Estatísticas da Wikispecial multilingual wikisource

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wiki unspecified for code 'sources'

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: novembro 2018
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
Nov 2018+1% +90% +4%+124%  +43%      +1%
Oct 20180%   +2%+61%  +89%      +1%
Sep 20180%   +1%-18%  -25%      +2%
Aug 2018+1% -71% +1%-3%  -38%      +2%
Jul 2018+1% +141% +2%-39%  -72%      +3%
Jun 2018+1% +39% +3%+10%  +423%      +2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
Nov 2018105312401376 k1013,4 9,2 k      3,6 k
Oct 20181041421873 k453,4 6,4 k      3,6 k
Sep 20181037417672 k283,4 3,4 k      3,5 k
Aug 20181033722471 k343,4 4,5 k      3,5 k
Jul 2018102614771270 k353,4 7,3 k      3,4 k
Jun 201810128321069 k573,3 27 k      3,3 k
May 20181004423767 k523 5,1 k      3,2 k
Apr 20181000316565 k1623 6,7 k      3,1 k
Mar 2018997215261 k203,2 2,0 k      3,1 k
Feb 2018995323460 k393,2 2,9 k      3,1 k
Jan 2018992317659 k423,2 3,7 k      3,0 k
Dec 2017989418457 k203,2 2,5 k      2,9 k
Nov 2017985920657 k403,2 4,3 k      2,9 k
Oct 2017976621556 k1203,2 6,2 k      2,9 k
Sep 2017970212352 k423,3 2,1 k      2,8 k
Aug 2017968216151 k83,3 1,7 k      2,8 k
Jul 2017966315250 k93,3 1,9 k      2,7 k
Jun 2017963323150 k73,3 925      2,7 k
May 20179601538450 k103,3 1,6 k      2,7 k
Apr 2017945714250 k113,3 922      2,7 k
Mar 2017938519449 k113,3 1,4 k      2,7 k
Feb 2017933628349 k163,3 3,3 k      2,7 k
Jan 20179271033349 k323,2 1,9 k      2,7 k
Dec 2016917722248 k153,2 1,2 k      2,7 k
Nov 2016910720347 k83,2 853      2,7 k
Oct 2016903416247 k63,2 543      2,7 k
Sep 2016899141249 47 k223,2 4,4 k      2,7 k
Aug 2016758621146 k73,2 663      2,6 k
Jul 201675254116146 k123,2 2,5 k      2,6 k
Jun 201669863157445 k383,2 7,9 k      2,6 k
May 2016635316344 k133,1 757      2,4 k
Apr 201663229 44 k33,1 1,5 k      2,4 k
Mar 2016630520544 k433,1 2,4 k      2,4 k
Feb 2016625215242 k603,1 9,6 k      2,4 k
Jan 2016623822541 k803 3,7 k      2,3 k
Dec 2015615214238 k673,1 3,5 k      2,3 k
Nov 2015613220236 k133,2 1,0 k      2,3 k
Oct 2015611519236 k123,2 1,6 k      2,3 k
Sep 201560668124535 k403,2 3,5 k      2,3 k
Aug 2015538317534 k373,2 2,2 k      2,3 k
Jul 201553552138233 k203,2 2,7 k      2,3 k
Jun 2015483 17232 k43,2 892      2,3 k
May 201548314431932 k203,2 6,4 k      2,3 k
Apr 2015469421332 k253 1,5 k      2,3 k
Mar 2015465627231 k193,139871,3 k179 Mb13,8 M47 k1,5 k1,3 k3,6 k2,3 k
Feb 201545958134330 k533,139913,1 k174 Mb13,7 M46 k1,5 k1,3 k3,6 k2,2 k
Jan 2015401313129 k103,14015667174 Mb13,7 M46 k1,5 k1,3 k3,6 k2,2 k
Dec 2014398519329 k553,139672,1 k171 Mb13,5 M46 k1,5 k1,2 k3,6 k2,2 k
Nov 2014393621327 k263,344771,7 k167 Mb13,3 M46 k1,5 k1,2 k3,6 k2,2 k
Oct 2014387517226 k153,34516998166 Mb13,2 M46 k1,4 k1,2 k3,6 k2,1 k
Sep 20143821427126 k143,344931,1 k163 Mb13,0 M46 k1,4 k1,2 k3,6 k2,1 k
Aug 2014368628125 k113,34443796160 Mb12,7 M45 k1,4 k1,2 k3,6 k2,1 k
Jul 2014362215125 k83,34451614159 Mb12,7 M45 k1,4 k1,2 k3,6 k2,1 k
Jun 2014360214225 k83,44479740159 Mb12,6 M45 k1,4 k1,2 k3,6 k2,1 k
May 2014358215124 k63,44507530158 Mb12,6 M45 k1,4 k1,2 k3,6 k2,1 k
Apr 2014356317324 k83,444661,3 k156 Mb12,4 M45 k1,4 k1,2 k3,6 k2,1 k
Mar 2014353229624 k193,344772,2 k156 Mb12,4 M45 k1,4 k1,2 k3,6 k2,1 k
Feb 201435116541423 k703,345075,5 k154 Mb12,4 M44 k1,4 k1,2 k3,5 k2,1 k
Jan 201433512452321 k803,446746,3 k147 Mb12,2 M42 k1,4 k1,2 k3,4 k2,0 k
Dec 20133231537619 k413,547312,7 k145 Mb12,0 M41 k1,4 k1,1 k3,4 k2,0 k
Nov 20133081427418 k183,647391,4 k143 Mb11,9 M41 k1,3 k1,1 k3,4 k2,0 k
Oct 201329428117 k73,64737500142 Mb11,8 M40 k1,3 k1,1 k3,3 k2,0 k
Sep 2013292 9217 k143,64707727140 Mb11,5 M40 k1,3 k1,1 k3,3 k2,0 k
Aug 2013292410416 k193,747271,3 k139 Mb11,5 M40 k1,3 k1,1 k3,3 k2,0 k
Jul 201328829116 k53,74741397137 Mb11,4 M40 k1,3 k1,1 k3,3 k2,0 k
Jun 2013286215116 k33,84742460136 Mb11,3 M40 k1,3 k1,1 k3,3 k1,9 k
May 2013284617216 k73,74752776136 Mb11,3 M40 k1,3 k1,1 k3,2 k1,9 k
Apr 2013278419615 k273,747612,2 k134 Mb11,1 M39 k1,3 k1,1 k3,2 k1,9 k
Mar 2013274214415 k173,847771,4 k129 Mb10,7 M39 k1,2 k1,1 k3,1 k1,8 k
Feb 2013272515314 k243,848762,2 k128 Mb10,5 M39 k1,2 k1,0 k3,1 k1,8 k
Jan 2013267311213 k163,950192,4 k124 Mb10,3 M38 k1,2 k9952,8 k1,7 k
Dec 201226439113 k143,852021,3 k122 Mb10,2 M37 k1,2 k9922,8 k1,6 k
Nov 201226128 12 k13,95369225119 Mb10,1 M37 k1,2 k9852,8 k1,6 k
Oct 201225938112 k63,95367415119 Mb10,1 M37 k1,2 k9842,8 k1,6 k
Sep 201225618 12 k43,95379276118 Mb10,1 M37 k1,2 k9842,8 k1,6 k
Aug 201225538 12 k23,95393168117 Mb10,0 M37 k1,2 k9842,8 k1,6 k
Jul 201225218 12 k33,95394353115 Mb9,9 M36 k1,2 k9852,8 k1,6 k
Jun 2012251 7 12 k23,95384323114 Mb9,9 M36 k1,1 k9812,7 k1,6 k
May 201225129112 k103,95391828114 Mb9,9 M36 k1,1 k9812,7 k1,6 k
Apr 201224938112 k23,95454312111 Mb9,7 M35 k1,1 k9672,7 k1,5 k
Mar 201224619212 k83,954241,4 k110 Mb9,6 M35 k1,1 k9672,7 k1,5 k
Feb 201224526111 k53,95526463108 Mb9,5 M35 k1,1 k9852,7 k1,2 k
Jan 2012243510 11 k33,95846351105 Mb9,2 M34 k1,0 k9842,5 k1,2 k
Dec 201123823 11 k23,95926207103 Mb9,1 M34 k9949822,4 k1,2 k
Nov 2011236310111 k133,95941669102 Mb9,0 M34 k9919882,3 k1,2 k
Oct 2011233310111 k946169655102 Mb9,0 M33 k6499822,3 k1,2 k
Sep 2011230415110 k346306790101 Mb8,9 M32 k6259782,2 k1,1 k
Aug 2011226514110 k24462831,0 k101 Mb8,8 M32 k5639062,2 k1,1 k
Jul 201122141739,5 k254,266122,0 k99 Mb8,6 M30 k5589022,2 k1,1 k
Jun 201121741328,7 k84,3688186194 Mb8,2 M29 k1,8 k8981,8 k1,1 k
May 20112131818,5 k24,3696534594 Mb8,2 M29 k1,8 k8901,7 k1,1 k
Apr 201121251228,4 k164,3698689893 Mb8,1 M29 k1,7 k8811,7 k1,1 k
Mar 201120721318,0 k24,5715740892 Mb8,1 M29 k1,7 k8851,5 k1,0 k
Feb 201120518 7,9 k24,4753423291 Mb8,0 M29 k1,7 k8661,2 k1,0 k
Jan 2011204211 7,9 k24,4763235490 Mb7,9 M29 k1,7 k8651,1 k1,0 k
Dec 20102021917,8 k24,4765131690 Mb7,9 M29 k1,7 k8641,1 k1,0 k
Nov 201020128 7,7 k 4,4766222790 Mb7,9 M29 k1,7 k8681,1 k1,0 k
Oct 201019911517,7 k44,4770640889 Mb8,0 M29 k1,7 k8721,1 k1,0 k
Sep 201019811327,6 k64,4772999588 Mb7,8 M29 k1,6 k8711,0 k1,0 k
Aug 2010197611 7,4 k34,4779652487 Mb7,6 M29 k1,7 k8711,0 k1,0 k
Jul 201019161217,3 k54,4786148286 Mb7,5 M29 k1,6 k8711,0 k1,0 k
Jun 201018538 7,2 k14,4791730586 Mb7,4 M29 k1,5 k8631,0 k1,0 k
May 201018211017,1 k24,4791533486 Mb7,4 M29 k1,5 k8561,0 k1,0 k
Apr 201018161117,1 k34,4792171785 Mb7,4 M29 k1,5 k8531,0 k1,0 k
Mar 201017538 7,0 k34,3793431984 Mb7,4 M29 k1,5 k8231,0 k1,0 k
Feb 201017218 6,9 k14,3756912980 Mb7,0 M29 k1,5 k8199991,0 k
Jan 201017121216,9 k34,3758439480 Mb7,0 M29 k1,5 k8199851,0 k
Dec 200916911326,8 k144,375911,6 k80 Mb7,0 M29 k1,4 k7859761,0 k
Nov 20091682716,3 k24,4786924178 Mb6,9 M29 k1,4 k780954745
Oct 2009166 4 6,3 k 4,478869577 Mb6,9 M29 k1,4 k780953742
Sep 20091661416,3 k34,4794222777 Mb6,9 M29 k1,4 k779954732
Aug 200916548 6,2 k24,4810626776 Mb6,8 M29 k1,4 k775954728
Jul 200916121026,1 k34,4789378274 Mb6,6 M29 k1,3 k774954721
Jun 200915931126,0 k74,3778479372 Mb6,4 M28 k1,4 k772938709
May 200915661015,8 k54,3777745569 Mb6,2 M28 k1,4 k752933677
Apr 20091502915,7 k64,4752654464 Mb5,9 M28 k1,3 k730912658
Mar 200914831725,5 k174,473551,2 k62 Mb5,6 M28 k1,3 k725907657
Feb 200914541135,0 k164,774881,3 k59 Mb5,8 M28 k1,3 k755882647
Jan 200914181824,5 k34,8776066958 Mb5,9 M28 k1,3 k750821525
Dec 200813331024,4 k174,876191,2 k55 Mb5,6 M27 k1,3 k749794517
Nov 200813041313,9 k75,1832972849 Mb5,2 M23 k1,2 k711459474
Oct 200812631023,7 k35,2861266548 Mb5,0 M22 k1,2 k551438462
Sep 200812331313,6 k35,2877538048 Mb5,0 M22 k1,2 k439432452
Aug 200812051313,5 k25,2893876547 Mb5,0 M22 k1,1 k415405431
Jul 200811541123,4 k85,1879778245 Mb5,1 M22 k1,1 k414395342
Jun 20081113913,2 k45,2923440942 Mb5,3 M22 k1,1 k412389202
May 20081081713,1 k25,2869430439 Mb4,8 M21 k1,1 k406381198
Apr 20081071713,0 k25,3883632239 Mb4,8 M21 k1,1 k414383196
Mar 200810641013,0 k35,3875337337 Mb4,6 M21 k1,1 k406382191
Feb 200810229 2,9 k25,3863527836 Mb4,4 M21 k1,0 k398374187
Jan 200810049 2,8 k25,3871642336 Mb4,4 M21 k1,0 k390373184
Dec 2007964822,8 k45,2877045336 Mb4,4 M21 k984289369177
Nov 20079257 2,6 k15,3851536133 Mb4,0 M21 k975274361160
Oct 20078731112,6 k25,2843731933 Mb4,0 M21 k966248356159
Sep 200784 3 2,5 k 5,3818512831 Mb3,8 M21 k957242351156
Aug 2007841612,5 k65,2821434731 Mb3,8 M21 k955238346150
Jul 20078328 2,3 k15,5813219330 Mb3,5 M21 k888225336147
Jun 20078138 2,3 k15,5803435328 Mb3,4 M21 k884210285142
May 200778 822,3 k45,5799033728 Mb3,3 M21 k883201274130
Apr 2007783812,1 k45,7795049526 Mb3,1 M21 k877198268128
Mar 20077541212,0 k35,7758670423 Mb2,8 M20 k816188268124
Feb 200771 421,9 k145,665841,6 k22 Mb2,1 M20 k787166270108
Jan 20077121031,5 k6675271,2 k21 Mb1,9 M20 k738149263106
Dec 20066927 1,3 k46830832020 Mb1,8 M19 k55513526294
Nov 2006673411,2 k66,387411,2 k19 Mb1,8 M19 k55513125193
Oct 200664 4 1,0 k 6,389437817 Mb1,6 M19 k39313024288
Sep 200664 2 1,0 k26,3878910216 Mb1,5 M19 k41013026187
Aug 200664 3 97026,6906213815 Mb1,5 M19 k40711925587
Jul 20066412 90916,9928410015 Mb1,4 M19 k40812625885
Jun 200663 3 878 793907314 Mb1,3 M19 k40812525385
May 200663 3 875 6,993877614 Mb1,3 M19 k41013023885
Apr 20066313 874 6,894175414 Mb1,3 M19 k39812319882
Mar 200662 2 862 6,994706914 Mb1,3 M19 k39911919480
Feb 20066235 85716,8947516214 Mb1,3 M19 k39311920380
Jan 20065926 84216,8958227514 Mb1,3 M19 k39312020079
Dec 20055714 81116,7937720214 Mb1,2 M18 k34910019276
Nov 20055612 793 6,694135513 Mb1,2 M17 k3499219072
Oct 200555 5 787 6,6946511413 Mb1,2 M17 k3499019072
Sep 20055524178116,5948330613 Mb1,2 M17 k3447719472
Aug 20055328 74716,3937938513 Mb1,1 M17 k3215418269
Jul 20055129 72816963622713 Mb1,1 M17 k3565517760
Jun 20054926 699 5,9974614312 Mb1,1 M17 k3305417748
May 200547610268615,8981463411 Mb1,1 M17 k3405417745
Apr 200541310 64115,282532219,8 Mb777 k17 k3395317043
Mar 20053828 599 5,278981849,1 Mb718 k16 k3374716641
Feb 20053626 5921581051689,1 Mb717 k16 k3143316039
Jan 20053426 57434,857702388,0 Mb492 k17 k3032015135
Dec 20043212 496 5,15824957,3 Mb487 k17 k2711714123
Nov 20043126 486 558442415,2 Mb486 k17 k2661516623
Oct 20042922 479 4,657151435,1 Mb471 k17 k2571517322
Sep 20042723 47514,349141624,7 Mb406 k17 k2601517419
Aug 20042536 453 4,249351673,9 Mb399 k17 k2361015518
Jul 20042258 44113,947811703,6 Mb376 k16 k230 13013
Jun 20041715 41913,74907963,4 Mb366 k16 k204 938
May 20041625 40313,649841343,4 Mb359 k16 k204 768
Apr 20041414 37733,551183393,2 Mb345 k15 k202 737
Mar 20041324 27713,660141272,1 Mb301 k12 k182 675
Feb 20041117 24313,661462201,9 Mb269 k11 k180 544
Jan 20041024 2137361553121,7 Mb234 k10,0 k168 413
Dec 2003847 8 42,1157021240 kb1,9 k70129 332
Nov 2003446 4 31,2179812517 kb1,0 k1349 17 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  250  5  10  100  1000 
Nov 201863464031221391 1111 35151062      49231794222   
Oct 20185328211812843 111  34148321     412519166311   
Sep 2018382117137631 11   2286321     29129641 1   
Aug 20184128221610421122   2397311     4326201110511   
Jul 20182551447731181271 221  2697642 11  3519151243 21  
Jun 201847353223141052 1111125117311     37191412832    
May 20184226231710722      391912931     412116118211   
Apr 201840191612105421     1997221 11  311212864 1   
Mar 2018321815114221      24117311 1   301612852     
Feb 2018413023169431      351310411     4621151061     
Jan 2018382017138631      2096431     3220161051     
Dec 2017482118148421      2386311     3716126531    
Nov 20174726201813622      25107311     33171164321   
Oct 201742262118135311     2071111     26141085111   
Sep 201731151297321      1952211     271396111    
Aug 2017342016137111      2642211     281310621     
Jul 201735211597211      2283211     30199532 1   
Jun 201751302314811       209821111   31189532     
May 201754443825184        1882111 1   342015831 11  
Apr 201734211411721       25129521     361511721 1   
Mar 201739251913941       361610741 1   35151271  1   
Feb 20174930282213311 221  2673321 11  39161181  1   
Jan 2017664133261231  111  3354311 11  401513101      
Dec 2016522722171021       28126431     47181510311    
Nov 20164425201573        1853111     31116211 1   
Oct 20164222161262        1641111     33147411 1   
Sep 201627225624922735        1763111     37191173  1   
Aug 20165526211151        1674211     311612311 1   
Jul 2016164140116447111      2063211     2817711  1   
Jun 20162281891577194311221  27105211     321286311    
May 2016361916973        2363111     286531  1   
Apr 20162614953   1111 216411      291061   1   
Mar 201642232015951  111  2297421     36131032111   
Feb 201631191512621  1111 26129431 1   371413851 211 
Jan 2016723122181051  1111 32118631 1   5726151061 1   
Oct 20185328211812843 111  34148321     412519166311   
Jul 20182551447731181271 221  2697642 11  3519151243 21  
Apr 201840191612105421     1997221 11  311212864 1   
Jan 2018382017138631      2096431     3220161051     
Oct 201742262118135311     2071111     26141085111   
Jul 201735211597211      2283211     30199532 1   
Apr 201734211411721       25129521     361511721 1   
Jan 2017664133261231  111  3354311 11  401513101      
Oct 20164222161262        1641111     33147411 1   
Jul 2016164140116447111      2063211     2817711  1   
Apr 20162614953   1111 216411      291061   1   
Jan 2016723122181051  1111 32118631 1   5726151061 1   
Oct 20153322191692   111  234221      32181172  1   
Jul 201534522013854921       2253332     3810855  1   
Apr 201535212114532       2285211 22222415931  211 
Jan 20152715131261        235211      371494       
Oct 201450241713821       2365211     3314742  1   
Jul 20142717151051   11   932111     35111153      
Apr 201432201710831       65211      26511       
Jan 20146950454040235       1641111     4014953  1   
Oct 201323138751        821111     3110731  1   
Jul 201322109751        832211     2911842  1   
Apr 2013272119161262       2374311     462415105      
Jan 20133616119422       2572211     4516952      
Oct 201219128631        1584411     28851       
Jul 20123412843        1753222     408631      
Apr 20122198321        217532      44171162      
Jan 201232151074        34191362      4915742      
Oct 2011261610821   11   197633      3318962      
Jul 201138191712731  111  215311      38138321 1   
Apr 20113317128721  22   2211622      38831       
Jan 201135181193        219752      28107611     
Oct 2010312115631        30161372      431612851     
Jul 2010301712761        2414631      542413531     
Apr 20102914117311       3313621      3914942      
Jan 2010291512531        3311621      5618119311    
Oct 200916642         2711641      4014112       
Jul 20091913107421       1710421      44159531     
Apr 200925149511        278521      45151141  1   
Jan 20094221181242        257521      5218104111    
Oct 20082914105221       249742      3913954      
Jul 20082919119321       246552      662216114      
Apr 200824127321        2272        4410731      
Jan 20082511974        1873        44221231      
Oct 2007251211521        16105        5715611      
Jul 20072312841        1973        35733       
Apr 200714887411       199421      4513972      
Jan 20073215107631  11   197421      44128431     
Oct 20061474          16321       451383       
Jul 2006112211   11   1452        49165        
Apr 200611431         19822       7425121       
Jan 2006207632        2713753  111 1335121135      
Oct 2005177521        26931       58221531      
Jul 20054522951        70272081      145573422112111  
Apr 200527131032        561912103      182684619111     
Jan 2005168642        381161       51201183      
Oct 200422522         28742       93322071      
Jul 200420984         20411       4915841      
Apr 200417643         157321      319521      
Jan 2004157431        10532       289541      

