching tool in higher education (Bookshelf)/Wikipedia Course Syllabus , 3 3 FAQ For Librarians , 4 3 Using Wikipedia as a teaching tool in higher education (Bookshelf) , 5 2 Main Page/en , 6 2 Using Wikipedia as a teaching tool in higher education (Bookshelf)/Before the assignment starts , 7 2 Wikipedia Campus Ambassador

Jul 2010: 1 8 Welcome to Wikipedia (Bookshelf) , 2 3 Using Wikipedia (Bookshelf) , 3 2 Main Page/en , 4 2 Using Wikipedia as a teaching tool in higher education (Bookshelf)/Week 1 , 5 2 Using Wikipedia as a teaching tool in higher education (Bookshelf)/Week 5

Aug 2010: 1 5 Ten reasons to contribute to Wikipedia (Bookshelf) , 2 5 Public Policy Initiative , 3 4 Screen Sprint ideas , 4 4 Using Wikipedia (Bookshelf) , 5 4 Wikipedia for Marketing Communications Professionals (Bookshelf) , 6 4 Bookshelf Project , 7 3 Main Page/en , 8 3 Localization guidelines (Bookshelf) , 9 3 Introduction to free licenses (Bookshelf) , 10 3 Ten ways to contribute to Wikipedia (Bookshelf) , 11 3 Bookshelf content review , 12 2 Bookshelf/Wikipedia

Sep 2010: 1 11 Account Creation Improvement Project , 2 8 Bookshelf Project , 3 6 Ten reasons to contribute to Wikipedia (Bookshelf) , 4 5 Screen Sprint ideas , 5 5 Using Wikipedia (Bookshelf) , 6 5 Wikipedia for Marketing Communications Professionals (Bookshelf) , 7 4 Main Page/en , 8 4 Wikipedia Campus Ambassador Handbook , 9 4 Anatomy of an Article Poster (Bookshelf) , 10 4 Public Policy Initiative , 11 3 Bookshelf/Wikipedia , 12 3 University of Michigan Wikipedians , 13 3 Wikipedian Student Organizations , 14 3 Localization guidelines (Bookshelf) , 15 3 Introduction to free licenses (Bookshelf)

Oct 2010: 1 12 Wikipedia 10 , 2 11 Account Creation Improvement Project , 3 8 Bookshelf/Wikipedia , 4 4 Introduction to free licenses (Bookshelf) , 5 3 Evaluating Wikipedia article quality (Bookshelf) , 6 3 Welcome to Wikipedia (Bookshelf) , 7 3 Wiki X planned events , 8 3 Wikipedia for Marketing Communications Professionals (Bookshelf) , 9 3 Translations and Localization (Bookshelf) , 10 2 Welcome to Wikipedia (Bookshelf)/de

Nov 2010: 1 5 Public Policy Initiative , 2 4 Bookshelf/Wikipedia , 3 4 Wikipedia 10 , 4 4 Account Creation Improvement Project , 5 2 Wikipedia as a Teaching Tool (Bookshelf) , 6 2 Welcome to Wikipedia (Bookshelf)/ca , 7 2 Wikipedia as a Teaching Tool/Basics of Editing

Dec 2010: 1 6 GLAM/Discussion , 2 3 GLAM/Tools & Requests , 3 3 Wikipedia Campus Ambassador/Training , 4 3 GLAM/Projects & Events , 5 3 GLAM/Contact us , 6 3 GLAM/Wikimedians , 7 3 Wikipedia as a Teaching Tool/Grading Rubrics , 8 3 Wikipedia as a Teaching Tool/Resources for Teaching with Wikipedia , 9 3 Wikipedia as a Teaching Tool/Basics of Editing , 10 2 Wikipedia Campus Ambassador/Training/Outreach , 11 1 Bookshelf/Wikipedia

Jan 2011: 1 12 GLAM/Contact , 2 10 GLAM/Discussion , 3 6 Bookshelf/Wikipedia , 4 5 GLAM/Wikimedians , 5 5 Main Page/en , 6 4 GLAM/Tools & Requests , 7 4 GLAM/Projects & Events , 8 3 Outreach team , 9 3 The State of Wikipedia , 10 3 Best practice to follow in mailing , 11 3 Account Creation Improvement Project/Suggestions , 12 3 Account Creation Improvement Project/Sign up , 13 2 GLAM/Newsletter/Suggestions , 14 2 GLAM/Newsletter/January 2011 , 15 2 Main Page/de

