Estatísticas da Wikispecial strategic planning

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings: agosto 2012
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
Apr 2012+1%   0%   +46%0%0%    0%
Mar 20120%   0%   +148%0%0%    0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
Aug 2012 ± 286      ± 14,8 ± 5 ± 24 ± 20 kb      ± 588
Aug 30, 2012286   2,5 k 14,852320 kb2,5 k    588
Jul 2012286   2,5 k 14,85920 kb2,5 k    587
Jun 2012286   2,5 k 14,852220 kb2,5 k    587
May 2012286   2,5 k 14,85420 kb2,5 k    587
Apr 201228624 2,5 k 14,857620 kb2,5 k    587
Mar 201228412 2,5 k 14,855220 kb2,5 k    585
Feb 2012283   2,5 k 14,852120 kb2,5 k    585
Jan 2012283   2,5 k 14,85920 kb2,5 k    584
Dec 2011283 2 2,5 k 14,852720 kb2,5 k    584
Nov 2011283 1 2,5 k 14,853120 kb2,5 k    583
Oct 201128336 2,5 k 14,8511220 kb2,5 k    583
Sep 2011280 2 2,5 k 14,753720 kb2,5 k    583
Aug 201128014 2,5 k 14,757720 kb2,5 k    581
Jul 2011279 1 2,5 k 14,755120 kb2,5 k    581
Jun 201127924 2,5 k 14,759420 kb2,5 k    580
May 20112771029 2,4 k214,7572420 kb2,4 k    578
Apr 2011267211 2,4 k 14,7533520 kb2,4 k    576
Mar 20112652655 2,4 k114,651,2 k19 kb2,4 k    570
Feb 201123935 2,3 k114,4524319 kb2,3 k    567
Jan 201123617 2,3 k 14,4514919 kb2,3 k    567
Dec 201023523 2,3 k 14,459319 kb2,3 k    564
Nov 201023341212,3 k 14,4546319 kb2,3 k    561
Oct 201022928 2,3 k 14,2529619 kb2,3 k    560
Sep 201022713 2,3 k 14,156619 kb2,3 k    556
Aug 201022617 2,3 k 14,1516219 kb2,3 k    554
Jul 2010225102912,3 k214,1589219 kb2,3 k    551
Jun 201021521722,2 k11452,5 k18 kb2,2 k    524
May 201021341112,2 k113,1545718 kb2,2 k    496
Apr 201020911122,2 k11351,3 k17 kb2,2 k    493
Mar 201020831222,1 k112,7549415 kb2,1 k    336
Feb 201020561312,1 k212,6563215 kb2,1 k    327
Jan 201019994852,0 k512,752,7 k14 kb2,0 k    324
Dec 2009190134351,9 k512,251,9 k13 kb1,9 k    277
Nov 2009177204141,7 k912,352,8 k12 kb1,7 k    256
Oct 2009157196291,5 k912,754,5 k9,4 kb1,5 k    171
Sep 20091385814991,2 k1411,755,7 k7,0 kb1,2 k    87
Aug 20098057120127572210,956,4 k4,3 kb757    41
Jul 2009231013164229,45449390 64    5
Jun 200913   4 35851120 4     
May 2009131  4 355,252920 4     
Apr 200912   4 34851820 4     
Mar 2009121  4 343,552120 4     
Feb 200911   4 338,252220 4     
Jan 200911   4 332,852720 4     
Dec 200811   4 32652120 4     
Nov 200811   4 320,851620 4     
Oct 200811   4 316,851520 4     
Sep 200811   4 31351620 4     
Aug 200811   4 3095420 4     
Jul 200811   4 30852120 4     
Jun 200811   4 302,851920 4     
May 2008111  4 29854020 4     
Apr 200810   4 28853320 4     
Mar 200810   4 279,855320 4     
Feb 200810   4 266,554420 4     
Jan 200810   4 255,552220 4     
Dec 200710 1 4 25053520 4     
Nov 200710   4 241,253020 4     
Oct 20071012 4 233,856320 4     
Sep 20079   4 21853220 4     
Aug 2007912 4 21052820 4     
Jul 20078   4 20357620 4     
Jun 2007812 4 18455820 4     
May 20077 1 4 169,554220 4     
Apr 2007711 4 15956720 4     
Mar 20076 1 4 142,253220 4     
Feb 20076   4 134,251720 4     
Jan 200761  4 13053720 4     
Dec 20065   4 120,852520 4     
Nov 200651  4 114,552320 4     
Oct 2006412 4 108,855020 4     
Sep 20063 1 4 96,252920 4     
Aug 20063   4 8952020 4     
Jul 20063   4 8451120 4     
Jun 20063   4 81,253120 4     
May 20063   4 73,551520 4     
Apr 20063   4 69,851820 4     
Mar 20063   4 65,251820 4     
Feb 20063   4 60,852320 4     
Jan 20063   4 5551920 4     
Dec 20053   4 50,251020 4     
Nov 20053   4 47,851320 4     
Oct 2005311 4 44,552220 4     
Sep 20052   4 3951220 4     
Aug 20052   4 365120 4     
Jul 20052   4 35,852920 4     
Jun 20052   3 3851515 3     
May 2005211 3 3351615 3     
Apr 20051   3 27,75915 3     
Mar 20051   2 375210 2     
Feb 20051   2 365610 2     
Jan 20051   2 335810 2     
Dec 20041   2 295110 2     
Nov 20041   2 28,55 10 2     
Oct 20041   2 28,55110 2     
Sep 20041   2 285210 2     
Aug 20041   2 275610 2     
Jul 20041   2 245310 2     