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
13,051100.0%206,486100.0%
31,70255.8%204,29398.9%
101,05234.5%200,52697.1%
3243614.3%189,55291.8%
1002157.0%178,01386.2%
316983.2%156,60475.8%
1000391.3%123,68659.9%
3162130.4%82,41239.9%
1000010.0%24,30911.8%

 

50 autores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
GiakoshUC1 024,3098981,95223Mar 31, 20176082,998128--
MizardellorsaUC2+36,2107861,36313Apr 21, 200935091,605181--
MahagajaUC3+16,01654484813Feb 23, 200550271,13579--
G.MussoUC7+44,62453951848May 01, 20175772,048279--
NigmontUC8 04,2655785123Jan 24, 201514052,84525--
Alex brolloUC12+13,9535061,79189Sep 11, 200837311,680---
JhsBotUC18+242,4071,554--Aug 04, 2018117----
AnkryUC19-12,01462,27740Jun 28, 20112711810---
Jon Harald SøbyUC20+51,9226821,314309May 19, 20175591,201315--
अजीत कुमार तिवारीUC21...1,6191,6191010Nov 04, 201825777777--
Павло ГетманцевUC23-31,461473-Aug 13, 201683883---
ChelinUC24-31,406345916Mar 27, 20132073295---
Рөстәм НурыевUC25-31,38444404-Apr 28, 20122406272---
KumincirUC30-11,1112044-Jan 22, 201514077755--
PmsarangiUC40+839797465-May 27, 20141647920728--
CandaluaUC45 0847188753Mar 08, 2008391812---
Satdeep GillUC50 073622761Oct 04, 201318822361--
Reptilien.19831209BE1UC55+66547118711May 03, 201821022724--
OoswesthoesbesUC70-254841,95115Sep 30, 200740785---
DezidorUC75-2452218-Dec 03, 200836483001--
Juan renombradoUC89-236731-Dec 10, 20122180----
Abhinav619UC98+292432932822Oct 28, 201832306306--
TchořUC114-3258162-Aug 05, 2012230713---
VIGNERONUC116-32491377-Mar 29, 2010316755---
АйсарUC126 023351012Jan 05, 20161059662--
RuthvenUC129+1572311774038Apr 10, 20182332---
HrishikesUC140+5320893289Jul 18, 20141595628--
Klein MuçiUC186...12712711Nov 02, 2018279595--
हृषिकेश कुमार सिंहUC198...115115--Nov 15, 2018147979--
MatlinUC208-1104371Jan 01, 20161063753--
अनिरुद्ध!UC215...10010011Nov 20, 2018911--
Sushma SharmaUC252+27351-Jan 29, 201766933--
MithridatesUC353+4684228109Nov 01, 200547762015--
OrbiliusMagisterUC354+54428654Jun 24, 20064541101--
Anthem LoverUC360+5754230--Sep 24, 2018661716--
XorasanUC389+12238123-Sep 22, 2018682110--
RaschladirasUC477+16829933-Aug 09, 20181126---
Orestia9UC479...2929--Nov 02, 20182733--
LismiaUC495...2828--Nov 25, 20184----
अनुनाद सिंहUC524+482531-Jul 30, 200741402---
Emanuele676UC717...1818--Nov 25, 20184----
संजीव कुमारUC752...1717--Nov 10, 20181999--
Alex brollo bisUC774+67162151Sep 04, 2015118213---
Parma1983UC829...1515--Nov 20, 20189----
Liuxinyu970226UC903+2413165-Dec 17, 2016712----
Chinmayee MishraUC907...1313--Nov 24, 20185----
VorziblixUC959+1727111011May 20, 20141654----
1l2l3kUC1111...99--Nov 18, 201811----
Raju JangidUC1162+169821-Jul 14, 201512341---
GuaihirrUC1180...8811Nov 22, 2018788--

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
JimreganUC45,732Sep 10, 20112637Jul 17, 2018135
C.R.UC55,574Nov 11, 20131844Jun 27, 2017520
Blossfeldia liliputańaUC65,249Sep 12, 2017443Oct 25, 2017400
KäthesBücherUC94,246Apr 04, 2018239Jul 16, 2018136
DixtosaUC104,166Jun 03, 20112736Jun 11, 2016901
მარგალონაUC114,154Sep 28, 20112619Oct 09, 201851
SmeiraUC133,914Oct 31, 20064412Mar 05, 20083921
AgiUC143,140Jan 17, 20132142Sep 08, 201882
SlomoxUC153,062Oct 08, 20064435Mar 30, 2017609
CrowerUC162,911Aug 02, 20103041Jul 14, 2017503
SatdeepbotUC172,755Dec 28, 2016701Feb 20, 2017647
AndynikyUC221,593Aug 17, 20131930Feb 09, 20141754
PheUC261,317Feb 04, 20103220Jul 10, 2016872
Nazni gomesUC271,309May 11, 20151298Jan 21, 20161043
វ័ណថារិទ្ធUC281,239Jan 23, 20112867Jan 21, 20151408
SahilrathodUC291,181Apr 30, 20151309May 04, 20151305
ZUFArUC311,092May 04, 20122400Aug 22, 201899
Jumark27UC321,090Oct 21, 20151135Jun 30, 2018152
Parveer GrewalUC331,076Nov 01, 20151124Mar 18, 2017621
HektorUC341,069Jul 01, 2016881Aug 29, 2016822

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 16.169 edições foram feitas por usuários anônimos, de um total de 260.715 edições ( 6e %)
  


20 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AkBotUC121,566Nov 24, 20122196Jul 23, 2018129--
BrolloBotUC213,538Sep 19, 20151167Mar 27, 20169775,059-
Wikisource-botUC3657Oct 15, 20151141Oct 27, 20151129--
RahmanuddinBotUC4552Jun 15, 2016897Jun 23, 2016889552-
CandalBotUC5495Nov 08, 20102943May 02, 2018211--
SumitaBotUC6469Jan 19, 2017679Feb 13, 2017654467-
DougBotUC7177Aug 27, 20112651Aug 27, 20112651177-
Electron BotUC8156Aug 23, 20151194Aug 23, 20151194--
ThomasBotUC9111Aug 27, 20054842Apr 30, 2011277047-
タチコマ robotUC1085Apr 28, 20083867Mar 23, 2017616--
SDrewthbotUC1160Dec 18, 20102903Oct 29, 20112588--
IanraBotUC1248Jul 02, 20141611Jul 02, 2014161148-
RileyBotUC1345Feb 09, 20132119Jun 27, 2016885--
SmeiraBot~sourceswikiUC1437Jan 26, 20074325Jan 26, 20074325--
AvocatoBotUC1535May 07, 20122397May 07, 20122397--
AlebotUC1622Feb 14, 20103210Jun 13, 20151265--
SlobotUC172Feb 28, 20093561Feb 28, 200935612-
ProtectoBotUC182Nov 01, 20112585Nov 01, 20112585--
Phe-botUC192Dec 27, 20112529Jul 03, 2016879--
Crochet.david.botUC201May 14, 20083851May 14, 20083851--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJpgOggPdfPngSvg
Nov 201832 k3,6 k3861,3 k1,1 k1,7 k133,3 k  47 k838982  1879822144763035
Oct 201832 k3,5 k3841,3 k1,1 k1,7 k133,3 k  44 k816979  1858321944643035
Sep 201831 k3,5 k3761,3 k1,1 k1,7 k133,2 k  43 k804897  1857421944613035
Aug 201830 k3,5 k3731,3 k1,1 k1,7 k133,2 k  43 k800887  1847421944613035
Jul 201830 k3,5 k3661,2 k1,1 k1,6 k133,2 k  43 k794815  1847421944603035
Jun 201829 k3,5 k3651,2 k1,1 k1,6 k133,1 k  42 k767808  1737421944603035
May 201828 k3,5 k3631,2 k1,1 k1,5 k133,0 k  41 k741733  1667418144603015
Apr 201828 k3,4 k3561,2 k1,1 k1,5 k133,0 k  40 k717727  1647418144603014
Mar 201827 k3,4 k3541,2 k1,1 k1,5 k132,9 k  36 k692720  1517418144603014
Feb 201827 k3,4 k3511,2 k1,1 k1,5 k132,9 k  35 k688702  1467417644583014
Jan 201827 k3,4 k3441,1 k1,1 k1,4 k132,8 k  34 k673691  1397416644533014
Dec 201726 k3,4 k3441,1 k1,1 k1,4 k132,6 k  33 k641677  1257416644363014
Nov 201726 k3,3 k3421,1 k1,1 k1,4 k122,6 k  33 k636656  1257416644293014
Oct 201725 k3,3 k3421,1 k1,1 k1,4 k122,5 k  33 k615572  1257416644273014
Sep 201724 k3,3 k3381,1 k1,1 k1,4 k122,4 k  30 k595554  1097416644273014
Aug 201724 k3,3 k3381,1 k1,1 k1,4 k122,4 k  29 k580554  957416644273014
Jul 201724 k3,3 k3371,1 k1,1 k1,4 k122,4 k  29 k579553  957416644273014
Jun 201724 k3,2 k3351,0 k1,1 k1,4 k122,4 k  29 k567544  947416544092994
May 201723 k3,2 k3351,0 k1,1 k1,4 k122,3 k  29 k564534  937416544082724
Apr 201723 k3,2 k3339701,1 k1,3 k122,3 k  29 k559529  937416544072234
Mar 201723 k3,2 k3319671,1 k1,3 k122,3 k  28 k557526  907416544072234
Feb 201723 k3,2 k3309671,1 k1,3 k122,3 k  28 k546520  907416544072234
Jan 201723 k3,2 k3279641,1 k1,3 k122,3 k  28 k543519  877416544072234
Dec 201623 k3,2 k3239641,1 k1,3 k122,3 k  27 k533518  877416544072234
Nov 201623 k3,1 k3229631,1 k1,3 k122,3 k  26 k525516  867416544072234
Oct 201623 k3,1 k3219621,1 k1,3 k122,2 k  26 k521514  867416544062234
Sep 201623 k3,1 k3209621,1 k1,3 k122,2 k  26 k509513  867416544062234
Aug 201623 k3,1 k3169611,1 k1,3 k122,2 k  25 k505513  857416544062234
Jul 201623 k3,1 k3159601,1 k1,3 k122,2 k  25 k502513  857416544052234
Jun 201623 k3,1 k3159601,1 k1,3 k122,2 k  25 k501510  857416544052234
May 201622 k3,1 k3119601,1 k1,3 k122,2 k  24 k491502  857416544052234
Apr 201622 k3,1 k3119601,1 k1,3 k122,2 k  24 k482502  857416544052234
Mar 201622 k3,0 k3119601,1 k1,3 k122,2 k  23 k467500  857416544052234
Feb 201622 k3,0 k3119591,0 k1,3 k122,2 k  22 k446495  857416544042234
Jan 201622 k3,0 k3109521,0 k1,3 k122,0 k  21 k437491  787416544042234
Dec 201522 k3,0 k3089471,0 k1,2 k121,9 k  18 k412471  757416444032234
Nov 201522 k3,0 k3089471,0 k1,2 k121,9 k  16 k411463  757416444032234
Oct 201522 k3,0 k3079471,0 k1,2 k121,9 k  16 k409455  757416444032234
Sep 201521 k3,0 k3069431,0 k1,2 k121,9 k  16 k396445  737416444012234
Aug 201521 k3,0 k3029381,0 k1,2 k121,8 k  15 k344429  697416344012234
Jul 201521 k2,9 k2989341,0 k1,2 k121,8 k  14 k285418  677416343992234
Jun 201521 k2,9 k2989341,0 k1,2 k121,7 k  13 k284411  677416343992234
May 201521 k2,9 k2989341,0 k1,2 k121,7 k  13 k283409  677416343992234
Apr 201521 k2,9 k2949321,0 k1,1 k121,7 k  13 k274401  657416343992234
Mar 201521 k2,9 k2929321,0 k1,1 k121,7 k  12 k270393 1197657416343992234
Feb 201520 k2,9 k2929281,0 k1,1 k121,6 k  12 k265390 2741627416243992234
Jan 201520 k2,9 k2919021,0 k1,1 k121,6 k  10 k237387 613397416043982234
Dec 201420 k2,9 k2888921,0 k1,1 k121,6 k  10 k227383 857307416043972234
Nov 201419 k2,8 k2888741,0 k1,1 k121,6 k  10,0 k210381 1538147415943962234
Oct 201419 k2,8 k2888741,0 k1,1 k121,6 k  9,5 k208373 891147415943962234
Sep 201418 k2,8 k2888681,0 k1,0 k121,6 k  9,1 k198371 922107415843952234
Aug 201418 k2,8 k2878681,0 k1,0 k121,6 k  8,8 k192369 723107415843952234
Jul 201418 k2,8 k2878681,0 k1,0 k121,6 k  8,6 k144366 476107415843952234
Jun 201418 k2,8 k2818621,0 k1,0 k121,5 k  8,5 k141358 70467415843932234
May 201418 k2,8 k2807521,0 k1,0 k121,5 k  8,4 k136357 45967415842832234
Apr 201418 k2,8 k2794931,0 k1,0 k121,5 k  8,3 k136354 10856741564262234
Mar 201418 k2,8 k2794931,0 k1,0 k121,5 k  8,1 k133352 19346741564262234
Feb 201417 k2,7 k2784901,0 k999121,5 k  7,8 k128347 50935741554252234
Jan 201416 k2,7 k2784891,0 k982121,4 k  6,9 k126322 61755741554252224
Dec 201316 k2,7 k2774871,0 k966121,4 k  4,9 k122316 26135741554232224
Nov 201316 k2,7 k2774751,0 k952121,4 k  4,0 k93306 11213741554152204
Oct 201315 k2,7 k2734731,0 k942121,4 k  3,5 k87305 4473741544142204
Sep 201315 k2,7 k2734731,0 k933121,3 k  3,5 k87292 6823741544142204
Aug 201315 k2,6 k2724731,0 k931121,3 k  3,2 k84288 11793741544142204
Jul 201315 k2,6 k2724711,0 k928121,3 k  2,9 k79274 3543741524142204
Jun 201315 k2,6 k2724711,0 k923121,3 k  2,8 k77266 4313741524142204
May 201315 k2,6 k2684681,0 k916121,3 k  2,8 k73261 6822741524122204
Apr 201314 k2,6 k2684671,0 k910121,3 k  2,8 k72257 20292741514122204
Mar 201314 k2,6 k2524551,0 k896121,3 k  2,7 k66235 1302274147462184
Feb 201313 k2,5 k2514431,0 k890121,3 k  2,6 k65215 2156273141462134
Jan 201312 k2,5 k2504411,0 k885121,2 k  2,6 k65182 993273139462134
Dec 201212 k2,5 k2484391,0 k882121,2 k  2,6 k65118 361273138462124
Nov 201211 k2,5 k2464391,0 k874121,2 k  2,5 k6587 151273138462124
Oct 201211 k2,5 k2464381,0 k870121,2 k  2,5 k6587 332273137462124
Sep 201211 k2,5 k2464371,0 k868121,2 k  2,4 k6187 166273136462124
Aug 201211 k2,5 k2434371,0 k862121,2 k  2,3 k6087 151273136462124
Jul 201211 k2,4 k2434371,0 k857121,2 k  2,2 k5986 300273136462124
Jun 201211 k2,4 k2434361,0 k854121,1 k  2,2 k5884 262273136452124
May 201211 k2,4 k2404351,0 k852121,1 k  2,2 k5683 753273136442124
Apr 201211 k2,4 k2404321,0 k839121,1 k  2,2 k5569 279273133442124
Mar 201211 k2,4 k2394321,0 k829121,1 k  2,1 k5568 1396273133442124
Feb 201210 k2,3 k2394321,0 k823121,0 k  2,0 k5167 434273133442124
Jan 201210 k2,3 k2384321,0 k815121,0 k  1,9 k4564 300273133442124
Dec 201110 k2,3 k2364311,0 k804121,0 k  1,9 k4463 174273132442124
Nov 201110 k2,3 k2364311,0 k796111,0 k  1,8 k4363 520273132442124
Oct 20119,9 k2,3 k2344311,0 k778111,0 k  1,8 k4263 390273132442124
Sep 20119,7 k2,3 k2314311,0 k776111,0 k  1,7 k3959 698273132442124
Aug 20119,6 k2,3 k2274311,0 k77211973  1,7 k3858 821273132442124
Jul 20119,1 k2,2 k2264291,0 k76911934  1,5 k3658 1582173131442124
Jun 20118,4 k2,2 k2264231,0 k72811922  1,4 k3554 801173125442124
May 20118,3 k2,2 k2264231,0 k72511913  1,2 k3452 316173125442124
Apr 20118,2 k2,2 k2224231,0 k70411904  1,2 k3350 810173125442124
Mar 20118,2 k2,1 k2224231,0 k70211895  7763249 347173125442124
Feb 20118,1 k2,1 k2214231,0 k69911889  7753249 208173125442124
Jan 20118,1 k2,1 k2194211,0 k69311885  7563149 325 73125432124
Dec 20108,1 k2,1 k2194211,0 k69111878  7193047 271 73125432124
Nov 20108,1 k2,1 k2174211,0 k68811873  6872847 196 73125432124
Oct 20108,1 k2,1 k2174211,0 k68211859  6812747 336 73125432124
Sep 20108,0 k2,1 k2124151,0 k65611850  6702647 885 73125432064
Aug 20107,8 k2,0 k2124151,0 k65311845  6632645 342 73125432064
Jul 20107,7 k2,0 k2104151,0 k64511823  6602645 464 73125432064
Jun 20107,6 k2,0 k2104151,0 k62911802  6132344 278 73125432064
May 20107,5 k2,0 k2094151,0 k61611794  6132344 296 73125432064
Apr 20107,5 k2,0 k2094141,0 k60811791  5742344 688 73124432064
Mar 20107,4 k1,9 k2034131,0 k59211786  5411844 231 73124432054
Feb 20107,4 k1,9 k2024131,0 k58511778  5201744 89 73124432054
Jan 20107,4 k1,9 k2024131,0 k58511773  5021344 343 73124432054
Dec 20097,3 k1,9 k19841399658411761  442744 1581 73124432054
Nov 20096,8 k1,9 k19841399356811756  279141 196 73124432054
Oct 20096,7 k1,9 k19741398456711752  264139 62 73124432054
Sep 20096,7 k1,9 k19641298456311752  260139 202 73124422054
Aug 20096,6 k1,9 k19541298255711752  259138 164 73124422054
Jul 20096,6 k1,8 k18941297954511744  255138 764 73124422054
Jun 20096,5 k1,8 k18941297951611730  205138 708 73124422054
May 20096,3 k1,8 k18741297549011679  182134 402 73124422054
Apr 20096,2 k1,8 k18441197445311665  179134 285 73124422044
Mar 20096,1 k1,8 k18440897445111644  77129 1169 73124422014
Feb 20095,6 k1,7 k17640897241510575  6129 1242 73124422014
Jan 20095,0 k1,7 k1724089643638511  6122 508 73124422014
Dec 20084,9 k1,7 k1704086863468506  6120 1135 73124422014
Nov 20084,4 k1,7 k1704086833458501  6120 681 73124422014
Oct 20084,2 k1,6 k1704086733298495    19 637 73124422014
Sep 20084,0 k1,6 k1674086733198483    19 363 73124422014
Aug 20083,9 k1,6 k1644086733138467    16 737 73124422014
Jul 20083,8 k1,6 k1644086733008368    16 755 73124422014
Jun 20083,4 k1,6 k1604086732817357    15 386 73124422014
May 20083,3 k1,5 k1604086732757347    14 275 73124422014
Apr 20083,2 k1,5 k1584086732737336    14 276 73124422014
Mar 20083,1 k1,5 k1584086732717313    14 331 73124422014
Feb 20083,1 k1,5 k1544076702627308    14 262 73124422004
Jan 20083,0 k1,5 k1544076702577302    14 316 73124422004
Dec 20072,9 k1,5 k1504076702527300    14 396 73124422004
Nov 20072,8 k1,5 k1484076702487296    12 318 73124422004
Oct 20072,8 k1,5 k1484076702397290    12 262 73124422004
Sep 20072,7 k1,4 k1474076702367289    12 92 73124422004
Aug 20072,7 k1,4 k1474076702337289    12 269 73124422004
Jul 20072,5 k1,4 k1454076702307285    12 162 73124422004
Jun 20072,4 k1,4 k1444076692297284    12 222 73124422004
May 20072,4 k1,4 k1444076692267282    12 296 73124422004
Apr 20072,3 k1,4 k1444076672247278    12 472 73124422004
Mar 20072,1 k1,4 k1434046672187275    12 661 73121422004
Feb 20072,0 k1,4 k1433996672167264    11 1500 7312042200 
Jan 20071,6 k1,4 k1433996672157232    9 1084 7312042200 
Dec 20061,4 k1,3 k1383996662117150    7 271 7312042200 
Nov 20061,3 k1,3 k1373986662077147    6 1150 7311942200 
Oct 20061,1 k1,3 k1373986662057145    6 51 7311942200 
Sep 20061,1 k1,3 k1363986662027144    6 74 7311942200 
Aug 20061,1 k1,3 k1353986662027144    6 104 7311942200 
Jul 20069931,3 k1353986662017144    6 75 7311942200 
Jun 20069621,3 k1353976662007143    6 52 7311842200 
May 20069591,2 k1343976661987142    6 59 7311842200 
Apr 20069551,2 k1293926661877135    6 41 7311842195 
Mar 20069421,2 k1293926661867134    6 46 7311842195 
Feb 20069371,2 k1293916661847130    5 128 7311742195 
Jan 20069211,2 k1283806661837126    5 172 7011742187 
Dec 20058871,1 k1243616641787123    5 80 7010542180 
Nov 20058651,1 k1203586631737122    5 41 7010442178 
Oct 20058591,1 k1203566631727120    5 93 7010242178 
Sep 20058531,1 k1203546611677117    5 232 7010142177 
Aug 20058161,0 k1163526551597115    5 250 7010042176 
Jul 20057889161073315501517107    5 171 698241175 
Jun 200574784695321291126684    5 100 68794 170 
May 200573176394237282110557    5 572 365  169 
Apr 20056846518318228281534    4 180 361  118 
Mar 20056405607714220868332    4 151 353  86 
Feb 2005631487704511139323    4 117 231  12 
Jan 200560944569438234322    4 136 230  11 
Dec 200451941868307933317    4 65  19  11 
Nov 200450936265293426213    3 188  19  10 
Oct 200450130855273417213    2 55  19  8 
Sep 2004494248509341224    2 69  1  8 
Aug 200447121345234612      95  1  1 
Jul 20044541754323441          1  1 
Jun 200442713640 3441               
May 200441111639 334                
Apr 20043849735 274                
Mar 20042828133 273                
Feb 20042476528 273                
Jan 20042164824 273                
Dec 2003103415 273                
Nov 20034185                   