Feb 2011: 1 11 GLAM/Discussion , 2 11 GLAM/Contact us , 3 7 Account Creation Improvement Project/Sign up , 4 6 GLAM/Newsletter , 5 6 GLAM/Contact , 6 5 Student Organizations/Activities , 7 5 Account Creation Improvement Project/Testing content , 8 5 GLAM/Newsletter/January 2011 , 9 5 GLAM/Projects & Events , 10 5 Wikipedian Student Organizations , 11 4 Editing workshops/Veria, February 23, 2011/Activities , 12 4 Wikipedians at Imperial College , 13 4 Account Creation Improvement Project/Open questions , 14 3 Outreach team , 15 3 Bookshelf/Wikipedia , 16 3 GLAM/Ambassador register , 17 3 How to build a class-based university program , 18 3 Wikipedia Education Program Strategy , 19 3 Ideas for Reorganizing Materials , 20 3 GLAM/Ambassadors & Interns/Institutions , 21 3 Account Creation Improvement Project/Testing content/Account creation form/Original version , 22 3 Help out , 23 2 GLAM/Newsletter/Tasks , 24 2 GLAM/Newsletter/Newsroom , 25 2 GLAM/Newsletter/February 2011/Contents/From the editors

Mar 2011: 1 11 GLAM/Contact , 2 11 GLAM/Discussion , 3 11 Welcome to Wikipedia (Bookshelf)/fr , 4 10 GLAM/Contact us , 5 6 Wikipedia Education Program Strategy , 6 5 Education/The Syllabus , 7 5 GLAM/Tools & Requests , 8 4 GLAM/Newsletter/Suggestions , 9 3 Wikipedian in Residence , 10 3 Evaluating Wikipedia article quality (Bookshelf)/ar , 11 3 Editing workshops/Samos, March 16, 2011/Comments and evaluation of workshop by participants , 12 3 Editing workshops/Samos, March 16, 2011/δημιουργία άρθρων , 13 3 Editing workshops/Samos, March 16, 2011/Workshop outline , 14 3 Wikipedia Education Program – Berlin Workshop , 15 3 Education/Assignment Design , 16 3 Education , 17 3 Account Creation Improvement Project/Results , 18 3 Account Creation Improvement Project/Testing content , 19 3 GLAM/Ambassadors & Interns/Map , 20 3 Account Creation Improvement Project/Sign up , 21 2 Outreach team , 22 2 Bookshelf/Wikipedia , 23 2 Editing workshops/Atalanti, March 23, 2011/Δραστηριότητες/ρόλος: φωτογράφος , 24 2 Editing workshops/Atalanti, March 23, 2011/Δραστηριότητες/ρόλος: συγγραφέας , 25 2 Editing workshops/Atalanti, March 23, 2011/Δραστηριότητες/ρόλος: εξερευνητής

Apr 2011: 1 19 Wikipedia in Education: Wikimania 2011 , 2 10 Wikipedian Student Organizations , 3 8 GLAM/Contact , 4 7 GLAM/Discussion , 5 7 Wikipedia Campus Ambassador , 6 6 GLAM/Newsletter/March 2011/Contents/News in brief , 7 6 Main Page , 8 5 Wikipedia in Education: Wikimania 2011/Ambassador Presentation , 9 5 India schools visited , 10 5 Selection of schools for the Pune pilot , 11 5 Account Creation Improvement Project/Testing content , 12 4 Proposal for using Wikipedia as a teaching tool at universities in India , 13 4 Wikipedia Campus Ambassador/FAQ , 14 4 Wikipedia Education Program Summary Information , 15 4 Account Creation Improvement Project/Results , 16 4 Editing workshops , 17 4 GLAM/Institutions , 18 4 GLAM/Newsletter/Suggestions , 19 3 Wikipedia Campus Ambassador/India applications , 20 3 Greece 2011 , 21 3 Bookshelf/Wikipedia , 22 3 Account Creation Improvement Project/Testing content/Account creation form/Frank's proposal , 23 3 Wikipedia Education Program Strategy , 24 3 Bookshelf , 25 3 Account Creation Improvement Project/Sign up

May 2011: 1 10 GLAM/Contact us , 2 9 GLAM/Contact , 3 9 GLAM/Case studies , 4 7 GLAM/Model projects , 5 6 GLAM/Discussion , 6 5 GLAM/Volunteers , 7 5 Wikipedia in Higher Education Summit , 8 5 GLAM/Newsletter/Suggestions , 9 5 GLAM/Tools & Requests , 10 4 GLAM/Get started , 11 4 GLAM/Case studies/Derby Museum , 12 4 Regional Ambassador/Resources , 13 4 Pune Pilot kick-off trip agenda , 14 4 Wikipedian in Residence , 15 4 Education/Reasons to use Wikipedia , 16 4 GLAM , 17 3 GLAM/Newsletter/May 2011/Contents/News in brief , 18 3 GLAM/Case studies/Brooklyn Museum , 19 3 Regional Ambassadors/About , 20 3 Proposal for using Wikipedia as a teaching tool at universities in India , 21 3 Bookshelf , 22 3 GLAM/Institutions , 23 2 GLAM/Case studies/Indiana University–Purdue University Indianapolis , 24 2 GLAM/Case studies/The Children's Museum of Indianapolis/Success story , 25 2 GLAM/Case studies/Wikimedia Australia Conference