Jun 20041   2 22,55310 2     
May 20041   2 215810 2     
Apr 20041   2 175410 2     
Mar 20041   2 155310 2     
Feb 20041   2 13,55410 2     
Jan 20041   2 11,55310 2     
Dec 20031   1 20511     
Nov 20031   1 19511     
Oct 20031   1 18521     
Sep 20031   1 165 1     
Aug 20031   1 16531     
Jul 20031   1 135 1     
Jun 20031   1 135 1     
May 20031   1 135 1     
Apr 20031   1 135 1     
Mar 20031   1 13511     
Feb 20031   1 125 1     
Jan 20031   1 125 1     
Dec 20021   1 125 1     
Nov 20021   1 125 1     
Oct 20021   1 12541     
Sep 20021   1 85 1     
Aug 20021   1 8541     
Jul 20021   1 45 1     
Jun 20021   1 45 1     
May 20021   1 4511     
Apr 20021   1 3511     
Mar 20021   1 25 1     
Feb 20021   1 2511     
Jan 20021   1 15 1     
Dec 20011   1 15 1     
Nov 20011   1 15 1     
Oct 200111  1 1511     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  250  5  10 
Aug 30, 201281     42111      911      
Jul 20123      51111      182       
Jun 20126      51111      1941      
May 20121      51111      194       
Apr 201217642    3111       83       
Mar 201214221    821        18741   1 
Feb 201212      42111      195       
Jan 20126      41111      152       
Dec 2011522     41111      156       
Nov 20118111    82111      16741     
Oct 20112010631   92111      2610722    
Sep 20111022     521        241341     
Aug 20111674     102         30752     
Jul 20111331     7211       26621     
Jun 201125842    15311       431384     
May 20111434329123   4912943      2538752288    
Apr 201164201161   11111       7223154     
Mar 20111868155247   65178741     2771086232112   
Feb 20113711553   15311       4614911    
Jan 20112411731   121         341121     
Dec 2010225321   711        36116      
Nov 2010372012531   15531       4120124     
Oct 20102711863   1852        47241363    
Sep 201023531    1251        251042     
Aug 20103711731   20543       56221072    
Jul 20109842291561   64211254      16265362191   
Jun 2010582717127211 368642      8042312281   
May 2010631611931   298432      12149281972   
Apr 20103214118521  238511      6322151171   
Mar 2010412012842   236531      743219144    
Feb 2010843113841   65231962      101614125811  
Jan 20101346448271252  119512314721    1646747271741  
Jul 20123      51111      182       
Apr 201217642    3111       83       
Jan 20126      41111      152       
Oct 20112010631   92111      2610722    
Jul 20111331     7211       26621     
Apr 201164201161   11111       7223154     
Jan 20112411731   121         341121     
Oct 20102711863   1852        47241363    
Jul 20109842291561   64211254      16265362191   
Apr 20103214118521  238511      6322151171   
Jan 20101346448271252  119512314721    1646747271741  
Oct 200918489624122931 2068559451532111114663482683111
Jul 2009531813921   2810532      66171052    
Apr 20096                 2        
Jan 2009121                3211     
Oct 20086                 21111    
Jul 20088                 4111     
Apr 200882                7211     
Jan 200813                 2        
Oct 200716521               22       
Jul 200723                 2        
Apr 200716411                        
Jan 2007142                3        
Oct 2006922                421      
Jul 20064                 1        
Apr 2006122                41       
Jan 2006101                2        
Oct 20053111               2        
Jul 2005111                         
Apr 20055                          
Jan 20054                          
Oct 20041                          
Jul 20043                          
Apr 20043                          
Jan 20043                          
Oct 20031                          
Jul 2003                           
Apr 2003                           
Jan 2003                           
Oct 20022                          
Jul 2002                           
Apr 20021                          
Jan 2002                           
Oct 20011                          