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Nov 2003: 1 16 Main Page/English , 2 6 Main Page/Old , 3 3 Main Page/Français

Dec 2003: 1 11 Main Page/English , 2 11 Main Page/Old , 3 5 Strona główna/archiwum , 4 4 Main Page/Français , 5 4 Main Page/Magyar

Jan 2004: 1 5 Main Page/Old , 2 2 Main Page/English , 3 2 Le ingeniose hidalgo don Quixote de La Mancha , 4 1 Main Page/Français

Feb 2004: 1 8 Main Page/English , 2 6 Main Page/Old , 3 3 Main Page/Français , 4 3 Main Page/Interlingua

Mar 2004: 1 5 Main Page/English , 2 4 Main Page/Old , 3 3 Strona główna/archiwum , 4 2 Main Page/Français

Apr 2004: 1 8 Main Page/Old , 2 5 Main Page/Français , 3 3 Main Page/English , 4 3 Main Page/Tiếng Việt , 5 2 Main Page/Bahasa Indonesia , 6 2 Main Page/Suomi

May 2004: 1 7 Main Page/Old , 2 5 Main Page/English , 3 2 Main Page/Français , 4 2 Main Page/Tiếng Việt

Jun 2004: 1 4 Main Page/English , 2 4 Main Page/Old , 3 2 Internasjonalen , 4 2 Kansainvälinen , 5 1 Main Page/Français

Jul 2004: 1 9 Main Page/Old , 2 5 Main Page/Français , 3 2 Main Page/English , 4 2 Main Page/עברית

Aug 2004: 1 5 Main Page/Old , 2 3 Main Page/Français , 3 3 Main Page/English , 4 3 Main Page/Esperanto , 5 1 दोहावली

Sep 2004: 1 10 Main Page/Old , 2 7 Main Page/English , 3 2 Main Page/Français

Oct 2004: 1 8 Main Page/Old , 2 5 Main Page/English , 3 3 Main Page/Français , 4 2 Strona główna/archiwum

Nov 2004: 1 8 Main Page/Old , 2 4 Main Page/Français , 3 4 Main Page/English , 4 3 Main Page/Lëtzebuergesch , 5 2 Strona główna/archiwum

Dec 2004: 1 5 Main Page/Français , 2 4 Main Page/Old , 3 3 Main Page/English , 4 2 Bible

Jan 2005: 1 4 Main Page/English , 2 2 Main Page/Français , 3 1 Copa Santa

Feb 2005: 1 5 Main Page/Français , 2 5 Main Page/English , 3 2 Main Page/Asturianu , 4 2 Main Page/Old

Mar 2005: 1 10 Main Page/English , 2 5 Main Page/Français , 3 2 Main Page/ગુજરાતી/old , 4 2 Strona główna/archiwum

Apr 2005: 1 5 Main Page/English , 2 4 Main Page/Français , 3 3 Bible , 4 2 O Fat obas , 5 2 Main Page/Српски , 6 1 Kowal

May 2005: 1 11 Main Page/English , 2 2 Main Page/Français , 3 2 Lorelei , 4 2 Main Page/Türkçe , 5 2 Main Page/Old , 6 1 Copa Santa

Jun 2005: 1 10 Main Page/English , 2 3 Main Page/Français

Jul 2005: 1 16 Main Page/English , 2 7 Main Page/Français , 3 3 Main Page/Kernewek , 4 2 Main Page/Lëtzebuergesch , 5 2 اومارمیدڭ؟ , 6 2 Main Page/Magyar , 7 2 Main Page/Old

Aug 2005: 1 10 Main Page/English , 2 9 Main Page , 3 3 Main Page/Français , 4 3 Internacionála , 5 3 Main Page/Polski , 6 2 Internasjonalen , 7 2 Kansainvälinen , 8 2 Bible , 9 2 インターナショナル , 10 1 दोहावली

Sep 2005: 1 4 Main Page , 2 4 Main Page/English , 3 3 Main Page/संस्कृत , 4 2 विनयपत्रिका १-९ , 5 2 विनयपत्रिका १०-१९ , 6 2 विनयपत्रिका २०-२९

Oct 2005: 1 5 Main Page , 2 2 Main Page/Українська , 3 2 Main Page/Česky , 4 1 दोहावली

Nov 2005: 1 2 Main Page , 2 2 Main Page/Slovenčina , 3 2 Main Page/Türkçe , 4 2 Main Page/Bahasa Indonesia

Dec 2005: 1 5 Main Page , 2 1 हरिगीता अध्याय १

Jan 2006: 1 6 Main Page , 2 3 Main Page/संस्कृत , 3 2 Cello Suite 3 , 4 2 Cello Suite 4 , 5 2 Cello Suite 5 , 6 2 Cello Suite 6 , 7 1 Padrone mio te voglio arrecchire

Feb 2006: 1 6 Main Page , 2 3 Main Page/Kreyòl Ayisyen , 3 2 ᎣᎩᏙᏓ ᎦᎸᎳᏗ ᎮᎯ , 4 2 Main Page/Slovenčina , 5 2 Main Page/Українська , 6 2 Main Page/Nāhuatl , 7 2 Main Page/தமிழ் , 8 1 Internacionála

Mar 2006: 1 5 Main Page , 2 2 Main Page/ಕನ್ನಡ

Apr 2006: 1 2 Main Page , 2 2 The Lord's Prayer , 3 1 Vene lu viento

May 2006: 1 5 Main Page , 2 2 Main Page/Gaeilge , 3 2 Main Page/Magyar , 4 1 Vene lu viento

Jun 2006: 1 6 Main Page , 2 2 Guagliù nun cacate muollo , 3 2 È venuto lo papa santu , 4 2 Patilasan Jaka Susuru , 5 2 Main Page/Eesti , 6 1 Veditela veditela chi sponta

Jul 2006: 1 3 Main Page , 2 2 Main Page/हिन्दी

Aug 2006: 1 3 Main Page , 2 2 सत्य के प्रयोग अथवा आत्मकथा , 3 1 Serenata napulitana

Sep 2006: 1 3 Main Page , 2 2 Libro de Mormon - 1 Nephi - Capitulo 8 , 3 1 Serenata napulitana

Oct 2006: 1 3 Main Page , 2 2 Main Page/Plattdüütsch , 3 1 A lu suono della gran cascia

Nov 2006: 1 3 Main Page , 2 2 Main Page/Gaeilge , 3 1 Veditela veditela chi sponta

Dec 2006: 1 2 Padrone mio te voglio arrecchire , 2 2 Main Page/Ἀρχαία ἑλληνική

Jan 2007: 1 20 Wikisource , 2 5 Main Page , 3 3 Main Page/हिन्दी , 4 2 صفحۂ اول , 5 2 Séng-gĭng , 6 2 Main Page/Volapük , 7 2 Main Page/Plattdüütsch , 8 1 Vene lu viento

Feb 2007: 1 3 Main Page , 2 2 Main Page/English , 3 1 A lu suono della gran cascia

Mar 2007: 1 11 Wikisource , 2 5 Main Page , 3 2 नागपुर में पूर्णाहुति , 4 2 असहयोग का प्रवाह , 5 2 एक संवाद , 6 2 चरखा मिला! , 7 1 विनयपत्रिका १-९

Apr 2007: 1 4 Main Page , 2 2 Era de maggio , 3 2 Main Page/Қазақша , 4 2 Main Page/Volapük , 5 2 Main Page/Беларуская , 6 2 Main Page/हिन्दी , 7 2 Main Page/தமிழ் , 8 1 Vene lu viento

May 2007: 1 3 Main Page , 2 2 Guagliù nun cacate muollo , 3 2 विनयपत्रिका १२०-१२९ , 4 2 Vödem redaka, VpN 1940, Nüm: 1 , 5 2 हिंदी काव्य , 6 2 Krummacher , 7 2 Râ-pun vya (Tolstoi)

Jun 2007: 1 4 Main Page , 2 2 Guagliù nun cacate muollo , 3 2 Main Page/Հայերեն , 4 2 Main Page/ᏣᎳᎩ , 5 2 ᎪᏪᎭᎨᏛ/ᏣᏂ , 6 1 Vene lu viento

Jul 2007: 1 6 Main Page , 2 3 Main Page/Հայերեն , 3 2 Main Page/मराठी , 4 2 Main Page:Marathi , 5 1 Adiu paure Carnaval

Aug 2007: 1 3 Main Page , 2 3 Doctrina para los viejos chonos , 3 3 Main Page/বাংলা , 4 1 Main Page/Ϯⲁⲥⲡⲓ ̀ⲛⲣⲉⲙ̀ⲛⲬⲏⲙⲓ

Sep 2007: 1 1 Querimònia

Oct 2007: 1 6 Main Page/Volapük , 2 5 Main Page/संस्कृत , 3 5 Wikisource , 4 5 Main Page/Esperanto , 5 4 Main Page , 6 4 Main Page/Հայերեն , 7 2 A lu suono della gran cascia , 8 1 Vene lu viento

Nov 2007: 1 5 Main Page/Հայերեն , 2 5 Main Page/Volapük , 3 4 Main Page/Laraʼ , 4 4 Main Page/Gaeilge , 5 4 Wikisource , 6 4 Main Page/Esperanto , 7 3 Main Page/ᏣᎳᎩ , 8 3 Volapükagased pro Nedänapükans , 9 3 Volapükaklub valemik Nedänik: Doküms , 10 3 Diatek Nulik , 11 3 सत्य के प्रयोग अथवा आत्मकथा , 12 3 Main Page/Pāḷi , 13 3 Main Page/ภาษาไทย , 14 2 कवितावली , 15 2 Main Page , 16 2 Autor:Jaufre Rudel , 17 1 Padrone mio te voglio arrecchire

Dec 2007: 1 4 Surat Khalifah Ali , 2 3 Main Page , 3 2 Lou chalibari , 4 2 Me cal mouri , 5 2 Keyakinan Nicea (bahasa Melayu) , 6 2 Keyakinan Athanasius (bahasa Melayu) , 7 2 Keyakinan Pesuruh , 8 2 Asas-Asas Keyakinan Islam , 9 2 Doa Tuhan , 10 2 A Moussu de Sainte-Beuve , 11 2 Autor:Jacques Jasmin , 12 1 Querimònia

Jan 2008: 1 3 Main Page/Саха тыла , 2 3 Main Page , 3 2 Main Page:Ancient Egyptian/MissingHieroglyphs , 4 2 Yayayku , 5 2 Main Page/Español , 6 1 Main Page/Français

Feb 2008: 1 3 Main Page/Limburgs , 2 2 È venuto lo papa santu , 3 2 Main Page/Aragonés , 4 2 Scél mucci Mic Dáthó , 5 1 Vene lu viento

Mar 2008: 1 4 Main Page , 2 2 Buscia! , 3 2 Main Page/Ἀρχαία ἑλληνική , 4 2 Perjanjian Hudaibiyah , 5 2 Main Page/Aragonés , 6 2 Main Page/Vèneto , 7 1 Vene lu viento

Apr 2008: 1 3 Main Page/Aragonés , 2 3 Main Page , 3 2 Buscia! , 4 2 प्रायश्चित- अमृतलाल नागर , 5 2 नहान , 6 2 आत्माराम , 7 2 आत्म-संगीत , 8 2 आख़िरी मंज़िल , 9 2 आख़िरी तोहफ़ा , 10 1 Vene lu viento

May 2008: 1 3 Main Page , 2 3 Main Page/Vèneto , 3 2 Gemeener Borger=Eed der Stadt Bremen , 4 2 समस्त रचनाकार , 5 1 Guagliù nun cacate muollo

Jun 2008: 1 3 Main Page/Aragonés , 2 3 Main Page , 3 2 Deklarata e Bolonjës , 4 2 Fjalimi i Presidentit të Kosovës para Këshillit të Sigurimit të Kombeve të Bashkuara , 5 2 Carta Puebla de Tuexa , 6 2 अंधेर –नगरी , 7 2 Táin Bó Cúailnge , 8 2 Wikisource , 9 1 Querimònia:Conclusion

Jul 2008: 1 4 Main Page , 2 2 Lo guarracino , 3 2 Ϧⲉⲛ `ⲫⲣⲁⲛ `ⲙ`Ⲫⲓⲱⲧ , 4 2 Main Page/Ϯⲁⲥⲡⲓ ̀ⲛⲣⲉⲙ̀ⲛⲬⲏⲙⲓ , 5 2 Main Page:Coptic/Introduction to Coptic Wikisource , 6 2 Jv/Rama Kawula , 7 2 Jv/Sastra Jawa , 8 2 Jv/Sastra Jawa Modhèrn , 9 2 Jv/Sastra Jawa Anyar , 10 2 Jv/Sastra Jawa Kuna , 11 2 Çështja e Kanalit të Korfuzit , 12 2 Jv/Déklarasi HAM PBB