Jun 2011: 1 9 GLAM/Contact , 2 8 Wikipedian Student Organizations , 3 6 Wikipedia in Higher Education Summit , 4 5 GLAM/Newsletter/June 2011/Contents/UK report , 5 5 GLAM/Model projects/Library Edit-a-thons , 6 4 GLAM/Volunteers , 7 4 Regional Ambassador/Resources , 8 3 GLAM/Model projects/OTRS letter , 9 3 GLAM/File formats , 10 3 GLAM/Newsletter/May 2011/Contents/News in brief , 11 3 GLAM/Newsletter/May 2011/Contents/GLAMcamp , 12 3 Education/The Syllabus , 13 3 GLAM/Newsletter/Suggestions , 14 3 Account Creation Improvement Project/Sign up , 15 2 Outreach team , 16 2 GLAM/Newsletter/June 2011/Contents/News in brief , 17 2 Wikipedia in Higher Education Summit/Agenda , 18 2 Public Policy Initiative/fr , 19 2 Editing workshops/Ministry of education, June 15, 2011/Ερωτηματολόγιο , 20 2 Editing workshops/Ministry of education, June 15, 2011/Δραστηριότητες , 21 2 Editing workshops/Ministry of education, June 15, 2011/Στοιχεία επικοινωνίας , 22 2 Editing workshops/Ministry of education, June 15, 2011/Εισαγωγή , 23 2 Editing workshops/Ministry of education, June 15, 2011/Τί θέλουμε να μάθουν/ανά δραστηριότητα , 24 2 Editing workshops/Ministry of education, June 15, 2011/Τί θέλουμε να αποκομίσουν , 25 2 Incentives for using Wikipedia as a teaching tool

Jul 2011: 1 13 Wikipedia in Higher Education Summit , 2 11 GLAM/Contact us , 3 8 Wikipedia in Higher Education Summit/Feedback and questions , 4 6 Regional Ambassadors/Current , 5 5 GLAM/Contact , 6 4 Regional Ambassador/Resources/Professors' Concerns , 7 4 GLAM/Volunteers , 8 4 GLAM/Model projects , 9 4 GLAM/Newsletter/Suggestions , 10 4 Main Page/en , 11 3 GLAM/North American list , 12 3 GLAM/Newsletter/July 2011/Contents/UK report , 13 3 Wikipedian in Residence , 14 3 Main Page , 15 2 Outreach team , 16 2 GLAM/Newsletter/July 2011/Contents/Spain report , 17 2 Student Contributions to Wikipedia , 18 2 Wikipedia in Higher Education Summit/Documentation , 19 2 GLAM/Newsletter/July 2011/Contents/Events , 20 2 GLAM/Model projects/OTRS letter/OTRS Generic French , 21 2 GLAM/Model projects/Library Edit-a-thons , 22 2 Regional Ambassador/Resources

Aug 2011: 1 11 WikiChix Lunch 2011 , 2 11 Wikipedia Regional Ambassadors/CA Trainings , 3 7 Wikipedian Student Organizations , 4 5 GLAM/Contact , 5 5 Wikipedia Ambassador Program , 6 4 Wikipedia Education Program , 7 4 Student Organizations/Activities , 8 4 Account Creation Improvement Project , 9 3 GLAM/Newsletter/August 2011/Contents/Events , 10 3 Wikipedia Education Program/Get Involved , 11 3 Wikipedia Education Program/Contact , 12 3 Wikipedia Education Program/History , 13 3 GLAM/Volunteers , 14 3 Student Organizations/Resources for Students , 15 3 GLAM/Newsletter/Newsroom , 16 2 Wikipedia Education Program/India/Learning Points August 2011 , 17 2 Οδηγός Διοργάνωσης Σεμιναρίων για τον εμπλουτισμό της Wikipedia στα Ελληνικά , 18 2 GLAM/Newsletter/August 2011/Contents/USA report , 19 2 Student Organizations/Design your Student Organization , 20 2 Student Organizations/Using Wikipedia and Wikimedia Marks , 21 2 Student Organizations/List of Wikipedian Student Organizations without a Clubhouse Page , 22 2 Student Organizations/Fundraising , 23 2 GLAM/ICA/fr , 24 2 Student Organizations/Strategic Planning process for Wikipedian Student Organizations , 25 2 Student Organizations/5 Steps for New Wikipedian Student Organizations