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
11,848100.0%32,114100.0%
358131.4%30,24294.2%
1028915.6%28,51988.8%
321095.9%25,60779.7%
100432.3%22,19069.1%
316140.8%16,91352.7%
100030.2%11,31935.2%
316220.1%10,16331.6%

 

8 autores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Rodrigo Tetsuo ArgentonUC26 01971215-Aug 06, 2009111911---
Hoo manUC126+526278-Aug 27, 200910981---
BennylinUC284+201015-Jan 26, 20109461---
Helder.wikiUC331+76825212Sep 09, 200910851---
Mikael HäggströmUC493+208527-May 08, 20108441---
AvocatoUC741...33--Aug 27, 20122----
ItuUC969+7262111Jan 26, 2011581----
Peter.CUC1024+81121--Apr 01, 2012150----

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Philippe (WMF)UC16,664Jul 23, 20091133Jun 05, 201285
HenkvDUC23,499Aug 14, 20091111May 20, 2011467
EekimUC31,156Jul 24, 20091132Mar 26, 2011522
Verdy pUC4822Aug 21, 20091104Oct 02, 2010697
Nemo bisUC5820Jul 30, 20091126Jul 27, 201233
JohnFUC6556Aug 13, 20091112Jan 11, 2010961
FastenUC7520Oct 09, 20091055Apr 16, 2011501
BryaUC8503Aug 28, 20091097May 27, 2011460
SeritaUC9461Aug 13, 20091112Oct 13, 20091051
RandomranUC10455Oct 29, 20091035Feb 22, 2011554
GoldzahnUC11407Jul 27, 20091129Mar 16, 2011532
Laura231UC12392Aug 19, 20091106Jul 14, 2010777
WereSpielChequersUC13338Aug 09, 20091116Apr 03, 2012148
ManipandeUC14320Oct 25, 2010674Nov 08, 2011295
Dafer45UC15308Oct 31, 20091033Oct 26, 2010673
MwpnlUC16300Aug 13, 20091112Jan 02, 2010970
KozuchUC17290Feb 12, 20091294Oct 06, 2011328
DedalusUC18286Aug 08, 20091117Jan 27, 2010945
TylerTUC19260Aug 12, 20091113Jan 29, 2010943
AudriusaUC20252Aug 15, 20091110Jul 09, 2010782

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
75.55.199.5116
99.56.136.133112
211.129.158.6762
99.113.32.4461
99.60.1.16452
221.191.22.3952
79.94.111.15551
221.190.250.25447
216.38.130.16646
66.92.12.11045

No total 4.498 edições foram feitas por usuários anônimos, de um total de 36.632 edições ( 12e %)
  