Aug 2008: 1 4 Main Page , 2 2 Querimònia , 3 2 Ϧⲉⲛ `ⲫⲣⲁⲛ `ⲙ`Ⲫⲓⲱⲧ , 4 2 Main Page:Coptic/Rules of writing , 5 2 Main Page:Coptic/Introduction to Coptic Wikisource , 6 2 インターナショナル , 7 2 Carta de particion de las buegas de los terminos de Biescas e Gaujn , 8 2 Main Page/Norrœnt , 9 2 Estatutu d'Autonomía del Principáu d'Asturies , 10 2 Constitución Española de 1978 , 11 2 Main Page/Aragonés , 12 2 Main Page/Laraʼ , 13 1 Querimònia:Conclusion

Sep 2008: 1 4 Main Page , 2 3 Main Page/Русский , 3 3 Main Page/Bahasa Melayu , 4 2 Serenata napulitana , 5 2 Jv/Al-Quran/Ali Imran , 6 2 Jv/Al-Quran , 7 2 Jv/Al-Quran/Al Baqarah , 8 2 Main Page/Italiano , 9 2 Main Page/Basa Jawa

Oct 2008: 1 3 靜夜 , 2 3 Úplná učebnice mezinárodní řeči dra. Esperanta , 3 3 Main Page , 4 2 Main Page/Ἀρχαία ἑλληνική , 5 2 Ⲟⲩ`ⲥϧⲁⲓ `ⲛⲧⲉ ⲁⲃⲃⲁ Ϣⲉⲛⲟⲩϯ ⲡⲓⲁⲣⲭⲏⲙⲁⲛⲇⲣⲏⲧⲏⲥ , 6 2 Jv/Alkitab/Jansz/Markoes , 7 2 Jv/Alkitab/Jansz/Éfesoes , 8 2 Jv/Alkitab/Jansz/Efesoes , 9 2 Jv/Alkitab/Jansz/Mattheoes , 10 2 Jv/Alkitab/Jansz , 11 2 Babad Tanah Jawi lan Tanah-Tanah ing Sakiwa-Tengenipoen , 12 2 Babad Tanah Jawi , 13 2 Jv/Babad Tanah Djawi lan Tanah-Tanah ing Sakiwa-Tengenipoen , 14 1 Querimònia

Nov 2008: 1 4 Main Page , 2 2 Jv/Al-Quran/Al Humazah , 3 2 Jv/Al-Quran/Al Fiil , 4 2 Jv/Al-Quran/Quraisy , 5 2 Jv/Al-Quran/Al Maa’uun , 6 2 Jv/Al-Quran/Al Kautsar , 7 2 Jv/Al-Quran/Al Falaq , 8 2 Jv/Serat Nitisruti , 9 2 Jv/Al-Quran/An Naas , 10 1 Querimònia:Introduccion

Dec 2008: 1 8 Main Page , 2 3 Main Page/Hornjoserbšćina , 3 3 Main Page/Afrikaans , 4 2 Ruiters van die Nag , 5 2 Portal:Plattdüütsch in de Politik , 6 2 Syrotka , 7 2 Heliand , 8 2 Main Page/संस्कृत , 9 1 कवितावली 1

Jan 2009: 1 3 Buscia! , 2 3 Main Page:Coptic/Priorities , 3 3 Main Page/Ϯⲁⲥⲡⲓ ̀ⲛⲣⲉⲙ̀ⲛⲬⲏⲙⲓ , 4 3 Main Page , 5 3 Wikisource , 6 2 Ⲉⲩⲁⲅⲅⲉⲗⲓⲟⲛ ⲕⲁⲧⲁ Ⲙⲁⲧⲑⲉⲟⲛ , 7 2 ქართვლის დედა

Feb 2009: 1 3 Wiben Peter , 2 2 Die wonder van Afrikaans , 3 2 Letërsia Moderne , 4 2 Letërsia e Pamvarsisë , 5 2 Letërsia e Rilindjes , 6 2 Letërsia e Vjetër , 7 2 Letërsia Shqiptare , 8 1 Fragment i zgjedhur

Mar 2009: 1 5 Main Page , 2 2 Main Page/Ἀρχαία ἑλληνική , 3 2 Main Page:Coptic/Priorities , 4 2 Prayer of The Apostle Paul (NHC I,1) , 5 2 Allgemeines plattdeutsches Volksbuch/Sprüchwührde (s. auch S. 23, 75, 81, 103, 135, 184) , 6 2 Ut Sloß un Kathen , 7 2 Allgemeines plattdeutsches Volksbuch/Dei Kinner von Hameln , 8 2 Allgemeines plattdeutsches Volksbuch/As Schwinegel un Matten Has inne Werr lepen. Von Klaus Groth , 9 2 Jv/Alkitab/Exodus , 10 2 Kein Hüsung/De Fluch , 11 2 Läuschen und Rimels/De Korten , 12 2 Läuschen und Rimels/Dat wir bald wat worr'n , 13 2 Hamborger Janmooten/Krischon Honolulu , 14 2 Ut de Franzosentid , 15 2 Ut mine Stromtid/Kapittel 11 , 16 1 Fragment i zgjedhur

Apr 2009: 1 2 Acàthistos , 2 2 Iegātnis , 3 2 Bagātie radi , 4 1 Adiu paure Carnaval

May 2009: 1 2 'O pueta , 2 2 დონის ღვთისმშობლის ხატის ლოცვა , 3 2 Internacionála , 4 2 ავტორი:გალაკტიონ ტაბიძე , 5 2 Main Page/ქართული , 6 1 Selections from the Sahih of al-Buhari (1906).djvu/13

Jun 2009: 1 4 ავტორი:გალაკტიონ ტაბიძე , 2 3 Main Page/Ϯⲁⲥⲡⲓ ̀ⲛⲣⲉⲙ̀ⲛⲬⲏⲙⲓ , 3 2 Ⲉⲃⲟⲗϧⲉⲛ `ⲛⲧⲉ Ⲡⲁⲡⲁ Ⲕⲩⲣⲓⲗⲗⲟⲥ ⲡⲓⲙⲁϩ ⲟⲩⲁⲓ , 4 2 Ancient Greek/Ἄλλα ἐγχειρήματα , 5 2 Ϧⲉⲛ `ⲫⲣⲁⲛ `ⲙ`Ⲫⲓⲱⲧ , 6 2 Main Page/Ἀρχαία ἑλληνική , 7 2 Ⲉⲩⲁⲅⲅⲉⲗⲓⲟⲛ ⲕⲁⲧⲁ Ⲙⲁⲧⲑⲉⲟⲛ , 8 1 विनयपत्रिका २०-२९

Jul 2009: 1 2 À la manière de/2ème série , 2 2 Mo sgeal fein.djvu/30 , 3 2 ექიმის მანკურნებელი სიტყვა , 4 2 ავტორი:ილია ჭავჭავაძე , 5 2 Wikisource

Aug 2009: 1 3 Schriever:Matthias Andreas Alardus von Canthier , 2 3 Gedanken van de Eegenleeve , 3 1 Selections from the Sahih of al-Buhari (1906).djvu/125

Sep 2009: 1 2 व्यवहारभानु , 2 2 आर्योद्देश्यरत्नमाला , 3 1 Selections from the Sahih of al-Buhari (1906).djvu/12

Oct 2009: 1 3 Wikisource , 2 2 Main Page/Беларуская , 3 1 Seadna.djvu/190

Nov 2009: 1 3 Какшан сер умбалне ломбо , 2 3 Main Page/עברית , 3 2 Цолга шӹдӹр , 4 2 Салымсола покшалнет , 5 2 Луатшӹм и , 6 2 Келесӹ, келесӹ

Dec 2009: 1 3 Main Page/Чăваш , 2 3 Main Page:Чăваш , 3 2 ابتدائے عسق ہے روتا ہے کیا , 4 2 ავტორი:ვაჟა-ფშაველა , 5 2 მივაშუროთ! , 6 2 თოვლი (გალაკტიონ ტაბიძე) , 7 2 თიბათვე გავიდა , 8 2 ვისმენ დანატრულ ხმას , 9 2 ვიგონებ რა იმ მიქელ-ანჯელოს... , 10 2 ვერხვები , 11 2 ეფემერა , 12 2 Phaistos Disc , 13 2 ედგარი მესამედ , 14 2 დროშები ჩქარა! , 15 2 დრო , 16 2 დგება შემოდგომა , 17 1 Querimònia:Article X

Jan 2010: 1 3 Main Page/Euskara , 2 2 Malay-English vocabulary.djvu/5 , 3 2 Diwan des Grossen Lyrischen Dichters Hafis 1858 Vol.1.djvu/20 , 4 2 ავტორი:გაზეთი ივერია , 5 2 ივერია (1894, N42-43) , 6 2 Anchaman Komunis kapada Persekutuan Tanah Melayu.djvu/1 , 7 2 Matio 1 , 8 2 Vocabulary of the English and Malay languages.djvu/7 , 9 2 The Lord's Prayer , 10 1 Шартял Кожым сӹлнӹктӹмӹ

Feb 2010: 1 3 Main Page/Беларуская , 2 2 Abbes ja Låkkam-girje.djvu/1 , 3 2 Las espigos de la lengo moundino (1860).djvu/5 , 4 1 Querimònia:Article XVI

Mar 2010: 1 3 清朝全史 , 2 2 Liber Regum , 3 2 प्रेमचंद , 4 2 Bible, Gothic, Ulfila , 5 1 Padrone mio te voglio arrecchire

Apr 2010: 1 3 Wikisource , 2 2 Odluka br. 87 o pretvaranju ZAVNO-a Crne Gore i Boke u Crnogorsku antifašističku skupštinu narodnog oslobođenja , 3 2 Main Page/Crnogorski , 4 2 Һади Такташ , 5 2 George Washington , 6 2 Pangur Bán , 7 1 रामचरितमानस:बालकाण्ड 5

May 2010: 1 2 ვიკიწყარო:ფორუმი , 2 2 Wikisource , 3 1 रामचरितमानस

Jun 2010: 1 5 Main Page/Brezhoneg , 2 2 Al Julio Baghy , 3 2 Zur Elektrodynamik bewegter Systeme I , 4 2 Main Page/ಕನ್ನಡ , 5 1 Чöскыд öмидз

Jul 2010: 1 3 Main Page/Brezhoneg , 2 3 Libro de Mormon - Secunde Libro de Nephi , 3 2 Bän bir Körogluydum , 4 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu , 5 2 කෝපි කඩේ , 6 2 कृष्ण भजन संग्रह , 7 1 Ma che me n'importe a me che je so' bella

Aug 2010: 1 3 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu , 2 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/68 , 3 2 Słownik geograficzny Królestwa Polskiego/Objaśnienie skróceń , 4 2 Słownik geograficzny Królestwa Polskiego , 5 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/67 , 6 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/10 , 7 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/9 , 8 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/7 , 9 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/6 , 10 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/5 , 11 2 हनुमान आरती , 12 2 Wikiborn:Press , 13 1 À la manière de…

Sep 2010: 1 6 Wikisource , 2 3 Mali , 3 3 Main Page/Кырык мары , 4 3 Yollar , 5 2 Çarşamba günü , 6 2 Çoçuk hem Kaplan , 7 2 Şiir okumaa , 8 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/338

Oct 2010: 1 4 Main Page/Brezhoneg , 2 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/25 , 3 2 Чöскыд öмидз , 4 2 Пелысь , 5 2 Няньöн-солöн , 6 2 Муслун , 7 2 Какшан сер умбалне ломбо , 8 2 Ире вӹдет йога , 9 1 Selections from the Sahih of al-Buhari (1906).djvu

Nov 2010: 1 3 Main Page/Occitan , 2 2 Vocabulary of the English and Malay languages.djvu/11 , 3 2 Akt erekcyjny pomnika króla Jana III Sobieskiego , 4 2 बेताल पच्चीसी 18 , 5 2 Main Page/Беларуская

Dec 2010: 1 3 Lorelei , 2 2 Sami Frashëri Shqipria Qka qen? Qesht? e Qdote behet? , 3 2 ვეფხისტყაოსანი/ამბავი ავთანდილისა, ასმათს რომ ეუბნების ქვაბშიგან , 4 2 ვეფხისტყაოსანი/ავთანდილისაგან მის ყმისა ძებნად წასლვა , 5 2 ვეფხისტყაოსანი/წიგნი ავთანდილისა თავის ყმათა თანა , 6 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/348

Jan 2011: 1 6 Main Page/Саха тыла , 2 4 Wikisource , 3 2 Main Page/ភាសាខ្មែរ , 4 2 Vatanımız , 5 2 Ne yaper saalık insannar , 6 2 რელიგია , 7 2 მარგალურ–ქორთული ლექსიკონი (მალხაზ გრიგოლია) , 8 1 Selections from the Sahih of al-Buhari (1906).djvu/13

Feb 2011: 1 4 Main Page/Саха тыла , 2 3 Main Page/हिन्दी , 3 2 Origo Mundi , 4 1 Luna nova

Mar 2011: 1 4 Main Page/Саха тыла , 2 3 Зыв зимыӀэм витӀ иӀэт жи , 3 2 रामचरितमानस , 4 2 თორმეტი ანათემა , 5 2 Си бзэ – си псэ, си дуней , 6 2 БЗУУБЗЭ , 7 2 Си Адыгей , 8 2 Адыиф , 9 2 Биз тынышлык йолы ман оьрленермиз , 10 2 Main Page/Адыгэбзэ , 11 2 រឿង​ ហោរ​និង​តា​ចាស់​ដូន​ចាស់ , 12 2 Main Page/Vepsän kel' , 13 1 Marzo (Di Giacomo)

Apr 2011: 1 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/77 , 2 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/76 , 3 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/75 , 4 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/74 , 5 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/73 , 6 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/72 , 7 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/71 , 8 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/70 , 9 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/69 , 10 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/68 , 11 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/67 , 12 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/66 , 13 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/65 , 14 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/64 , 15 2 آغوستوس بوجگیله ‌قارینجه , 16 2 توركيه جمهوريتى ايله چه قوسلوواق جمهوريتى آراسنده آنقره ده منعقد ۱۱ تشرين اول ۱۳٤۰ (۱٩۲٤) تاريخلى مهادنت معاهده نامه سى , 17 2 An t-oileanach.djvu/45 , 18 2 An t-oileanach.djvu/44 , 19 2 An t-oileanach.djvu/31 , 20 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/136

May 2011: 1 2 'O pueta , 2 2 اصسز یورد , 3 2 شخص / Şahıs:محمد عاكف , 4 2 توركيه - ايران امنيت و مخادنت معاهده سى , 5 2 خاویار , 6 2 Main Page/عثمانلوجه , 7 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/85

Jun 2011: 1 3 دعا , 2 3 Main Page/عثمانلوجه , 3 3 Mo sgeal fein.djvu/30 , 4 2 Słownik geograficzny Królestwa Polskiego/Tom I/Babańce , 5 2 Słownik geograficzny Królestwa Polskiego/Tom I/Babany , 6 2 Słownik geograficzny Królestwa Polskiego/Tom I/Babanka (rzeka) , 7 2 Słownik geograficzny Królestwa Polskiego/Tom I/Babanka (duża wieś) , 8 2 Słownik geograficzny Królestwa Polskiego/Tom I/Babanka (wieś) , 9 2 Słownik geograficzny Królestwa Polskiego/Tom I/Babalice , 10 2 Słownik geograficzny Królestwa Polskiego/Tom I/Babaje , 11 2 Słownik geograficzny Królestwa Polskiego/Tom I/Baba Żaszkowska ruda , 12 2 Słownik geograficzny Królestwa Polskiego/Tom I/Baba Wielka , 13 2 Słownik geograficzny Królestwa Polskiego/Tom I/Baba Mała , 14 1 श्रीहरिगीता

Jul 2011: 1 3 Main Page/Беларуская , 2 2 Bîranîna 23 saliya tomarkirina destana Xwakurk , 3 2 Pyt Kramer , 4 2 Gretchen Grosser's Fertälstere in dän GA, 2000 , 5 2 Gretchen Grosser's Fertälstere in dän GA, 2001 , 6 2 Gretchen Grosser's Fertälstere in dän GA, 2002 , 7 2 Gretchen Grosser's Fertälstere in dän GA, 2003 , 8 2 Gretchen Grosser's Fertälstere in dän GA, 2004 , 9 2 Gretchen Grosser's Fertälstere in dän GA, 2005 , 10 2 Gretchen Grosser's Fertälstere in dän GA, 2006 , 11 2 Gretchen Grosser's Fertälstere in dän GA, 2007 , 12 2 Gretchen Grosser's Fertälstere in dän GA, 2011 , 13 2 Gretchen Grosser's Fertälstere in dän GA, 2010 , 14 2 Gretchen Grosser's Fertälstere in dän GA , 15 2 Gretchen Grosser's Fertälstere in dän GA, 2008 , 16 2 Gretchen Grosser's Fertälstere in dän GA, 2009 , 17 2 Johann Friedrich Minssen , 18 2 كلحانه خط شریفی , 19 2 Айның нурлары арасында , 20 2 Авызлары, борынныры җимерелгән сүзләрне яклап , 21 2 «Пи-би-би-бип...» , 22 2 «Инде бу кырларда...» , 23 2 «Бүген радио безгә хәбәр итте...» , 24 2 «Ояты юк сатлык юлбасарның...» , 25 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/89

Aug 2011: 1 3 Gedichte Hesse 1919.djvu/8 , 2 2 Gedichte Hesse 1919.djvu/176 , 3 2 Gedichte Hesse 1919.djvu/138 , 4 2 Gedichte Hesse 1919.djvu/108 , 5 2 Gedichte Hesse 1919.djvu/80 , 6 2 Gedichte Hesse 1919.djvu/44 , 7 1 Reboux-Müller - À la manière de, sér1-2, 1921.djvu

Sep 2011: 1 2 Cucina teorico-pratica , 2 2 Cucina teorico-pratica.djvu , 3 2 Bybel/Genesis , 4 2 Main Page/Nordfriisk , 5 2 Hail Mary , 6 2 The Lord's Prayer , 7 2 Destpêk , 8 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/103

Oct 2011: 1 3 Otche nash , 2 2 Yokwe eok Maria , 3 1 विनयपत्रिका १-९

Nov 2011: 1 2 魏玛宪法 , 2 2 Universal Declaration of Human Rights , 3 2 Lorelei , 4 2 Main Page/Frysk , 5 1 A lu suono della gran cascia

Dec 2011: 1 3 Main Page/Occitan , 2 3 Main Page/Беларуская , 3 2 Dichjarazioni univirsali di i diritti di l'omu , 4 2 Bybel/Genesis , 5 2 Main Page/मराठी , 6 1 Na trí daill agus an Chevalier i mBaile-átha-clíath

Jan 2012: 1 4 Main Page/मराठी , 2 3 Main Page/Беларуская , 3 2 Tantara malagasy , 4 2 Le Jerusalem Liberate , 5 2 Le corvo e le vulpe , 6 2 Cucina teorico-pratica.djvu/368 , 7 2 Słownik geograficzny Królestwa Polskiego/Tom I/Angerburg , 8 2 Słownik geograficzny Królestwa Polskiego/Tom I/Allersberg , 9 2 Mo Sgéal Féin/18 , 10 2 An t-oileanach.djvu/190 , 11 2 Słownik geograficzny Królestwa Polskiego/Tom I/Bobiatyn , 12 2 Кырык мары пӹсӹ вӓтӹ , 13 2 Eridi canım , 14 2 Darsımak , 15 1 Resüstaunza