Sep 2011: 1 10 GLAM/Contact , 2 9 Wikipedia Education Program Metrics and Activities Meeting , 3 6 Student Organizations/Clubhouse/Wikipedia Club at Montana State University , 4 5 GLAM/Newsletter/August 2011/Contents/Events , 5 5 Wikipedian Student Organizations , 6 4 Bookshelf/Three Wikipedia films , 7 3 Editing Sport Biographies on Wikipedia , 8 3 GLAM/Newsletter/August 2011/Contents/Israel report , 9 3 Welcome to Wikipedia (Bookshelf)/sv , 10 3 GLAM/Newsletter/August 2011/Contents/USA report , 11 3 GLAM/Newsletter/August 2011/Contents/UK report , 12 3 Projects , 13 2 GLAM/Newsletter/September 2011/Contents/USA report , 14 2 Best practices in organizing a Wikipedia workshop , 15 2 Wikipedia Challenge , 16 2 Student Organizations/Clubhouse/Michigan Wikipedians , 17 2 GLAM/Newsletter/September 2011/Contents/Wikimania report , 18 2 GLAM/Newsletter/August 2011/Contents/Canada report , 19 2 GLAM/Newsletter/August 2011/Contents/Mexico report , 20 2 GLAM/Newsletter/August 2011/Contents/Germany report , 21 2 Student Organizations/Editintro Clubhouse Main Page , 22 2 Wikipedia Education Program , 23 1 Outreach team

Oct 2011: 1 30 Wikipedia Education Program Metrics and Activities Meeting , 2 16 Cairo Pilot kick-off trip agenda , 3 8 GLAM/Contact , 4 5 GLAM/Newsletter/September 2011/Contents/Australia and New Zealand report , 5 4 Editing workshops , 6 4 GLAM/Newsletter/Suggestions , 7 3 GLAM/Events/November 2011 , 8 3 Wikipedia Education Program Metrics and Activities Meeting/September 2011 , 9 3 GLAM/Newsletter/October 2011/Contents/UK report , 10 3 GLAM/Newsletter/October 2011/Contents/USA report , 11 3 GLAM/Newsletter/October 2011/Contents/Australia and New Zealand report , 12 3 Editing workshops/Κορμός εργαστηρίων/Σχόλια και παρατηρήσεις του εργαστηρίου από διοργανωτές , 13 3 GLAM/Newsletter/September 2011/Contents/USA report , 14 3 Wikipedia Education Program/News , 15 3 Student Organizations/Clubhouse/Wikipedia Club at Montana State University , 16 3 Editing workshops/Κορμός εργαστηρίων , 17 3 GLAM/Model projects , 18 3 GLAM/Newsletter/Newsroom , 19 3 Bookshelf , 20 3 Best practice to follow in mailing , 21 3 GLAM/Contact us , 22 2 History of the Paralympic Movement in Australia , 23 2 Outreach Oceania/Project Goals , 24 1 GLAM/Newsletter/October 2011/Contents/Israel report

Nov 2011: 1 8 GLAM/Newsletter/November 2011/Contents/Australia and New Zealand report , 2 6 GLAM/Newsletter/Newsroom , 3 6 GLAM/Contact , 4 5 GLAM/Newsletter/November 2011/Contents/East Asia report , 5 5 History of the Paralympic Movement in Australia/Wikipedia/Style Guide , 6 5 GLAM/Newsletter/October 2011/Contents/Israel report , 7 4 GLAM/Newsletter/November 2011/Contents/Italy report , 8 4 GLAM/Newsletter/November 2011/Contents/USA report , 9 4 GLAM/Model projects/GLAM events , 10 4 Wikipedia Education Program/MENATrip , 11 3 Outreach team , 12 3 GLAM/Newsletter/November 2011/Contents/France report , 13 3 GLAM/Newsletter/November 2011/Contents/Argentina report , 14 3 Wikipedia Education Program MENA , 15 3 GLAM/Newsletter/November 2011/Contents/Russia report , 16 3 GLAM/Newsletter/November 2011 , 17 3 Best practices in blogging about the Wikipedia Education Program , 18 3 GLAM/Newsletter/November 2011/Contents , 19 3 GLAM/Newsletter/October 2011/Single , 20 3 GLAM/Newsletter/October 2011 , 21 3 GLAM/Events/November 2011 , 22 3 GLAM/Newsletter/October 2011/Contents/Germany report , 23 3 Wikipedia Education Program Metrics and Activities Meeting , 24 3 Wikipedia Education Program , 25 3 Wikipedia Regional Ambassadors

Dec 2011: 1 6 GLAM/Contact , 2 6 GLAM/Projects & Events , 3 5 Wikipedia Education Program Metrics and Activities Meeting , 4 4 GLAM/Newsletter/December 2011/Contents/UK report , 5 4 GLAM/Events/December 2011 , 6 4 Wikipedian in Residence , 7 4 GLAM/Tools & Requests , 8 3 GLAM/Newsletter/December 2011/Contents/USA report , 9 3 GLAM/Newsletter/December 2011/Contents/Netherlands report , 10 3 GLAM/Newsletter/December 2011 , 11 3 GLAM/Newsletter/December 2011/Contents/Australia and New Zealand report , 12 3 GLAM/Newsletter/November 2011/Contents/France report , 13 3 GLAM/Newsletter/November 2011/Contents/USA report , 14 3 GLAM/QRpedia , 15 3 GLAM/Newsletter/Newsroom , 16 2 GLAM/Newsletter/December 2011/Contents/Italy report , 17 2 History of the Paralympic Movement in Australia/Wikimedians to the Games/Points , 18 2 History of the Paralympic Movement in Australia/Wikimedians to the Games , 19 2 GLAM/Newsletter/December 2011/Contents/France report , 20 2 GLAM/Newsletter/December 2011/Contents/Russia report , 21 2 GLAM/Case studies/The Children's Museum of Indianapolis/QRpedia , 22 2 History of the Paralympic Movement in Australia/Wikibooks , 23 2 GLAM/Newsletter/December 2011/Contents/Africa report , 24 2 Main Page/pt , 25 2 GLAM/Model projects/Engaging a different language or cultural community