Feb 2012: 1 7 Main Page/ગુજરાતી/old , 2 4 Wikisource , 3 2 Revue des langues romanes XL (1896).djvu/42 , 4 2 Charte soussilvane de 1609 , 5 2 Il chapè a trais pizs/03 , 6 2 Il chapè a trais pizs.djvu/15 , 7 2 Il chapè a trais pizs.djvu/14 , 8 2 Il chapè a trais pizs.djvu/13 , 9 2 Il chapè a trais pizs/02 , 10 2 Il chapè a trais pizs , 11 2 Il chapè a trais pizs/01 , 12 1 Querimònia:Article XX

Mar 2012: 1 5 Main Page/ગુજરાતી/old , 2 3 Main Page/Bahasa Melayu , 3 2 Fluors alpinas.djvu/85 , 4 2 Fluors alpinas.djvu/73 , 5 2 Fluors alpinas.djvu/72 , 6 2 Sulets sül muond , 7 2 Il chaunt della chüna , 8 2 La gilgia , 9 2 Suicidi , 10 2 Fluors alpinas.djvu/178 , 11 2 Fluors alpinas.djvu/159 , 12 2 Fluors alpinas.djvu/199 , 13 2 Fluors alpinas.djvu/60 , 14 2 Fluors alpinas.djvu/45 , 15 2 Fluors alpinas.djvu/41 , 16 2 Fluors alpinas.djvu/40 , 17 2 Fluors alpinas.djvu/39 , 18 2 Fluors alpinas.djvu/38 , 19 2 Fluors alpinas.djvu/37 , 20 1 Veditela veditela chi sponta

Apr 2012: 1 3 हनुमानचालीसा , 2 1 Fluors alpinas.djvu/124

May 2012: 1 2 Әсәйҙәргә. Айгөл Хәсәнова , 2 2 Аждаһаның башы ниңә ун ике? Арыҫлан Сырлыбаев , 3 2 Оҙонуйҙа еләк бешкән. Гүзәл Ситдиҡова , 4 2 Ҡиәмәтлек ейән. Гүзәл Ситдиҡова , 5 2 Өс таған , 6 2 Уй ғына... Гүзәл Ситдиҡова , 7 2 Яҡында ғына кеүек әсәйем. Гүзәл Ситдиҡова , 8 2 Ҡомға яҙылған сер. Гүзәл Ситдиҡова. , 9 2 Ғәмәл дәфтәре. Гүзәл Ситдиҡова. , 10 2 Усағым. Гүзәл Ситдиҡова. , 11 2 Басһыҙ гармун. Гүзәл Ситдиҡова. , 12 2 Алҡалы төн. Гүзәл Ситдиҡова. , 13 2 Аэропорт. Гүзәл Ситдиҡова. , 14 2 Ауылым кистәре. Гүзәл Ситдиҡова. , 15 2 Һигеҙенсе шинель. Гүзәл Ситдиҡова. , 16 2 Башҡорт иле. Гүзәл Ситдиҡова. , 17 2 Һауа торошо. Гүзәл Ситдиҡова. , 18 2 Ял иттерәм әле бәхет ҡошон. Гүзәл Ситдиҡова. , 19 2 Төш. Гүзәл Ситдиҡова. , 20 2 Күсәгилеш. Гүзәл Ситдиҡова. , 21 2 Ҡанундар. Гүзәл Ситдиҡова. , 22 2 Билдәһеҙ. Гүзәл Ситдиҡова. , 23 2 Аҡ күлдәк. Гүзәл Ситдиҡова. , 24 2 Бишек йыры. Гүзәл Ситдиҡова , 25 2 Өмөт. Ситдиҡова Гүзәл.

Jun 2012: 1 4 მესმის, მესმის სანატრელი , 2 3 Текетек Бәшмәгестан илендә. Гүзәл Ситдиҡова , 3 2 Nederduitsch-Maleisch en Soendasch 1841.djvu , 4 2 Рус түгелмен, ләкин россиян мин. Мостай Кәрим , 5 2 Йәйге ямғыр , 6 2 Балаларға ҡыуаныс бүләк ит (бәйге) , 7 2 Słownik geograficzny Królestwa Polskiego/Tom I/Astrawas , 8 2 Seadna.djvu/311 , 9 1 Kitab Pakih Soenda.pdf/14

Jul 2012: 1 3 100 exemplo de Interlingua , 2 3 Wikisource , 3 2 Costituziun per il Cantun Grischun (1854).pdf , 4 2 ცხოვრება გიორგი მეცამეტისა (პლატონ იოსელიანი) , 5 2 ავტორი:ანა კალანდაძე , 6 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/117

Aug 2012: 1 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/33 , 2 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/06 , 3 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/03 , 4 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/02 , 5 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/01 , 6 3 Nowy Zakoń (1896)/Swjate evangelium Jězusa Khrystusa po Mateju , 7 2 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/32

Sep 2012: 1 2 與宮崎寅藏平山周的談話 , 2 2 Main Page/Ненэцяʼ , 3 2 विकल्प , 4 2 सरफरोशी की तमन्ना , 5 2 तुलसी-स्तवन , 6 1 Tain Bo Cuailnge.djvu/30

Oct 2012: 1 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/16 , 2 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/14 , 3 3 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/13 , 4 3 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/6 , 5 2 Dy wymmysuaschy Gmoansproch , 6 2 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/26 , 7 2 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/25 , 8 2 Ludwik Młynek - Narzecze wilamowickie (Wilhelmsauer Dialekt. Dy wymmysuaschy Gmoansproch).djvu/24 , 9 1 2010-215-alb.pdf

Nov 2012: 1 2 Tantara ny Andriana eto Madagasikara , 2 2 Thesaurus Palaeohibernicus 2.djvu , 3 2 Tain Bo Cuailnge.djvu , 4 2 Destpêk , 5 1 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/5

Dec 2012: 1 3 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/3 , 2 2 YNZER GYZANTER ABP JÓZEF BILCZEWSKI , 3 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/4 , 4 2 Main Page/მარგალური , 5 1 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/72

Jan 2013: 1 2 შენგულ სი! , 2 2 სონეტი 66. , 3 2 სონეტი 7 , 4 2 მე შენი ტრფობით ვერ გავძეხ , 5 2 ჭიჭა ხარჩილა , 6 2 *თოჲ, თოჲ, ეია , 7 2 *აცა, ბაცა , 8 2 *ცირა, ჸანჭი მიგაბარი , 9 2 თოლშა ილნალეფიში შელორცა , 10 2 გერია დო უჩა ხენწიფეშ არიკი , 11 2 ადამურიშ არიკი , 12 2 *კონჷ თანჷ, კონჷ თანჷ , 13 2 *გურ მიწყუნეთ გური ჯიმა , 14 2 ცურუ. , 15 2 ყებური , 16 2 მაფატიას უჩქუ ხვალე , 17 2 სამარგალო, მარგალი , 18 2 ჭვახე ღვინი , 19 2 კოჩანა. , 20 2 მუთუნ ვარე თე ქიანა , 21 2 ქომწი მუთუნი , 22 2 კოჩქ მუჭო რე გეეშმაკჷნი , 23 2 ცოდაში ჭვილი თე ქიანა , 24 2 ინგირი. , 25 2 გაზარხული რე კურცხუ ირფელი

Feb 2013: 1 2 კოლხურ ხვითო , 2 2 კოსტანტინე პატონი , 3 2 ოგურე , 4 2 ონწე , 5 2 დავითიშ ნაბირა - ზუბოვკა (დავითიანი) , 6 2 Tain Bo Cuailnge.djvu/75 , 7 2 დღას ვეგნაჩირთა თე ქიანას სიფრთხილეშ კირდეს , 8 2 გომორძგუა, სააფხაზო სქანი!(გიორგი შენგელია) , 9 2 სამარგალო (როზმერ გოგენია) , 10 2 ცაშა კიბე ვემიდგინე , 11 2 კოჩიშ გური ეფერ ორე , 12 2 ჩხანა იელი, იელი , 13 2 ჯაშ არკვანიშ დიშნანჯირა , 14 2 სამარგალო - გურიშ კილა , 15 2 რინა მუ რე - წვალება რე, მის არტინე ღურაშა , 16 2 ბარამი ჸუდეს მულარდ დო, ღვინც კულათ შუნდუნი , 17 2 მუდგა გურქუ მოირთასჷნი, შხვას ვაწყინებაფუა , 18 2 მუჭოთი წყარი მოძინელი, მუჭოთ ქარი-ბორია , 19 2 თეში მითინც ვეშიალებე ოჯახიში ეჯუმაფა , 20 2 შუმა ვეშილებენია შაბანიში თუთასია , 21 2 მეჩეთიშა შუმილო ახალეფიში მინულა , 22 2 გურულეფი დო იმერელეფი , 23 2 ქორთუეფიშ ჯვეშშეჯვეში ფარანიშ კულტურაშ დოგურაფა , 24 2 მიხეილ ჯავახიშვილი , 25 2 ოქორთუეშ ჭყანიერობა

Mar 2013: 1 3 „Wymysöjer śtytła” – miasteczko Wilamowice oraz jego osobliwości zawarte w zbiorze piosenek wilamowskich Józefa Gary strona 3.jpg , 2 2 „Wymysöjer śtytła” – miasteczko Wilamowice oraz jego osobliwości zawarte w zbiorze piosenek wilamowskich Józefa Gary strona 5.jpg , 3 2 ტვინშე მუკნატყვაცა , 4 2 ტაროზ მატაროზაია , 5 2 Бөйрәкәй.Таңсулпан Ғарипова , 6 2 Ba/Яҙмышым минең - Башҡортостаным , 7 2 ფერო სისმარეფი , 8 2 თუთაშ სიზმარეფს გათანუნა ჩე პოპორეფი , 9 2 თოუთი , 10 2 ზესქვი , 11 2 მოსკოვს ართი ფაცხა ბძირი , 12 2 Ер өҫтөнән...Тамара Искәндәриә , 13 2 Бөтәһе лә үтә...Тамара Искәндәриә , 14 2 Моң. Тамара Искәндәриә , 15 2 გემიძინი, მახუტელა , 16 2 სესია (ალიოშა კვარაცხელია) , 17 2 ნარაგად რე , 18 2 სი სო რგორა მა თე დროს , 19 2 მუჟამს იხი შერენსჷ დო , 20 2 Ҡөрьән , 21 2 რობაიეფი (გინმათანგალი ზაალ ჯალაღონია) , 22 2 1993 წანაშ 27 ეკენია , 23 2 ჭარა , 24 2 დიდას , 25 2 უჩა გვალა ჩეთ გეგნუთუ

Apr 2013: 1 3 Ba/Бәлеш , 2 3 خلوقك بايرامى , 3 2 Алтын үҫкән тупраҡ(инсценировка). Факиһа Туғыҙбаева , 4 2 Тыуған көн(инсценировка). Факиһа Туғыҙбаева , 5 2 Хәйерле иртә(инсценировка). Факиһа Туғыҙбаева , 6 2 Ғаға энә менән ҡойо ҡаҙый(инсценировка). Факиһа Туғыҙбаева , 7 2 Тутыйғоштоң серле буяуҙары(әкиәт). Факиһа Туғыҙбаева , 8 2 Ba/Балыҡсы һәм алтын балдаҡ тураһында әкиәт , 9 2 Ba/Ай йүгерә , 10 2 Ba/Өс Джек , 11 2 Ba/Төймә , 12 2 Ba/Эшем эйәһе , 13 2 Ba/Батыр уйлана... , 14 2 Ba/Ми-не-ке! , 15 2 Ba/Тәмле һүҙҙәр , 16 2 Ba/Ҡуян менән Йомран , 17 2 Ba/Ысын дуҫлыҡ , 18 2 Ba/Сәтләүек , 19 2 Ba/1 сентябрь , 20 2 Ba/Ҡурсаҡ кешегә әйләнде , 21 2 Ba/Искәндәрҙе кем уятты? , 22 2 Сәскәле кишер. Гүзәл Ситдиҡова , 23 2 Тыңлауһыҙ ҡаталар. Гүзәл Ситдиҡова , 24 2 Иҫәр шар. Гүзәл Ситдиҡова , 25 2 Яңы дуҫ. Гүзәл Ситдиҡова

May 2013: 1 2 ნირზი , 2 2 ციშპის მიკოდგ ჩქიმი ოდა... , 3 2 Main Page/Олык марий , 4 2 საოსუროშ გორუა , 5 2 კუში სქუა კუ იჸი , 6 2 გურიშ ენოჯინა , 7 2 Атайлылыҡ. Гүзәл Ситдиҡова , 8 2 Совет ҡатыны мин. Гүзәл Ситдиҡова , 9 2 Сәждә. Гүзәл Ситдиҡова , 10 2 Нарспи. Силпи ялĕнче , 11 1 Querimònia:Conclusion

Jun 2013: 1 2 მაღურუ ოლორი , 2 2 ოფუჩერი ჩქიმი დიხა! , 3 2 გენია , 4 1 გივის

Jul 2013: 1 2 Histoire des Alpes - Storia delle Alpi - Geschichte der Alpen (1996)/02 , 2 2 Ñi wirintüku mongen Presidente de la República – Sebastián Piñera Echenique , 3 1 Histoire des Alpes - Storia delle Alpi - Geschichte der Alpen/02

Aug 2013: 1 2 Canzone e Ariette nove , 2 2 Labi 1998.djvu/25 , 3 2 Labi 1998.djvu/24 , 4 2 Labi 1998.djvu/23 , 5 2 Labi 1998.djvu/22 , 6 2 Labi 1998.djvu/21 , 7 2 Labi 1998.djvu/20 , 8 2 Labi 1998.djvu/19 , 9 2 Labi 1998.djvu/17 , 10 2 Labi 1998.djvu/16 , 11 2 Labi 1998.djvu/15 , 12 2 Labi 1998.djvu/14 , 13 2 Labi 1998.djvu/13 , 14 2 Labi 1998.djvu/12 , 15 2 Labi 1998.djvu/11 , 16 2 Labi 1998.djvu/10 , 17 2 Labi 1998.djvu/9 , 18 2 Labi 1998.djvu/8 , 19 1 Querimònia

Sep 2013: 1 2 Nûh , 2 2 Labi 1998.djvu/44 , 3 1 Selections from the Sahih of al-Buhari (1906).djvu/32

Oct 2013: 1 2 ਕਮਿਊਨਿਸਟ ਪਾਰਟੀ ਦਾ ਮੈਨੀਫੈਸਟੋ , 2 2 ਛੱਬੀ ਆਦਮੀ ਅਤੇ ਇੱਕ ਕੁੜੀ , 3 1 Marzo (Di Giacomo)

Nov 2013: 1 2 Canzone e Ariette nove , 2 2 Konkani Viswakosh Vol3.pdf/13 , 3 2 Tua feliceso esas grava afero , 4 2 Hethadenee waunauyaunee vadan Luke vanenana , 5 2 In Arapahoe: Matthew 9, 1-8 , 6 2 ვაპუნს დო ვაფშქირენსი , 7 2 სქან ჸოროფაქ , 8 2 კოლექტივქი დიფაჩუ დო , 9 2 ირკოჩი ისოფუ , 10 2 ცხენით გილექანჩუდესი , 11 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/31

Dec 2013: 1 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/37 , 2 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/36 , 3 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/35 , 4 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/34 , 5 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/33 , 6 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/32 , 7 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/31 , 8 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/30 , 9 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/29 , 10 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/28 , 11 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/27 , 12 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/26 , 13 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/25 , 14 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/24 , 15 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/23 , 16 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/22 , 17 2 NA1-1994 11-Immigration.pdf/9 , 18 2 NA1-1994 11-Immigration.pdf/8 , 19 2 NA1-1994 11-Immigration.pdf/7 , 20 2 NA1-1994 11-Immigration.pdf/6 , 21 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/21 , 22 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/20 , 23 2 Divina Commedia (Napulitano)/2 , 24 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/19 , 25 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/18

Jan 2014: 1 3 Konkani Viswakosh Vol2.pdf/22 , 2 3 Constitución Europea , 3 2 Kostituzzjoni ta’ Malta , 4 2 ចិត្តមាតាបិតា , 5 2 កុមារដ្ឋាន-ម៉ម សុទ្ធ-១៩៥២.pdf/3 , 6 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/124 , 7 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/123 , 8 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/122 , 9 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/121 , 10 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/120 , 11 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/119 , 12 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/118 , 13 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/117 , 14 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/116 , 15 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/115 , 16 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/114 , 17 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/113 , 18 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/112 , 19 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/111 , 20 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/110 , 21 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/109 , 22 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/108 , 23 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/107 , 24 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/106 , 25 2 La Divina Commedia Napoletano Domenico Jaccarino-Nfierno.djvu/105

Feb 2014: 1 3 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/15 , 2 3 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/14 , 3 3 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី៣/12 , 4 3 Ҡыҙыл вәғәз. Шәйехзада Бабич , 5 3 Ғәйет ҡорбан. Шәйехзада Бабич , 6 3 Исемдәр баҡсаһы. Шәйехзада Бабич , 7 3 Список № 9. Шәйехзада Бабич , 8 2 Фазыл Мәржәниҙең мәрҫиәһе. 3-сө өлөш. М.Аҡмулла , 9 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី៨/1 , 10 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី៤/2 , 11 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី៤/1 , 12 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី២/19 , 13 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី២/18 , 14 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី២/17 , 15 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/13 , 16 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/12 , 17 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/11 , 18 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/10 , 19 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/9 , 20 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/8 , 21 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/7 , 22 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/6 , 23 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/5 , 24 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/19 , 25 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី១/17

Mar 2014: 1 3 គតិលោក/ភាគទី៦/1 , 2 3 គតិលោក/ភាគទី៦ , 3 3 គតិលោក/ភាគទី៣ , 4 2 Teatro - Aniello Costagliola.djvu/45 , 5 2 Teatro - Aniello Costagliola.djvu/43 , 6 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/18 , 7 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/16 , 8 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/14 , 9 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/12 , 10 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/10 , 11 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/6 , 12 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/5 , 13 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/4 , 14 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/3 , 15 2 Józef Gara - Zbiór wierszy o wilamowskich obrzędach i obyczajach.pdf/8 , 16 2 Zbiór wierszy o wilamowskich obrzędach i obyczajach oraz Słownik języka wilamowskiego/DY FÜRRYD , 17 2 គតិលោក/ភាគទី៥/16 , 18 2 គតិលោក/ភាគទី២/15 , 19 2 គតិលោក/ភាគទី២/14 , 20 1 Pieśni narodowe.djvu/86

Apr 2014: 1 2 Teatro - Aniello Costagliola.djvu/83 , 2 2 Teatro - Aniello Costagliola.djvu/81 , 3 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/111

May 2014: 1 2 Chha mana atha guntha.pdf/66 , 2 2 Da lu fronte - Lettere de nu Campuasciane.pdf/12 , 3 2 Da lu fronte - Lettere de nu Campuasciane.pdf/11 , 4 2 Da lu fronte - Lettere de nu Campuasciane.pdf/9 , 5 1 მარგალური შხვადო შხვა რე