Jan 2012: 1 7 GLAM/Newsletter/January 2012/Contents/Australia and New Zealand report , 2 5 GLAM/Newsletter/January 2012/Contents , 3 5 GLAM/Newsletter/December 2011/Contents/Israel report , 4 5 Wikipedian in Residence , 5 5 GLAM/Newsletter/Newsroom , 6 4 GLAM/Newsletter/January 2012/Contents/France report , 7 4 Wikipedia Education Program/Participation Requirements , 8 4 GLAM/Newsletter/January 2012/Contents/USA report , 9 4 History of the Paralympic Movement in Australia/Wikimedians to the Games/Participants , 10 4 Wikipedia Education Program , 11 4 Bookshelf , 12 4 GLAM/Contact , 13 3 GLAM/Newsletter/January 2012/Contents/UK report , 14 3 GLAM/Newsletter/January 2012/Contents/Germany report , 15 3 GLAM/Newsletter/January 2012/Contents/Indonesia report , 16 3 GLAM/Newsletter/January 2012/Contents/Netherlands report , 17 3 GLAM/Newsletter/January 2012/Contents/Czech Republic report , 18 3 Wikipedia Professor Orientation/Module Three , 19 3 Wikipedia Professor Orientation/Module Two , 20 3 GLAM/Newsletter/January 2012/Contents/Open Access report , 21 3 Cairo Pilot program plan , 22 3 GLAM/Newsletter/January 2012/Contents/Tool testing report , 23 3 GLAM/Newsletter/December 2011/Contents/France report , 24 3 Οδηγός Διοργάνωσης Σεμιναρίων για τον εμπλουτισμό της Wikipedia στα Ελληνικά , 25 3 GLAM/QRpedia

Feb 2012: 1 13 Wikipedia training day, Hobart VET , 2 10 Teaching-with-Wikipedia Cookbook (Wikimania 2012) , 3 9 Wikipedia training day, Kingston Tasmania , 4 8 Wikipedia Education Program , 5 6 GLAM/Newsletter/February 2012/Contents/USA report , 6 6 Regional Ambassadors/Current , 7 5 Wikipedia Professor Training/Sign , 8 5 Wikipedia Education Program media coverage , 9 4 Wikipedia Education Program visual identity , 10 4 GLAM/Newsletter/February 2012/Contents/Australia and New Zealand report , 11 4 GLAM/Newsletter/Suggestions , 12 3 GLAM/Newsletter/February 2012/Contents/Czech Republic report , 13 3 GLAM/Events/March 2012 , 14 3 GLAM/Newsletter/February 2012/Contents/Italy report , 15 3 Wikipedia Education Program/Arabic language countries/Microblogging , 16 3 Wikipedia Education Program/fr , 17 3 India outreach instructional videos , 18 3 GLAM/Newsletter/February 2012/Contents/Africa report , 19 3 GLAM/Newsletter/January 2012/Contents/From the team , 20 3 Cairo Pilot program plan , 21 3 GLAM/Model projects/GLAM events , 22 3 GLAM/QRpedia , 23 3 Wikipedia Education Program Summary Information , 24 3 GLAM , 25 2 Outreach team

Mar 2012: 1 26 Wikipedia Education Program/Wikimania 2012 , 2 17 Wikipedia Education Program/US-Canada/Updates , 3 7 Wikipedia Education Program , 4 7 GLAM/Contact , 5 6 Wikipedian in Residence , 6 6 GLAM/Newsletter/Newsroom , 7 5 GLAM/Newsletter/February 2012/Contents/Netherlands report , 8 5 GLAM/Newsletter/March 2012/Contents/Australia and New Zealand report , 9 5 GLAM/Newsletter/February 2012/Contents/USA report , 10 5 GLAM/Newsletter/February 2012/Contents , 11 5 Wikipedia Education Program media coverage , 12 4 GLAM/Newsletter/March 2012/Contents/France report , 13 4 Outreach team , 14 4 GLAM/Newsletter/February 2012/Contents/France report , 15 4 GLAM/Newsletter/February 2012/Contents/Czech Republic report , 16 4 GLAM/Newsletter/February 2012/Contents/Africa report , 17 4 Wikipedia Regional Ambassadors , 18 3 GLAM/Newsletter/March 2012/Contents/USA report , 19 3 GLAM/Newsletter/March 2012/Contents/Africa report , 20 3 GLAM/Newsletter/February 2012/Contents/Germany report , 21 3 GLAM/Newsletter/February 2012/Contents/Wiki Loves Monuments report , 22 3 GLAM/Newsletter/February 2012/Contents/Israel report , 23 3 Regional Ambassadors/Current , 24 2 GLAM/Newsletter/March 2012/Contents/UK report , 25 2 GLAM/Newsletter/March 2012/Contents/Bulgaria report

Apr 2012: 1 7 GLAM/Contact , 2 6 LGBT Outreach Project , 3 5 GLAM/Newsletter/April 2012/Contents/France report , 4 5 Best practices in training adults , 5 5 Wikipedia Education Program/US-Canada/Updates , 6 5 GLAM/Contact us , 7 4 Welcome to Wikipedia (Bookshelf)/ta , 8 4 GLAM/Newsletter/April 2012/Contents/USA report , 9 4 GLAM/Newsletter/March 2012/Contents/USA report , 10 4 Wikipedia Education Program Metrics and Activities Meeting , 11 4 Wikipedia Education Program media coverage , 12 3 GLAM/Newsletter/April 2012/Contents/UK report , 13 3 GLAM/Events/April 2012 , 14 3 GLAM/Newsletter/March 2012/Contents , 15 3 GLAM/Newsletter/Newsroom , 16 3 GLAM/Discussion , 17 3 Best practices , 18 2 Welcome to Wikipedia (Bookshelf)/kn , 19 2 Welcome to Wikipedia (Bookshelf)/mr , 20 2 GLAM/Newsletter/April 2012/Contents/Spain report , 21 2 Wikipedia Education Program Metrics and Activities Meeting/April 2012 , 22 2 History of the Paralympic Movement in Australia/Wikimedians to the Games/Participants/DawnRenshaw , 23 2 LGBT Outreach Project/Request for WMF board resolution on homophobia , 24 2 GLAM/Newsletter/April 2012/Contents , 25 2 GLAM/Case studies/Smithsonian Institution Archives/Women in Science Edit-a-thon

May 2012: 1 6 GLAM/Newsletter/April 2012/Contents/UK report , 2 6 Wikipedia Education Program/Wikimania 2012 , 3 6 Wikipedian in Residence , 4 6 GLAM/Contact , 5 5 GLAM/Newsletter/May 2012/Contents/Africa report , 6 5 GLAM/Newsletter/May 2012/Contents/USA report , 7 4 GLAM/Newsletter/May 2012/Contents/Spain report , 8 4 GLAM/Newsletter/May 2012/Contents/Germany report , 9 4 GLAM/Newsletter/April 2012/Contents/Israel report , 10 4 Wikipedia Education Program , 11 4 GLAM/Discussion , 12 3 GLAM/Newsletter/May 2012/Contents/Australia and New Zealand report , 13 3 GLAM/Newsletter/May 2012/Contents , 14 3 Evaluating Wikipedia article quality (Bookshelf)/es , 15 3 GLAM/Newsletter/May 2012/Contents/UK report , 16 3 GLAM/Newsletter/April 2012/Contents/Germany report , 17 3 GLAM/Newsletter/April 2012/Contents/USA report , 18 3 GLAM/Newsletter/April 2012/Contents , 19 3 GLAM/Volunteers , 20 3 Wikipedia Education Program Summary Information , 21 2 GLAM/Newsletter/May 2012/Contents/Italy report , 22 2 GLAM/Newsletter/May 2012/Contents/Sweden report , 23 1 Wikipedia Education Program/Classroom (Educators)/24a

Jun 2012: 1 17 Wikipedia Education Program/Wikimania 2012 , 2 6 Wikipedia Loves Libraries , 3 4 GLAM/Newsletter/June 2012/Contents/UK report , 4 4 Wikipedia Loves Libraries/Events , 5 4 Wikipedia Loves Libraries/Communication , 6 4 GLAM/Newsletter/May 2012/Contents/France report , 7 4 GLAM/Newsletter/May 2012/Contents/USA report , 8 3 Wikipedia Loves Libraries/Presentations , 9 3 GLAM/Newsletter/May 2012/Contents/Australia and New Zealand report , 10 3 GLAM/Newsletter/May 2012/Contents/Germany report , 11 3 GLAM/Newsletter/May 2012/Contents/UK report , 12 3 Welcome to Wikipedia (Bookshelf)/ta , 13 3 LGBT Outreach Project , 14 2 Wikipedia Education Program/US-Canada/Join , 15 2 Wikipedia Education Program/US-Canada/Campus Ambassadors , 16 2 Wikipedia Education Program/US-Canada , 17 2 Wikipedia Education Program/US-Canada/FAQ , 18 2 Education/Case Studies/milestones , 19 2 Wikipedia Education Program/Classroom (Ambassadors)/36 , 20 2 Wikipedia Education Program/Classroom (Ambassadors)/34a , 21 2 Wikipedia Education Program/Classroom (Ambassadors)/33a , 22 2 Wikipedia Education Program/Classroom (Ambassadors)/32a , 23 2 Wikipedia Education Program/Classroom (Ambassadors)/31a , 24 2 Wikipedia Education Program/Classroom (Ambassadors)/30a , 25 2 Wikipedia Education Program/Classroom (Ambassadors)/29a