Jun 2014: 1 3 កម្ពុជសុរិយា/ឆ្នាំទី៣៩ , 2 2 Sinfonie d'amore.pdf/26 , 3 2 Sinfonie d'amore.pdf/25 , 4 2 Sinfonie d'amore.pdf/24 , 5 2 Sinfonie d'amore.pdf/23 , 6 2 Canzoni abruzzesi - De Titta.djvu , 7 2 Chiacchiareata seconna nfra lu Cuorpo de Napole e lu Sebeto.djvu/2 , 8 2 Chiacchiareata seconna nfra lu Cuorpo de Napole e lu Sebeto.djvu/1 , 9 2 Sinfonie d'amore.pdf/19 , 10 2 Sinfonie d'amore.pdf/16 , 11 2 Sinfonie d'amore.pdf/15 , 12 2 'E Lluce-luce.djvu/11 , 13 2 'E Lluce-luce.djvu/10 , 14 2 Chiacchiareata seconna nfra lu Cuorpo de Napole e lu Sebeto.djvu , 15 2 កម្ពុជសុរិយា/ឆ្នាំទី២៥ , 16 2 'E Lluce-luce.djvu/9 , 17 2 Teatro - Aniello Costagliola.djvu/154 , 18 2 កម្ពុជសុរិយា/ឆ្នាំទី៤២ , 19 2 កម្ពុជសុរិយា/ឆ្នាំទី៤១ , 20 2 កម្ពុជសុរិយា/ឆ្នាំទី៤០ , 21 2 កម្ពុជសុរិយា/ឆ្នាំទី៣៨ , 22 2 Teatro - Aniello Costagliola.djvu/153 , 23 2 'E Lluce-luce.djvu/6 , 24 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/119

Jul 2014: 1 2 Teatro - Menotti Bianchi.djvu/30 , 2 2 Teatro - Menotti Bianchi.djvu/29 , 3 2 Teatro - Menotti Bianchi.djvu/27 , 4 2 Teatro - Menotti Bianchi.djvu/25 , 5 2 Teatro - Menotti Bianchi.djvu/23 , 6 2 Teatro - Menotti Bianchi.djvu/13 , 7 2 Teatro - Menotti Bianchi.djvu/5 , 8 2 Teatro - Menotti Bianchi.djvu/1 , 9 2 თაშ რე, სქუა, თე ორინჯეშ , 10 2 Canzoni abruzzesi - De Titta.djvu/3 , 11 2 Canzoni abruzzesi - De Titta.djvu/2 , 12 1 Teatro - Menotti Bianchi.djvu/53

Aug 2014: 1 3 १८५७ का भारतीय स्वातंत्र्य समर.pdf/108 , 2 3 १८५७ का भारतीय स्वातंत्र्य समर.pdf/113 , 3 2 H. Poincaré-Nauka i Hypoteza.djvu , 4 2 १८५७ का भारतीय स्वातंत्र्य समर.pdf/107 , 5 2 १८५७ का भारतीय स्वातंत्र्य समर.pdf/14 , 6 2 Sinfonie d'amore.pdf/34 , 7 2 Sinfonie d'amore.pdf/33 , 8 1 Vene lu viento

Sep 2014: 1 4 Main Page/ଓଡ଼ିଆ , 2 3 १८५७ का भारतीय स्वातंत्र्य समर.pdf/41 , 3 2 Teatro - Menotti Bianchi.djvu/121 , 4 2 Teatro - Menotti Bianchi.djvu/119 , 5 2 Teatro - Menotti Bianchi.djvu/117 , 6 2 Teatro - Menotti Bianchi.djvu/116 , 7 2 Teatro - Menotti Bianchi.djvu/114 , 8 2 Teatro - Menotti Bianchi.djvu/113 , 9 2 Amari jatir agua neta.pdf/33 , 10 2 Amari jatir agua neta.pdf/26 , 11 2 Teatro - Ernesto Murolo.djvu/15 , 12 2 Teatro - Ernesto Murolo.djvu/14 , 13 2 Teatro - Ernesto Murolo.djvu/13 , 14 2 Teatro - Ernesto Murolo.djvu/12 , 15 2 Teatro - Ernesto Murolo.djvu/11 , 16 2 Teatro - Ernesto Murolo.djvu/9 , 17 2 Teatro - Ernesto Murolo.djvu/8 , 18 2 Teatro - Ernesto Murolo.djvu/7 , 19 2 Teatro - Ernesto Murolo.djvu/5 , 20 2 Teatro - Ernesto Murolo.djvu/1 , 21 2 Sarala Bhashatattwa.pdf/69 , 22 2 So muorto e m'hanno fatto tornà a nascere.djvu/5 , 23 2 So muorto e m'hanno fatto tornà a nascere.djvu/3 , 24 2 So muorto e m'hanno fatto tornà a nascere.djvu/1 , 25 2 १८५७ का भारतीय स्वातंत्र्य समर.pdf/169

Oct 2014: 1 3 Main Page/ଓଡ଼ିଆ , 2 2 Main Page/Тыва дыл , 3 2 Jati, Jagruti o Pragati.pdf/10 , 4 2 Jati, Jagruti o Pragati.pdf/9 , 5 2 ଓଡ଼ିଆ ଭାଗବତ/୧୨ , 6 2 ଓଡ଼ିଆ ଭାଗବତ/୧୧ , 7 2 Amari matir amar shaheed.pdf/7 , 8 2 Amari matir amar shaheed.pdf/5 , 9 2 Amari jatir agua neta.pdf/92 , 10 2 Amari jatir agua neta.pdf/68 , 11 2 Poesie napoletane - Ferdinando Russo.djvu , 12 2 Teatro - Menotti Bianchi.djvu/172 , 13 2 Teatro - Menotti Bianchi.djvu/171 , 14 2 Teatro - Menotti Bianchi.djvu/169 , 15 2 Teatro - Menotti Bianchi.djvu/167 , 16 2 Teatro - Menotti Bianchi.djvu/165 , 17 2 Teatro - Menotti Bianchi.djvu/163 , 18 2 Teatro - Menotti Bianchi.djvu/162 , 19 2 Teatro - Menotti Bianchi.djvu/161 , 20 2 Teatro - Menotti Bianchi.djvu/160 , 21 2 Teatro - Menotti Bianchi.djvu/159 , 22 2 Teatro - Menotti Bianchi.djvu/158 , 23 2 Teatro - Menotti Bianchi.djvu/157 , 24 2 Teatro - Menotti Bianchi.djvu/156 , 25 2 Teatro - Menotti Bianchi.djvu/155

Nov 2014: 1 3 Сөөлгу чагаа (Габриэле Гарсиа Маркес / Ондар Ай-кыстың очулгазы) , 2 3 Дүрген аъдым (Ондар Ай-кыс) , 3 3 Чагаа (Ория деп аймактың баштыңчызы / Ондар Ай-кыстың очулгазы) , 4 3 Хүлүмзүрүг (Ондар Ай-кыс) , 5 3 Аралаштыр (Ондар Ай-кыс) , 6 3 Көвей кылдыр ынак мен деп сөглевес мен... (Шекспир / Ондар Ай-кыстың очулгазы) , 7 3 Челээш кырлап (Ондар Ай-кыс) , 8 3 Кады чору (Ондар Ай-кыс) , 9 3 Дилег (Ондар Ай-кыс) , 10 3 Шын (Ондар Ай-кыс) , 11 3 Сагындым (Ондар Ай-кыс) , 12 3 Көрүжүңде (Ондар Ай-кыс) , 13 2 Йөк аты. Фирүзә Абдуллина , 14 2 Teatro - Menotti Bianchi.djvu/305 , 15 2 Teatro - Menotti Bianchi.djvu/289 , 16 2 Teatro - Menotti Bianchi.djvu/288 , 17 2 Дун уруг төрүттүнгенде, хин шыгжаарда йөрээл , 18 2 Эге сөс , 19 2 Бодал (Саган-оол Алдынмай) , 20 2 Салгын биске саавыр номчаан (Саган-оол Алдынмай) , 21 2 Аас-кежииң үжүктери (Саган-оол Алдынмай) , 22 2 Дүүн (Леннон биле Маккартни/Көпектиң очулгазы) , 23 2 Ыдыктыг ыяш (Дамба-Хуурак Орлан) , 24 2 Ховаган мен (Ондар Ай-кыс) , 25 2 Дакпыр балыг кажан бүдер? (Доңгак Эрик)

Dec 2014: 1 2 Ҡышҡы иртә. А.С. Пушкин. , 2 2 Evangelio secundo Luca/Capitulo 3 , 3 2 Бөгөн. Фирүзә Абдуллина. , 4 2 Evangelio secundo Luca/Capitulo 2 , 5 2 Skandinavisk IWW Sång Bok (Seattle, 1920s).djvu/11 , 6 2 Ваҡытым юҡ. Фирүзә Абдуллина. , 7 2 Evangelio secundo Luca/Capitulo 1 , 8 2 'A morte.djvu , 9 2 Notte - Menotti Bianchi.djvu , 10 2 Аҫҡа түгел, өҫкә ҡара... Фирүзә Абдуллина. , 11 2 Teatro - Salvatore di Giacomo.djvu/13 , 12 2 Teatro - Salvatore di Giacomo.djvu/11 , 13 2 Teatro - Salvatore di Giacomo.djvu/9 , 14 2 Teatro - Salvatore di Giacomo.djvu/7 , 15 2 Teatro - Salvatore di Giacomo.djvu/5 , 16 2 Cenerentola.djvu , 17 2 L'Ombra.djvu , 18 2 Йәйем үтә. Фирүзә Абдуллина. , 19 2 Ерем,һыуым, күгем, кешеләрем… Фирүзә Абдуллина. , 20 2 Самалар. Фирүзә Абдуллина. , 21 2 Na sucietà 'e meze cazette.djvu , 22 1 Bhagvadgita पांचवां adhyaya

Jan 2015: 1 2 भगवदगीता- बसंतेश्वरी.pdf , 2 2 'E scugnizze.djvu , 3 2 Teatro - Salvatore di Giacomo.djvu/90 , 4 2 Teatro - Salvatore di Giacomo.djvu/89 , 5 2 Башбит/Бөгөнгө анонстар/2015/01 , 6 1 À la manière de/2ème série

Feb 2015: 1 3 Poesie napoletane - Ferdinando Russo.djvu/40 , 2 3 Poesie napoletane - Ferdinando Russo.djvu/36 , 3 3 Poesie napoletane - Ferdinando Russo.djvu/35 , 4 2 ਸ਼ੇਖ਼ ਚਿੱਲੀ ਦੀ ਕਥਾ.pdf/6 , 5 2 ССРСть Конституцияц (1938).djvu/7 , 6 2 Teatro - Salvatore di Giacomo.djvu/288 , 7 2 Teatro - Salvatore di Giacomo.djvu/287 , 8 2 Comme te voglio amà! (1887).djvu/2 , 9 2 Ammore è pazzo (1890).djvu/2 , 10 2 Gyan Kosh vol 1.pdf/61 , 11 2 Antarrashtriya Gyankosh.pdf/136 , 12 2 Antarrashtriya Gyankosh.pdf/151 , 13 2 Иоанн-вельденьне Шкайстонь Ёнь-куля/ВО/00 , 14 2 Gyan Kosh vol 1.pdf/55 , 15 2 Carcioffolà.djvu/1 , 16 2 Poesie napoletane - Ferdinando Russo.djvu/48 , 17 2 Poesie napoletane - Ferdinando Russo.djvu/47 , 18 2 Poesie napoletane - Ferdinando Russo.djvu/46 , 19 2 Poesie napoletane - Ferdinando Russo.djvu/45 , 20 2 Poesie napoletane - Ferdinando Russo.djvu/44 , 21 2 Poesie napoletane - Ferdinando Russo.djvu/43 , 22 2 Poesie napoletane - Ferdinando Russo.djvu/42 , 23 2 Poesie napoletane - Ferdinando Russo.djvu/41 , 24 2 Poesie napoletane - Ferdinando Russo.djvu/39 , 25 2 Poesie napoletane - Ferdinando Russo.djvu/38

Mar 2015: 1 2 Pieśni narodowe.djvu/86 , 2 2 Pieśni narodowe.djvu/87 , 3 2 Pieśni narodowe.djvu/91 , 4 2 Исеме бар ҙа, есеме юҡ. Зыя Юлмөхәмәтов. , 5 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/59 , 6 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/90 , 7 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/41 , 8 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/35 , 9 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/31 , 10 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/27 , 11 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/23 , 12 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/17 , 13 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/13 , 14 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/9 , 15 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/8 , 16 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/7 , 17 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/6 , 18 2 PL Fizyczne wychowanie w Japonii (Hancock).djvu/5 , 19 2 Swenske och Lappeske ABC/sámegiella , 20 2 Swenske och Lappeske ABC.djvu/36 , 21 2 Swenske och Lappeske ABC.djvu/34 , 22 2 Swenske och Lappeske ABC.djvu/32 , 23 2 Swenske och Lappeske ABC.djvu/30 , 24 2 Swenske och Lappeske ABC.djvu/28 , 25 2 Swenske och Lappeske ABC.djvu/26

Apr 2015: 1 2 Antarrashtriya Gyankosh.pdf/76 , 2 2 Antarrashtriya Gyankosh.pdf/75 , 3 2 Antarrashtriya Gyankosh.pdf/74 , 4 2 Antarrashtriya Gyankosh.pdf/73 , 5 2 Antarrashtriya Gyankosh.pdf/64 , 6 2 Antarrashtriya Gyankosh.pdf/63 , 7 2 Antarrashtriya Gyankosh.pdf/62 , 8 2 Antarrashtriya Gyankosh.pdf/61 , 9 2 Main Page/Түрқменчә , 10 2 Гайталама , 11 2 Башҡорт Викикитапханаһын төҙөүҙә шәхси тәжрибә. Абдуллина Ф.Д. , 12 2 БАШҠОРТ ТЕЛЕ ДӘРЕСТӘРЕНДӘ ВИКИПЕДИЯНЫ ТӨРЛӨ АЛЫМДАРҘА ҠУЛЛАНЫП УҠЫТЫУ. Иҫәнбаева Г.А. , 13 2 ЮҒАРЫ УҠЫУ ЙОРТТАРЫНДА КОМПЬЮТЕР ТЕХНОЛОГИЯҺЫН ҠУЛЛАНЫУ. Вәлиева Г.Д. , 14 2 Antarrashtriya Gyankosh.pdf/100 , 15 2 Antarrashtriya Gyankosh.pdf/99 , 16 2 Antarrashtriya Gyankosh.pdf/98 , 17 2 Antarrashtriya Gyankosh.pdf/97 , 18 2 Antarrashtriya Gyankosh.pdf/60 , 19 2 Antarrashtriya Gyankosh.pdf/68 , 20 2 Antarrashtriya Gyankosh.pdf/67 , 21 2 Antarrashtriya Gyankosh.pdf/106 , 22 2 Antarrashtriya Gyankosh.pdf/105 , 23 2 Antarrashtriya Gyankosh.pdf/80 , 24 2 Antarrashtriya Gyankosh.pdf/66 , 25 2 Antarrashtriya Gyankosh.pdf/79

May 2015: 1 3 Lo cunto de li cunti , 2 2 H. Poincare-Wartość nauki.djvu , 3 2 Nauka i Hypoteza , 4 2 Konkani Vishwakosh - Volume 4 Released.pdf/445 , 5 2 Konkani Vishwakosh - Volume 4 Released.pdf/484 , 6 2 Konkani Vishwakosh - Volume 4 Released.pdf/487 , 7 2 Konkani Vishwakosh - Volume 4 Released.pdf/418 , 8 2 Konkani Vishwakosh - Volume 4 Released.pdf/413 , 9 2 'O nievo.djvu/16 , 10 2 'O nievo.djvu/13 , 11 2 'O nievo.djvu/12 , 12 2 'O nievo.djvu/11 , 13 2 'O nievo.djvu/10 , 14 2 'O nievo.djvu/9 , 15 2 'O nievo.djvu/8 , 16 2 'O nievo.djvu/7 , 17 2 'O nievo.djvu/6 , 18 2 'O nievo.djvu/5

Jun 2015: 1 2 Teatro - Libero Bovio.djvu/11 , 2 2 Teatro - Libero Bovio.djvu/9 , 3 2 Teatro - Libero Bovio.djvu/7 , 4 2 Teatro - Libero Bovio.djvu/6 , 5 2 Teatro - Libero Bovio.djvu/5 , 6 1 გოსოფურ ახალ ქიანას

Jul 2015: 1 3 'E scugnizze.djvu/3 , 2 3 Ҡәҙер кисәһе.Гүзәл Ситдиҡова тәржемәһе , 3 2 Poesie napoletane - Ferdinando Russo.djvu/52 , 4 2 Teatro - Libero Bovio.djvu/39 , 5 2 Teatro - Libero Bovio.djvu/38 , 6 2 Poesie napoletane - Ferdinando Russo.djvu/51 , 7 2 Teatro - Libero Bovio.djvu/37 , 8 2 Poesie napoletane - Ferdinando Russo.djvu/50 , 9 2 Teatro - Libero Bovio.djvu/36 , 10 2 Poesie napoletane - Ferdinando Russo.djvu/49 , 11 2 Teatro - Libero Bovio.djvu/35 , 12 2 Teatro - Libero Bovio.djvu/34 , 13 2 Teatro - Libero Bovio.djvu/33 , 14 2 Teatro - Libero Bovio.djvu/32 , 15 2 'E scugnizze.djvu/4 , 16 2 'E scugnizze.djvu/2 , 17 2 Swahili tales.djvu/40 , 18 2 Swahili tales.djvu/38 , 19 2 Teatro - Libero Bovio.djvu/31 , 20 2 Teatro - Libero Bovio.djvu/30 , 21 2 Teatro - Libero Bovio.djvu/29 , 22 2 Teatro - Libero Bovio.djvu/28 , 23 2 Teatro - Libero Bovio.djvu/27 , 24 2 Teatro - Libero Bovio.djvu/26 , 25 2 Teatro - Libero Bovio.djvu/25

Aug 2015: 1 4 No turco napolitano.djvu/3 , 2 4 Miseria e nobiltà.djvu/1 , 3 4 Wikiproject:L'oro di nap (lotteria) , 4 4 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/6 , 5 3 È buscia o è verità.djvu/3 , 6 3 Carduccianelle.djvu/7 , 7 3 Wikiproject:L'oro di nap (lotteria)/Partecipante , 8 3 Polski:Spis tekstów , 9 3 No turco napolitano.djvu/7 , 10 3 No turco napolitano.djvu/5 , 11 3 No turco napolitano.djvu/4 , 12 3 Miseria e nobiltà.djvu/7 , 13 3 Miseria e nobiltà.djvu/5 , 14 3 Miseria e nobiltà.djvu/4 , 15 3 Miseria e nobiltà.djvu/3 , 16 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/21 , 17 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/53 , 18 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/54 , 19 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/20 , 20 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/19 , 21 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/18 , 22 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/17 , 23 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/16 , 24 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/15 , 25 3 Cholenec - Catherine Tekakouita, trad algonquine,1876.djvu/14