Jul 2012: 1 31 Wikipedia Education Program/Wikimania 2012 , 2 6 GLAM/Newsletter/June 2012/Contents/UK report , 3 6 GLAM/Newsletter/June 2012/Contents/USA report , 4 5 Education Portal/Projects and Programs , 5 5 Education Portal/Newsletter , 6 5 Wikipedian in Residence , 7 5 GLAM/Contact , 8 4 GLAM/Newsletter/July 2012/Contents/Africa report , 9 4 GLAM/Contact us , 10 3 Education Portal/Newsletter/Newsroom , 11 3 GLAM/Newsletter/July 2012/Contents/UK report , 12 3 Cairo Pilot – final report , 13 3 GLAM/Newsletter/June 2012/Contents/From the team , 14 3 GLAM/Newsletter/June 2012/Contents/Netherlands report , 15 3 Wikipedia Loves Libraries , 16 3 GLAM/QR codes/Congressional Cemetery , 17 3 LGBT Outreach Project , 18 3 Education/Case Studies , 19 2 GLAM/Newsletter/July 2012/Header , 20 2 Education Portal , 21 2 GLAM/Newsletter/June 2012 , 22 2 Wikipedia Education Program/Training modules/Ambassadors , 23 2 GLAM/Newsletter/June 2012/Contents/Open Access report , 24 2 GLAM/Newsletter/June 2012/Contents/Germany report , 25 1 GLAM/Newsletter/July 2012/Contents/Italy report

Aug 2012: 1 6 GLAM/Newsletter/July 2012/Contents/Germany report , 2 6 Wikipedian in Residence , 3 5 Wikipedia Education Program/MENA/Tutorials , 4 5 GLAM/Contact , 5 4 Education Portal/Newsletter/Newsroom , 6 4 Education Portal/Contact us , 7 4 Education Portal/Newsletter/August 2012 , 8 4 Wikipedia Education Program/News/3 January 2012 , 9 3 Wikipedia as a Teaching Tool (Bookshelf)/Print version , 10 3 Education Portal/Newsletter/August 2012/Welcome to the first This Month in Education newsletter! , 11 3 Οδηγός συγγραφής λημμάτων για την Τοπική Αυτοδικοίκηση , 12 3 GLAM/Newsletter/August 2012/Contents , 13 3 GLAM/Newsletter/July 2012/Contents/USA report , 14 3 Education Portal/Projects and Programs , 15 3 GLAM/Newsletter/July 2012/Contents/UK report , 16 3 Wikipedia Education Program , 17 3 GLAM/Discussion , 18 2 Wikipedia Education Program/MENA/Timeplan , 19 2 GLAM/Newsletter/August 2012/Contents/Serbia report , 20 2 Wikipedia Education Program/Photo gallery , 21 2 Education Portal/Newsletter/August 2012/Project TAO at Wikimania: Promoting Wikipedia among Seniors , 22 2 Education Portal/Get involved , 23 2 Education Portal/Newsletter/Newsroom/Archive , 24 2 Education Portal/Newsletter/August 2012/Involving more professors in the Wikipedia Education Program in Brazil , 25 2 Education Portal/Newsletter/August 2012/EduWiki Conference, UK

Sep 2012: 1 10 Wikipedian in Residence , 2 6 Education Portal/Newsletter/September 2012 , 3 6 Education Portal/Newsletter/Newsroom , 4 5 Event planning process , 5 5 Wikipedia Education Program/Training modules/Ambassadors feedback , 6 5 GLAM/Contact , 7 4 GLAM/Toolset project , 8 4 Wikipedia as a Teaching Tool (Bookshelf)/Print version , 9 4 GLAM/Newsletter/August 2012/Contents/Africa report , 10 4 GLAM/Newsletter/Newsroom , 11 3 GLAM Bootcamp , 12 3 Concepts , 13 3 GLAM/Newsletter/August 2012/Contents/Germany report , 14 3 GLAM/Newsletter/August 2012/Contents/UK report , 15 3 GLAM/Newsletter/August 2012/Contents , 16 3 Wikipedia Education Program/MENA/Tutorials , 17 3 Editathon , 18 3 GLAM/Model projects/GLAM events , 19 3 GLAM/Tools & Requests , 20 2 GLAM/Newsletter/September 2012/Contents/Mexico report , 21 2 GLAM/Newsletter/September 2012/Contents/UK report , 22 2 GLAM/Toolset project/Request for Comments/Technical Architecture , 23 2 GLAM/Toolset project/Request for Comments/Techinical Architecture , 24 2 GLAM/Toolset project/Request for Comments , 25 2 Best practices in working with developers

Oct 2012: 1 7 GLAM Bootcamp/US , 2 5 GLAM/Newsletter/September 2012/Contents/Sweden report , 3 5 Education Portal/Newsletter/Newsroom , 4 4 GLAM/Newsletter/September 2012/Contents/Spain report , 5 4 GLAM/Newsletter/September 2012/Contents/Germany report , 6 4 GLAM/Newsletter/September 2012/Contents/India report , 7 4 GLAM/Newsletter/September 2012/Contents/Open Access report , 8 4 GLAM/Newsletter/September 2012/Contents/Africa report , 9 4 Wikipedia Education Program/Training modules/Ambassadors feedback , 10 4 GLAM/Contact us , 11 3 GLAM/Newsletter/September 2012 , 12 3 GLAM/Events/October 2012 , 13 3 GLAM/Newsletter/September 2012/Contents/UK report , 14 3 GLAM/Newsletter/September 2012/Contents/Switzerland report , 15 3 Wikipedian in Residence , 16 3 GLAM/Newsletter/Newsroom , 17 3 GLAM/Case studies , 18 2 Education Portal/Newsletter/September 2012/Research shows students improve English Wikipedia , 19 2 Education Portal/Newsletter/September 2012/Wikipedia de la A a la W by Tomás Saorin of the University of Murcia , 20 2 Wikipedian in Residence/Ladd Observatory , 21 2 GLAM/Newsletter/October 2012/Contents , 22 2 GLAM/Newsletter/September 2012/Announcement , 23 2 GLAM/Newsletter/September 2012/Contents/USA report , 24 2 GLAM/Newsletter/September 2012/Contents/From the team , 25 2 GLAM/Case studies/WikiAfrica/Share Your Knowledge/Institutions

Nov 2012: 1 6 Education Portal/Newsletter/Newsroom , 2 4 GLAM/Newsletter/October 2012/Contents/Germany report , 3 4 GLAM/Newsletter/October 2012/Contents/Open Access report , 4 3 GLAM/Newsletter/October 2012 , 5 3 GLAM/Newsletter/October 2012/Contents/Sweden report , 6 3 GLAM/Newsletter/October 2012/Contents/USA report , 7 3 GLAM/Contact , 8 2 GLAM/Newsletter/November 2012/Contents/France report , 9 2 Wikipedian in Residence/SAHS , 10 2 GLAM/Newsletter/October 2012/Announcement , 11 2 GLAM/Newsletter/October 2012/Contents/From the team , 12 2 GLAM/Newsletter/October 2012/Contents/UK report , 13 1 GLAM/Newsletter/November 2012/Contents/USA report

Dec 2012: 1 6 GLAM/Newsletter/November 2012/Contents/Australia and New Zealand report , 2 6 GLAM/Newsletter/Newsroom , 3 5 GLAM/Newsletter/November 2012/Contents/Germany report , 4 4 GLAM/Events/January 2013 , 5 4 GLAM/Newsletter/November 2012/Contents/Sweden report , 6 4 Education Portal/Newsletter/Newsroom , 7 3 GLAM/Newsletter/November 2012/Contents/UK report , 8 3 GLAM/Events/December 2012 , 9 3 GLAM/Newsletter/November 2012/Contents/USA report , 10 3 GLAM/Newsletter/November 2012/Contents/France report , 11 3 Education Portal/Tips and Resources , 12 3 GLAM/Newsletter/Suggestions , 13 2 GLAM/Crowdsourcing projects , 14 2 GLAM/Newsletter/November 2012/Contents/Africa report , 15 2 GLAM/Newsletter/December 2012/Contents/Open Access report , 16 2 GLAM/Events/April 2013 , 17 1 GLAM/Newsletter/January 2013/Header

Jan 2013: 1 3 GLAM/Newsletter/December 2012/Contents/Netherlands report , 2 3 GLAM/Newsletter/December 2012/Contents/Tool testing report , 3 2 Education/Case Studies/resumiruntema , 4 2 GLAM/Newsletter/December 2012/Contents/France report , 5 2 GLAM/Newsletter/December 2012/Contents/UK report , 6 2 GLAM/Newsletter/December 2012/Contents/Italy report , 7 2 GLAM/Newsletter/December 2012/Contents/USA report , 8 2 GLAM/Newsletter/December 2012/Contents , 9 2 GLAM/Events/January 2013 , 10 2 Education Portal/Tips and Resources , 11 1 GLAM/Newsletter/January 2013/Contents

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Tuesday July 23, 2013 21:09

Dump file outreachwiki-latest-pages-meta-history.xml.bz2 (full dump), size 15 Mb as bz2 -> 311 Mb
Dump processed till Jan 11, 2013, on server stat1, ready at Fri-11/01/2013-02:50 after 42 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.