Sep 2015: 1 2 Carduccianelle.djvu/34 , 2 2 Carduccianelle.djvu/22 , 3 2 Carduccianelle.djvu/21 , 4 2 Carduccianelle.djvu/20 , 5 2 Carduccianelle.djvu/19 , 6 2 Kabir Granthavali.pdf/784 , 7 2 Agrumi - August Kopisch - 1838.pdf/43 , 8 2 Lo guaracino (raccolta Agrumi) , 9 2 Kabir Granthavali.pdf/576 , 10 2 Kabir Granthavali.pdf/24 , 11 2 Kabir Granthavali.pdf/198 , 12 2 Kabir Granthavali.pdf/267 , 13 2 Kabir Granthavali.pdf/379 , 14 2 Notte - Menotti Bianchi.djvu/14 , 15 2 Kabir Granthavali.pdf/635 , 16 2 Kabir Granthavali.pdf/382 , 17 2 Agrumi - August Kopisch - 1838.pdf , 18 2 Kabir Granthavali.pdf/904 , 19 2 Kabir Granthavali.pdf/383 , 20 2 Spassatiempo 1875 n.003.djvu/1 , 21 2 Notte - Menotti Bianchi.djvu/11 , 22 2 Kabir Granthavali.pdf/600 , 23 2 PL Słownik geograficzny Królestwa Polskiego i innych krajów słowiańskich. T. 1.djvu/178 , 24 2 Julian Ursyn Niemcewicz-Nasze Verkehry.pdf/5 , 25 2 Julian Ursyn Niemcewicz-Nasze Verkehry.pdf/16

Oct 2015: 1 2 Teatro - Libero Bovio.djvu/153 , 2 2 ਛੰਤ ਗੁਰੂ ਅਰਜਨ ਦੇਵ ਜੀ , 3 2 ਸੁਖਮਨੀ ਸਾਹਿਬ , 4 2 Adam Bełcikowski - Pies i jego obyczaje.djvu/25 , 5 2 Adam Bełcikowski - Pies i jego obyczaje.djvu/24 , 6 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/202

Nov 2015: 1 2 Көршәк. , 2 2 Code of Hammurabi (1904).pdf/30 , 3 2 Code of Hammurabi (1904).pdf/28 , 4 2 Code of Hammurabi (1904).pdf/26 , 5 2 Code of Hammurabi (1904).pdf/24 , 6 2 Code of Hammurabi (1904).pdf/22 , 7 2 ზურაბ ცხონდია , 8 1 Ma che me n'importe a me che je so' bella

Dec 2015: 1 3 民約與邦本 , 2 2 Lo cunto de li cunti , 3 2 Verhandelingen van het Bataviaasch Genotschap van Kunsten en Wetenschappen LVIII.djvu/127 , 4 2 Wikiproject:'O testo tuosto 'e Natale , 5 2 Lo cunto de li cunte - Tomo II.djvu/5 , 6 2 Lo cunto de li cunte - Tomo I.djvu/11 , 7 2 Lo cunto de li cunte - Tomo II.djvu/107 , 8 2 Lo cunto de li cunte , 9 2 Lo cunto de li cunte - Tomo II.djvu/75 , 10 2 Lo cunto de li cunte - Tomo II.djvu/73 , 11 2 Lo cunto de li cunte - Tomo II.djvu/11 , 12 2 Lo cunto de li cunte - Tomo II.djvu/10 , 13 2 Lo cunto de li cunte - Tomo II.djvu/9 , 14 2 Lo cunto de li cunte - Tomo I.djvu/3 , 15 2 Lo cunto de li cunte - Tomo I.djvu/246 , 16 2 Lo cunto de li cunte - Tomo I.djvu/83 , 17 2 Lo cunto de li cunte - Tomo I.djvu/75 , 18 2 Lo cunto de li cunte - Tomo I.djvu/57 , 19 2 Lo cunto de li cunte - Tomo I.djvu/25 , 20 2 Lo cunto de li cunte - Tomo I.djvu/24 , 21 2 Lo cunto de li cunte - Tomo I.djvu/23

Jan 2016: 1 3 Ottův slovník naučný/Abbotova pasta , 2 3 Main Page/Лезги , 3 3 Rashida kniga.pdf , 4 3 Башҡорт халҡының милли үҙаңын үҫтереүҙә киң мәғлүмәт сараларының роле , 5 3 \"Ек Мәргән\" хикәйәтендә әҙәби фекер сағылышы , 6 3 Әхмәтзәки Вәлиди Туғандың «Шура» журналы биттәрендәге публицистикаһы , 7 3 Башҡортостан район газеталарында милли концепция сығышы (Мәләүез районының «Көнгәк» газетаһы миҫалында) , 8 3 Poesie motti e pensieri.djvu/9 , 9 2 PL Jan Łąpiński - Przewodnik po Ciechocinku.djvu/7 , 10 2 PL Jan Łąpiński - Przewodnik po Ciechocinku.djvu/6 , 11 2 PL Jan Łąpiński - Przewodnik po Ciechocinku.djvu/5 , 12 2 Altavilla - Lli fanatice pe lo Geronta Sebezio.djvu/7 , 13 2 Altavilla - Lli fanatice pe lo Geronta Sebezio.djvu/6 , 14 2 Altavilla - Lli fanatice pe lo Geronta Sebezio.djvu/5 , 15 2 Altavilla - Lli fanatice pe lo Geronta Sebezio.djvu/4 , 16 2 Altavilla - Lli fanatice pe lo Geronta Sebezio.djvu/3 , 17 2 Altavilla - Lli fanatice pe lo Geronta Sebezio.djvu/2 , 18 2 Altavilla - La folla pe lu ppane francese.djvu/4 , 19 2 Altavilla - Lli fanatice pe lo Geronta Sebezio.djvu/1 , 20 2 Altavilla - Li duje segretiste.djvu/6 , 21 2 Altavilla - Li duje segretiste.djvu/5 , 22 2 Altavilla - Li duje segretiste.djvu/2 , 23 2 Altavilla - Li duje segretiste.djvu/1 , 24 2 Остазым генерал Мирсалих Биксуринға мәҙхиә , 25 2 Бер ҡалала гүзәл күрҙем

Feb 2016: 1 3 Main Page/Napulitano/Editori , 2 3 Main Page/Napulitano/Categorie , 3 2 'A storia nova - Ferdinando Russo.djvu/7 , 4 2 'A storia nova - Ferdinando Russo.djvu/5 , 5 2 'A storia nova - Ferdinando Russo.djvu/4 , 6 2 'A storia nova - Ferdinando Russo.djvu/1 , 7 2 'A storia nova - Ferdinando Russo.djvu/47 , 8 2 तत्वविवेकप्रकरणम् , 9 2 Piedigrotta - Commedia per musica - Marco d'Arienzo - Luigi Ricci.djvu , 10 2 Altavilla - Nu turtaniello ca nzogna.djvu/4 , 11 2 Lo matremmonio a fforza - Michele Zezza.djvu , 12 2 Gente 'e mala vita (1897) - Ferdinando Russo.djvu , 13 2 Canta Posillipo... (Ernesto Murolo).djvu , 14 2 Canzoni napolitane - Salvatore Di Giacomo - 1891.djvu , 15 2 Eco di napoli - 100 celebri canzoni popolari napolitane - Vincenzo De Meglio - Vol 1.djvu , 16 2 Le poesie di Giovanni Capurro - 1918.djvu , 17 2 Agrumi - August Kopisch - 1838.pdf , 18 2 Nuove poesie e prosa in dialetto materano - Francesco Festa.djvu , 19 2 Saggio di traduzioni e poesie in dialetto Materano - Francesco Festa.djvu , 20 1 Reboux-Müller - À la manière de, sér1-2, 1921.djvu

Mar 2016: 1 3 Егеттәрҙәй мәле Йәнйегеттең , 2 2 “Һай, үҙебеҙҙекеләр!” йәки һимеҙлектән ҡотолоу , 3 2 Jarosz Derdowski - O Panu Czorlińscim co do Pucka po sece jachoł.djvu/21 , 4 2 Altavilla - Lo stracchino de no rano lo piezzo.djvu/4 , 5 2 Altavilla - Lo stracchino de no rano lo piezzo.djvu/2 , 6 2 Teatro - Libero Bovio.djvu/215 , 7 2 Teatro - Libero Bovio.djvu/216 , 8 2 Teatro - Libero Bovio.djvu/212 , 9 2 Teatro - Libero Bovio.djvu/211 , 10 2 Teatro - Libero Bovio.djvu/210 , 11 2 Altavilla - Pascariello e Pascalotto.djvu/4 , 12 2 Altavilla - No barone fermo e n'auto de rispetto.djvu/4 , 13 2 Altavilla - No barone fermo e n'auto de rispetto.djvu/2 , 14 2 Altavilla - No barone fermo e n'auto de rispetto.djvu/1 , 15 2 O Novo Guia da Conversação, em Portuguez e Inglez, em duas partes.djvu/183 , 16 2 O Novo Guia da Conversação, em Portuguez e Inglez, em duas partes.djvu/180 , 17 2 O Novo Guia da Conversação, em Portuguez e Inglez, em duas partes.djvu/115 , 18 2 O Novo Guia da Conversação, em Portuguez e Inglez, em duas partes.djvu/37 , 19 2 O Novo Guia da Conversação, em Portuguez e Inglez, em duas partes.djvu/108 , 20 2 O Novo Guia da Conversação, em Portuguez e Inglez, em duas partes.djvu/158 , 21 2 Altavilla - Li venneture de grasso lucido.djvu/11 , 22 2 Altavilla - Li venneture de grasso lucido.djvu/10 , 23 2 Altavilla - Li venneture de grasso lucido.djvu/9 , 24 2 Илсекәй – боронғо ауыл , 25 2 Altavilla - No duetto sbriogna e no palco arrepezza.djvu/2

Apr 2016: 1 2 პოეტიშ ეკონია ობირეში , 2 1 No si poni risistì

May 2016: 1 3 Poesaka Soenda 1922-07-1(01).djvu/10 , 2 2 Poesaka Soenda 1922-07-1(01).djvu/8 , 3 2 Dan Kihote , 4 2 Di Piiriad , 5 2 Sebm Iej a Man , 6 2 Saam 91 , 7 2 Sata , 8 1 Buscia!

Jun 2016: 1 4 Ramanama.pdf/6 , 2 3 Satya Ke Prayog - Mahatma Gandhi.pdf/331 , 3 3 Satya Ke Prayog - Mahatma Gandhi.pdf/6 , 4 3 Ramanama.pdf/9 , 5 3 Ramanama.pdf/8 , 6 3 Ramanama.pdf/7 , 7 3 Poesaka Soenda 1924-(10-12)-3(04).pdf/19 , 8 3 სი მიგოჩქ, შურ გიდგუ , 9 2 Satya Ke Prayog - Mahatma Gandhi.pdf/426 , 10 2 Satya Ke Prayog - Mahatma Gandhi.pdf/401 , 11 2 Satya Ke Prayog - Mahatma Gandhi.pdf/400 , 12 2 Satya Ke Prayog - Mahatma Gandhi.pdf/399 , 13 2 Satya Ke Prayog - Mahatma Gandhi.pdf/398 , 14 2 Satya Ke Prayog - Mahatma Gandhi.pdf/397 , 15 2 Satya Ke Prayog - Mahatma Gandhi.pdf/396 , 16 2 Satya Ke Prayog - Mahatma Gandhi.pdf/395 , 17 2 Satya Ke Prayog - Mahatma Gandhi.pdf/394 , 18 2 Satya Ke Prayog - Mahatma Gandhi.pdf/393 , 19 2 Satya Ke Prayog - Mahatma Gandhi.pdf/392 , 20 2 Satya Ke Prayog - Mahatma Gandhi.pdf/391 , 21 2 Satya Ke Prayog - Mahatma Gandhi.pdf/389 , 22 2 Satya Ke Prayog - Mahatma Gandhi.pdf/388 , 23 2 Satya Ke Prayog - Mahatma Gandhi.pdf/387 , 24 2 Satya Ke Prayog - Mahatma Gandhi.pdf/386 , 25 2 Satya Ke Prayog - Mahatma Gandhi.pdf/385

Jul 2016: 1 2 Reboux-Müller - À la manière de, sér1-2, 1921.djvu/223 , 2 2 Reboux-Müller - À la manière de, sér1-2, 1921.djvu/221 , 3 2 Reboux-Müller - À la manière de, sér1-2, 1921.djvu/220 , 4 2 Reboux-Müller - À la manière de, sér1-2, 1921.djvu/219 , 5 2 Reboux-Müller - À la manière de, sér1-2, 1921.djvu/218 , 6 2 Julius Ceasuer Punjabi Translation by HS Gill.pdf/17 , 7 2 Julius Ceasuer Punjabi Translation by HS Gill.pdf/16 , 8 2 Милләт бәҫен ҡайғыртыусылар , 9 2 Julius Ceasuer Punjabi Translation by HS Gill.pdf/15 , 10 2 Julius Ceasuer Punjabi Translation by HS Gill.pdf/14 , 11 2 Илсекәй – боронғо ауыл , 12 2 Kabir Granthavali.pdf/4 , 13 1 À la manière de…/sér1-2/Rédemption

Aug 2016: 1 3 Wikisource , 2 2 Коңгурой , 3 2 मित्रता , 4 2 یازار:محممد فوضولی , 5 2 Čåče nostru , 6 2 Teatro - Ernesto Murolo , 7 2 Agrumi - August Kopisch - 1838.pdf/46 , 8 2 १८५७ का भारतीय स्वातंत्र्य समर.pdf/196 , 9 2 Sinfonie d'amore.pdf/10 , 10 1 À la manière de…/sér1-2/Le Tigre et le Lion

Sep 2016: 1 3 Jamunā laharī.pdf/19 , 2 2 PL Jan Łąpiński - Przewodnik po Ciechocinku.djvu/284 , 3 2 PL Jan Łąpiński - Przewodnik po Ciechocinku.djvu/25 , 4 2 PL Jan Łąpiński - Przewodnik po Ciechocinku.djvu/23 , 5 2 PL Jan Łąpiński - Przewodnik po Ciechocinku.djvu/10 , 6 2 Чавайн - Элнет/Кумшо ужаш , 7 2 Чавайн - Элнет/Кокымшо ужаш , 8 2 Чавайн - Элнет/Икымше ужаш , 9 2 ᠴᡳᠩ ᠸᡝᠨ ᡴᡳ ᠮᡝᠩ ᠪᡳᡨ᠌ᡥᡝ/ᠵᠠᡳ ᡩᡝᠪᡨᡝᠯᡳᠨ , 10 2 Godan - Premchand - Hindi Novel.pdf/560 , 11 2 Godan - Premchand - Hindi Novel.pdf/559 , 12 2 Godan - Premchand - Hindi Novel.pdf/558 , 13 2 Godan - Premchand - Hindi Novel.pdf/557 , 14 2 Godan - Premchand - Hindi Novel.pdf/556 , 15 2 Godan - Premchand - Hindi Novel.pdf/555 , 16 2 Godan - Premchand - Hindi Novel.pdf/554 , 17 2 Godan - Premchand - Hindi Novel.pdf/553 , 18 2 Godan - Premchand - Hindi Novel.pdf/551 , 19 2 Godan - Premchand - Hindi Novel.pdf/549 , 20 2 Godan - Premchand - Hindi Novel.pdf/547 , 21 2 Godan - Premchand - Hindi Novel.pdf/546 , 22 2 Godan - Premchand - Hindi Novel.pdf/545 , 23 2 Godan - Premchand - Hindi Novel.pdf/544 , 24 2 Godan - Premchand - Hindi Novel.pdf/543 , 25 2 Godan - Premchand - Hindi Novel.pdf/542

Oct 2016: 1 3 Śpiewnik Robotniczy PPS.djvu/26 , 2 3 Śpiewnik Robotniczy PPS.djvu/25 , 3 2 Hej! na bój! , 4 2 Julius Ceasuer Punjabi Translation by HS Gill.pdf/51 , 5 2 Julius Ceasuer Punjabi Translation by HS Gill.pdf/50 , 6 2 Julius Ceasuer Punjabi Translation by HS Gill.pdf/49 , 7 1 'O pueta

Nov 2016: 1 3 Ghadar Di Goonj.pdf/6 , 2 3 Ghadar Di Goonj.pdf/7 , 3 3 Julius Ceasuer Punjabi Translation by HS Gill.pdf/114 , 4 3 Julius Ceasuer Punjabi Translation by HS Gill.pdf/52 , 5 3 Julius Ceasuer Punjabi Translation by HS Gill.pdf/28 , 6 3 Jhagda Suchaji Te Kuchaji Naar Da.pdf/8 , 7 2 Jhagda Suchaji Te Kuchaji Naar Da.pdf/10 , 8 2 Jhagda Suchaji Te Kuchaji Naar Da.pdf/9 , 9 2 Серле муйынсаҡ. Дүртенсе күренеш , 10 2 Серле муйынсаҡ. Өсөнсө күренеш , 11 2 Серле муйынсаҡ. Икенсе күренеш , 12 2 Серле муйынсаҡ. Беренсе күренеш , 13 2 Серле муйынсаҡ. Ҡатнашыусылар , 14 2 Серле муйынсаҡ (сценарий) , 15 2 Sohni Mahiwal - Qadir Yar.pdf/2 , 16 2 Sohni Mahiwal - Qadir Yar.pdf/1 , 17 2 Ghadar Di Goonj.pdf/9 , 18 2 Ghadar Di Goonj.pdf/8 , 19 2 تشکیک سے مذہب کی تائید ہوتی ہے یا مخالفت , 20 1 Reboux-Müller - À la manière de, sér1-2, 1921.djvu

Dec 2016: 1 3 Rajasthan Ki Rajat Boondein (Hindi).pdf/5 , 2 3 Rajasthan Ki Rajat Boondein (Hindi).pdf/2 , 3 3 ᠮᠠᠨᠵᡠ ᡳ ᠶᠠᡵᡤᡳᠶᠠᠨ ᡴᠣᠣᠯᡳ/ᡠᠵᡠᡳ ᡩᡝᠪᡨᡝᠯᡳᠨ , 4 3 ᠮᠠᠨᠵᡠ ᡳ ᠶᠠᡵᡤᡳᠶᠠᠨ ᡴᠣᠣᠯᡳ , 5 3 Macbeth Shakespeare in Punjabi by HS Gill.pdf/98 , 6 3 Macbeth Shakespeare in Punjabi by HS Gill.pdf/18 , 7 3 Main Page/ਪੰਜਾਬੀ , 8 2 Demon (Michaił Lermontow).djvu/3 , 9 2 Demon (Michaił Lermontow).djvu/2 , 10 2 Aaj Bhi Khare Hain Talaab (Punjabi).pdf/11 , 11 2 Aaj Bhi Khare Hain Talaab (Hindi).pdf/5 , 12 2 Aaj Bhi Khare Hain Talaab (Hindi).pdf/2 , 13 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/37 , 14 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/36 , 15 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/35 , 16 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/34 , 17 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/33 , 18 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/32 , 19 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/31 , 20 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/30 , 21 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/29 , 22 2 Rajasthan Ki Rajat Boondein (Hindi).pdf/28 , 23 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/293

Jan 2017: 1 4 A geographical description of the Panjab.pdf/20 , 2 4 Guru Granth Tey Panth.djvu/10 , 3 4 Guru Granth Tey Panth.djvu/6 , 4 4 Guru Granth Tey Panth.djvu/5 , 5 3 Demon (Michaił Lermontow).djvu/15 , 6 3 Demon (Michaił Lermontow).djvu/11 , 7 3 Demon (Michaił Lermontow).djvu/10 , 8 3 A geographical description of the Panjab.pdf/21 , 9 3 A geographical description of the Panjab.pdf/19 , 10 3 A geographical description of the Panjab.pdf/18 , 11 3 A geographical description of the Panjab.pdf/17 , 12 3 A geographical description of the Panjab.pdf/11 , 13 3 A geographical description of the Panjab.pdf/10 , 14 3 A geographical description of the Panjab.pdf/9 , 15 3 Guru Granth Tey Panth.djvu/14 , 16 3 Guru Granth Tey Panth.djvu/13 , 17 3 Guru Granth Tey Panth.djvu/12 , 18 3 Guru Granth Tey Panth.djvu/11 , 19 3 Guru Granth Tey Panth.djvu/9 , 20 2 Demon (Michaił Lermontow).djvu/53 , 21 2 Demon (Michaił Lermontow).djvu/20 , 22 2 Demon (Michaił Lermontow).djvu/19 , 23 2 Demon (Michaił Lermontow).djvu/18 , 24 2 Demon (Michaił Lermontow).djvu/17 , 25 2 Demon (Michaił Lermontow).djvu/16

Feb 2017: 1 3 Karel Dostál-Lutinov - Duch Německa - 1917.djvu/115 , 2 3 Antoni Lange - Przekłady z poetów obcych.djvu/313 , 3 3 Ghadar Di Goonj.pdf/11 , 4 3 Sakuntala in Hindi.pdf/25 , 5 3 Sakuntala in Hindi.pdf/24 , 6 3 Sakuntala in Hindi.pdf/23 , 7 3 Sakuntala in Hindi.pdf/22 , 8 3 Sakuntala in Hindi.pdf/21 , 9 3 Sakuntala in Hindi.pdf/20 , 10 3 Sakuntala in Hindi.pdf/19 , 11 3 A geographical description of the Panjab.pdf/61 , 12 3 A geographical description of the Panjab.pdf/42 , 13 3 A geographical description of the Panjab.pdf/37 , 14 3 A geographical description of the Panjab.pdf/36 , 15 3 A geographical description of the Panjab.pdf/35 , 16 3 A geographical description of the Panjab.pdf/32 , 17 3 A geographical description of the Panjab.pdf/21 , 18 3 Dharami Soorma.pdf/11 , 19 3 ਮੈਕਬੈਥ , 20 2 Stará panna , 21 2 Karel Dostál-Lutinov - Duch Německa - 1917.djvu/139 , 22 2 Antoni Lange - Przekłady z poetów obcych.djvu/312 , 23 2 Ghadar Di Goonj.pdf/10 , 24 2 Sakuntala in Hindi.pdf/31 , 25 2 Sakuntala in Hindi.pdf/30

Mar 2017: 1 2 Demon (Michaił Lermontow).djvu/31 , 2 2 Demon (Michaił Lermontow).djvu/24 , 3 2 Demon (Michaił Lermontow).djvu/17 , 4 2 Demon (Michaił Lermontow).djvu , 5 2 Guru Granth Tey Panth.djvu/87 , 6 2 १८५७ का भारतीय स्वातंत्र्य समर.pdf/321 , 7 2 Main Page/मराठी , 8 1 香港特別行政區 高等法院原訟法庭 民事司法管轄權 高院憲法及行政訴訟2016年第164號

Apr 2017: 1 4 O kobiecie i o miłości.djvu/5 , 2 4 O kobiecie i o miłości.djvu/3 , 3 3 O kobiecie i o miłości.djvu/9 , 4 3 O kobiecie i o miłości.djvu/7 , 5 2 O kobiecie i o miłości , 6 2 O kobiecie i o miłości.djvu/71 , 7 1 Евангелие от Матфея, Марка, Луки и Иоанна на мордовском языке (М. Е. Евсевьев, 1910).djvu/94

May 2017: 1 3 Konkani Viswakosh Vol1.pdf/56 , 2 3 Konkani Viswakosh Vol1.pdf/51 , 3 2 Main Page/mfe , 4 2 Main Page/Morisien , 5 2 Intrada/La Bibia piemontèisa , 6 2 Main Page/Ladin , 7 2 Main Page/Тоҷикӣ , 8 2 Саҳифаи Аслӣ , 9 2 Konkani Viswakosh Vol1.pdf/59 , 10 2 Konkani Viswakosh Vol1.pdf/104 , 11 2 Konkani Viswakosh Vol1.pdf/103 , 12 2 Konkani Viswakosh Vol1.pdf/60 , 13 2 Konkani Viswakosh Vol1.pdf/58 , 14 2 Konkani Viswakosh Vol1.pdf/57 , 15 1 香港特別行政區 高等法院原訟法庭 民事司法管轄權 高院憲法及行政訴訟2016年第164號

Jun 2017: 1 4 Buscia! , 2 3 Vene lu viento , 3 3 Veditela veditela chi sponta , 4 3 Serenata napulitana , 5 3 Padrone mio te voglio arrecchire , 6 3 'O surdato 'nnammurato , 7 3 'O pueta , 8 3 Marzo (Di Giacomo) , 9 3 Ma che me n'importe a me che je so' bella , 10 1 Евангелие от Матфея, Марка, Луки и Иоанна на мордовском языке (М. Е. Евсевьев, 1910).djvu/220

Jul 2017: 1 2 Hail Mary , 2 2 Wikisource , 3 1 Selections from the Sahih of al-Buhari (1906).djvu

Aug 2017: 1 2 Vajtim e mallkim , 2 2 Para fëtyrës Naim Frashërit , 3 2 Vajtim mbi varrin e Naim Frashërit , 4 2 Main Page/ᠰᡞᠪᡝ ᡤᡞᠰᡠᠨ , 5 2 აღწერა სამეფოსა საქართველოსა , 6 2 Séng-gĭng/Mā-tái Hók-ĭng/5 , 7 2 Main Page/ᠮᠠᠨᠵᡠ ᡤᡳᠰᡠᠨ , 8 2 Hail Mary , 9 1 Storia dla leteratura ladina/Storia dla leteratura ladina/2.1.1

Sep 2017: 1 1 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu/30

Oct 2017: 1 3 Facecje Republikańskie , 2 3 Królewsko-Polski Kabaret , 3 3 Rzeczpospolita Babińska , 4 3 Wygnańcy , 5 2 1924 - საისტორიო მოამბე - I , 6 2 Ottův slovník naučný/Abbotova pasta , 7 2 Autori e opere in ladino , 8 2 Ad astra! , 9 2 Ocalenie , 10 2 La odòndra , 11 2 W cieniu miecza (tomik) , 12 2 La flu , 13 2 Le jagher dal jal da galeder , 14 2 Sady (tomik) , 15 2 Książę/Część pierwsza/całość , 16 2 Książę/Część druga/całość , 17 2 Książę , 18 2 Modlitwa , 19 2 Ucieczka , 20 2 Zdrada , 21 2 Jesień , 22 2 Połów gwiazd (tomik) , 23 2 Wygnańcy/XVII , 24 2 Wygnańcy/Całość , 25 2 Wygnańcy/XVI

Nov 2017: 1 3 آتش پارے , 2 3 آنائی کے شیر انسان/باب 1 , 3 3 آنائی کے شیر انسان , 4 2 Cherokee Primer.djvu/2 , 5 2 Cherokee Primer.djvu/1 , 6 2 بائبل (شاہ جیمس)/طوبیاہ , 7 2 آنائی کے شیر انسان - باب 6 , 8 2 آنائی کے شیر انسان - باب 5 , 9 2 آنائی کے شیر انسان - باب 4 , 10 2 آنائی کے آدم خور انسان\\باب 4 , 11 2 آنائی کے شیر انسان - باب 3 , 12 2 آنائی کے شیر انسان - باب 2 , 13 2 مورمن کی کتاب.pdf , 14 2 Progreso - 1a yaro.pdf/199 , 15 2 Progreso - 1a yaro.pdf/201 , 16 2 Progreso - 1a yaro.pdf/200 , 17 2 Progreso - 1a yaro.pdf/17 , 18 2 Progreso - 1a yaro.pdf/16 , 19 1 कर्नाटकस्य कला सम्स्क्रुति

Dec 2017: 1 3 Wikisource , 2 2 Lehorreko arrantzalea.pdf/23 , 3 2 Lehorreko arrantzalea.pdf/22 , 4 2 Lehorreko arrantzalea.pdf/21 , 5 2 Lehorreko arrantzalea.pdf/20 , 6 1 À la manière de…/sér1-2/La Parure

Jan 2018: 1 2 Querimònia:Conclusion , 2 2 Querimònia:Article XX , 3 2 Querimònia:Article XVI , 4 2 Querimònia:Article XIII , 5 2 Querimònia:Article X , 6 2 Querimònia:Article VII , 7 2 Querimònia:Article IV , 8 2 Querimònia:Article I , 9 2 Querimònia:Introduccion , 10 1 Usuari:KRLS/Cat-a-lot.js

Feb 2018: 1 2 Cnuasacht trágha - Sheehan.djvu , 2 2 La settimana religiosa1894.pdf/6 , 3 2 Викикитапхана:Әҫәрҙәре йәмғиәт милкенә күскән авторҙар исемлеге , 4 2 Spozoei Impromissi , 5 2 Lu rebellamentu di Sichilia - Palermo (1882).djvu , 6 2 Ra.canson.de.l'aze.1665.djvu , 7 2 ប្រជុំរឿងព្រេងខ្មែរ/ភាគទី៤/2 , 8 2 Universal Declaration of Human Rights , 9 1 Прафисыр И.П.Бараздин

Mar 2018: 1 3 Wikisource , 2 2 Ән-Нәс сүрәһе , 3 1 说人生观

Apr 2018: 1 4 सूर के पद-2 , 2 2 აბულაძე ილია - ნაბეჭდი სამეცნიერო შრომების სია , 3 2 Progreso - 1a yaro.pdf/766 , 4 2 H.M. Im Schlaraffenland.djvu/224 , 5 2 Piaggio Poexie zeneize 1846.djvu/613 , 6 2 说人生观 , 7 2 Teatro - Salvatore di Giacomo.djvu/40 , 8 2 რინა მოკო პელაზგური , 9 2 Main Page/Wenska rec , 10 2 Main Page/Euskara , 11 1 Progreso - 1a yaro.pdf/581

May 2018: 1 2 მცხეთის საბუთები № 482 , 2 2 1508-1509 წწ. - შეწირულების სიგელი მზეჭაბუკ ათაბაგისა აწყურის ღმრთისმშობლისადმი , 3 2 Dolnołužyske Serbstwo w zachodnem lěśe , 4 2 Bogumił Šwjela , 5 2 Мөхәммәт Пәйғәмбәрҙең хәләл ефеттәре , 6 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/7 , 7 2 Aesop a tháinig go h-Éirinn.djvu , 8 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/fel/11 , 9 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/fel , 10 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/rif/11 , 11 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/rif , 12 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/2 , 13 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/13 , 14 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/12 , 15 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/11 , 16 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/rif/10 , 17 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/10 , 18 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu/rif/1 , 19 2 H. Forir - Notul so lè bazè skol dè vî tin, 1862 (in BSLLW t.4 p.66-78).djvu , 20 2 Jakub Kućank , 21 2 Bjarnat Krawc , 22 2 Korla Awgust Mosak-Kłosopólski , 23 2 Korla Awgust Jenč , 24 2 Mikławš Jacsławk , 25 2 Jaroměr Hendrich Imiš

Jun 2018: 1 3 မြန်မာတွေ စည်းကမ်းဖောက် , 2 3 ဗုံကြီးသံကဗျာ , 3 3 မြကန် , 4 3 A scoverta de l'América , 5 2 1 Esdras , 6 2 ပန်းသည် , 7 2 တူတူရေဝါး , 8 2 ဥပုသ်စောင့် , 9 2 ဝင်္ကပါ , 10 2 လယ်စောင့်တဲလေး , 11 2 ကြာဆစ်ကြိုး , 12 2 သပြေသီးကောက် , 13 2 ရွှေခဲကြက်တူရွေး , 14 2 တပေါင်းလဘွဲ့ လေးချိုးပုလဲ , 15 2 ဆောင်းဘွဲ့ လေးချိုး , 16 2 စလေဉာဏ် , 17 2 ဆောင်းရတုပွဲ လေးချိုး , 18 2 အနန္တသူရိယ မျက်ဖြေလင်္ကာ , 19 2 သိုးကလေ , 20 2 မိန်ရာသီ တပေါင်းလဘွဲ့ လူးတား , 21 2 ဗြိစ္ဆာရာသီ တန်ဆောင်မုန်းလဘွဲ့ လူးတား , 22 2 တူရာသီ သီတင်းကျွတ်လဘွဲ့ လူးတား , 23 2 ကရကဋ်ရာသီ ဝါဆိုလဘွဲ့ လူးတား , 24 2 ပြိဿရာသီ ကဆုန်လဘွဲ့ လူးတား , 25 2 မိဿရာသီ တန်ခူးလဘွဲ့ လူးတား

Jul 2018: 1 3 Main Page/Istriot , 2 3 Singhasan Battisi.pdf/162 , 3 3 Singhasan Battisi.pdf/71 , 4 2 Innamoramento/09 , 5 2 Innamoramento/08 , 6 2 Innamoramento/07 , 7 2 Innamoramento/06 , 8 2 Innamoramento/05 , 9 2 Innamoramento/04 , 10 2 Innamoramento/03 , 11 2 Innamoramento/02 , 12 2 Innamoramento/01 , 13 2 Bontà e bellezza dell'uomo/09 , 14 2 Bontà e bellezza dell'uomo/08 , 15 2 Bontà e bellezza dell'uomo/07 , 16 2 Bontà e bellezza dell'uomo/06 , 17 2 Bontà e bellezza dell'uomo/05 , 18 2 Bontà e bellezza dell'uomo/04 , 19 2 Bontà e bellezza dell'uomo/03 , 20 2 Bontà e bellezza dell'uomo/02 , 21 2 Bontà e bellezza dell'uomo/01 , 22 2 Innamoramento , 23 2 Bontà e bellezza dell'uomo , 24 2 Bontà e bellezza di donna/09 , 25 2 Bontà e bellezza di donna/08

Aug 2018: 1 3 Main Page/Ladin , 2 3 Main Page/Эрзянь , 3 3 Main Page/Asturianu , 4 2 ကြာအေး , 5 2 တို့ဖေဖေ , 6 2 ပန်းလက်ဆောင် , 7 2 ဗောဓိရွှေကျောင်း , 8 2 Эрямос совамо (Т. А. Раптанов, 1936).djvu/10 , 9 2 Эрямос совамо (Т. А. Раптанов, 1936).djvu/9 , 10 2 Hærramek ja bæsstamek Jesus Kristus ođđa Testament.pdf/5 , 11 2 Main Page/Livvikarjalan , 12 2 Main Page/Слове́нскїй , 13 2 La Bibia piemontèisa , 14 2 Main Page/پښـــــتو , 15 2 Main Page/Lumbaart , 16 2 Main Page/Pó-sing-gṳ̂ , 17 2 Main Page/Hinónoʼeitíít , 18 2 Main Page/Bolak , 19 2 Main Page/Chibemba , 20 2 Main Page/Davvisámegiella , 21 2 Main Page/O‘zbek , 22 2 Main Page/Avestan , 23 2 მარგალურ–ქორთულ ლექსიკონი , 24 2 Main Page/Vepsän kel' , 25 2 Main Page/Gagauz

Sep 2018: 1 2 Vatey verêna , 2 2 Btreydloffts gedicht , 3 2 1518 წ. - წყალობის წიგნი შიოშ ფალავანდიშვილისა გიორგი გულიკაშვილისადმი , 4 2 Эрямос совамо (Т. А. Раптанов, 1936).djvu/90 , 5 2 1478 წ. ახლო - საჩივრის წიგნი ავთანდილ ზევდგინისძისა - III , 6 2 Aşmi tepıştış , 7 2 Anê-Danê , 8 2 Psychopathologie de la vie quotidienne/1 , 9 2 Freud - La Psychopathologie de la vie quotidienne, 1922, trad. Jankélévitch.djvu , 10 2 1965 - ქართული სამართლის ძეგლები - ტომი II , 11 2 Main Page/Bahasa Melayu , 12 2 Main Page/Afrikaans , 13 1 Мезе работамс велень хозяйстваса комсомолти и од ломаттненди

Oct 2018: 1 3 Paskeille sur le véritable Détail du Siège & Dessiègement de la Généreuse Vienne.png/rif , 2 3 Lorelei , 3 2 ქართული საბჭოთა ენციკლოპედია, ტ. 1.djvu/5 , 4 2 Sul matrimoni de duu vecc , 5 2 Pupin sul trii , 6 2 On mort in pee , 7 2 La poesia della Olga , 8 2 Fegls sgulants da la Rosa alva , 9 2 Babad Panjalu , 10 2 Al didancuei , 11 2 La ciacia , 12 2 Recort dl ann 1866 , 13 2 Rätoromanische bibliographie bibliografia retoromanza 1729- 2015/Premessa , 14 2 Manifest da la Partida communistica , 15 2 Main Page/Lumbaart , 16 1 1565 წ. 09.25. - ნასყიდობის წიგნი ელიზბარ სოლაღაშვილისა პაპუნა მაღალაძისადმი

Nov 2018: 1 5 संत काव्य.pdf/21 , 2 4 भारत में अंगरेज़ी राज.pdf/100 , 3 4 संत काव्य.pdf/40 , 4 4 संत काव्य.pdf/39 , 5 4 संत काव्य.pdf/38 , 6 4 संत काव्य.pdf/37 , 7 4 संत काव्य.pdf/36 , 8 4 संत काव्य.pdf/35 , 9 4 संत काव्य.pdf/34 , 10 4 संत काव्य.pdf/33 , 11 4 संत काव्य.pdf/32 , 12 4 संत काव्य.pdf/31 , 13 4 संत काव्य.pdf/30 , 14 4 संत काव्य.pdf/29 , 15 4 संत काव्य.pdf/28 , 16 4 संत काव्य.pdf/27 , 17 4 संत काव्य.pdf/26 , 18 4 संत काव्य.pdf/25 , 19 4 संत काव्य.pdf/24 , 20 4 संत काव्य.pdf/23 , 21 4 संत काव्य.pdf/22 , 22 4 संत काव्य.pdf/20 , 23 4 संत काव्य.pdf/19 , 24 4 संत काव्य.pdf/18 , 25 4 संत काव्य.pdf/17

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Wednesday December 12, 2018 22:34

Dump file sourceswiki-20181201-stub-meta-history.xml.gz (edits only), size 20 Mb as gz -> 169 Mb
Dump processed till Nov 30, 2018, on server stat1007, ready at Tue-04/12/2018-10:22 after 1 min, 28 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.