1 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
SmackBotUC112Mar 17, 20062357Dec 23, 2009980--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgOggPdfPngSvgXcf
Aug 30, 20122,1 k1,5 k1252627758373416   1,0 k  1312213719821
Jul 20122,1 k1,5 k1252627758373416   1,0 k  312213719821
Jun 20122,1 k1,5 k1252627758373415   1,0 k  712213719821
May 20122,1 k1,5 k1252627758373415   1,0 k  112213719821
Apr 20122,1 k1,4 k1252627748363415   1,0 k  6512213719821
Mar 20122,1 k1,4 k1252627738363415   1,0 k  4112213719821
Jul 20122,1 k1,5 k1252627758373416   1,0 k  312213719821
Apr 20122,1 k1,4 k1252627748363415   1,0 k  6512213719821
Jan 20122,1 k1,4 k1252627738353415   1,0 k  612213719821
Oct 20112,1 k1,4 k1252627728353414   1,0 k  10512213719821
Jul 20112,1 k1,4 k1252627638253414   1,0 k  3312213719821
Apr 20112,1 k1,3 k1252617608073412   991  24212213719811
Jan 20112,0 k1,1 k1252606277833402   982  12912213619811
Oct 20101,9 k1,1 k1242476277673402   973  23811113519711
Jul 20101,9 k1,0 k1232466007343397   965  84111113519611
Apr 20101,8 k920902275776523393   897  1297191351801 
Jan 20101,6 k843122155596053374   875  2546191331701 
Oct 200981867361374783932306   819  4259 71261021 
Jul 2009646622470117   13  428    11 
Apr 20091    30                
Jan 20091    24                
Oct 20081    24                
Jul 20081    23                
Apr 20081    19                
Jan 20081    10                
Oct 20071    8                
Jul 20071    8                
Apr 20071    7                
Jan 20071    5                
Oct 20061    4                
Jul 20061    2                
Apr 20061    1                
Jan 20061                     
Oct 20051                     
Jul 20051                     
Apr 20051                     
Jan 20051                     
Oct 20041                     
Jul 20041                     
Apr 20041                     
Jan 20041                     
Oct 20031                     
Jul 20031                     
Apr 20031                     
Jan 20031                     
Oct 20021                     
Jul 20021                     
Apr 20021                     
Jan 20021                     
Oct 20011                     

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Oct 2001: 1 1 Case studies/International Olympic Committee

Feb 2002: 1 1 Case studies/International Olympic Committee

Apr 2002: 1 1 Case studies/International Olympic Committee

May 2002: 1 1 Case studies/International Olympic Committee

Aug 2002: 1 2 Case studies/International Olympic Committee

Oct 2002: 1 2 Case studies/International Olympic Committee

Oct 2003: 1 1 Case studies/International Olympic Committee

Nov 2003: 1 1 Case studies/International Olympic Committee

Dec 2003: 1 1 Case studies/International Olympic Committee

Jan 2004: 1 2 Case studies/International Olympic Committee

Feb 2004: 1 3 Case studies/International Olympic Committee

Mar 2004: 1 1 Case studies/International Olympic Committee

Apr 2004: 1 3 Case studies/International Olympic Committee

May 2004: 1 5 Case studies/International Olympic Committee

Jun 2004: 1 2 Case studies/International Olympic Committee

Jul 2004: 1 2 Case studies/International Olympic Committee

Aug 2004: 1 3 Case studies/International Olympic Committee

Sep 2004: 1 2 Case studies/International Olympic Committee

Oct 2004: 1 1 Case studies/International Olympic Committee

Jan 2005: 1 3 Case studies/Save the Children , 2 1 Case studies/International Olympic Committee

Feb 2005: 1 2 Case studies/International Olympic Committee

Mar 2005: 1 1 Case studies/International Olympic Committee

Apr 2005: 1 4 Case studies/International Olympic Committee

May 2005: 1 2 Case studies/ONE Campaign , 2 1 Case studies/International Olympic Committee

Jun 2005: 1 3 Case studies/ONE Campaign , 2 1 Case studies/International Olympic Committee

Jul 2005: 1 4 Case studies/International Olympic Committee

Sep 2005: 1 1 Case studies/International Olympic Committee

Oct 2005: 1 2 Case studies/International Olympic Committee

Nov 2005: 1 3 Case studies/Save the Children , 2 1 Case studies/International Olympic Committee

Dec 2005: 1 2 Case studies/International Olympic Committee , 2 2 Case studies/Save the Children

Jan 2006: 1 6 Case studies/International Olympic Committee , 2 3 Case studies/Save the Children

Feb 2006: 1 11 Case studies/International Olympic Committee

Mar 2006: 1 2 Case studies/ONE Campaign , 2 1 Case studies/International Olympic Committee

Apr 2006: 1 4 Case studies/ONE Campaign , 2 3 Case studies/International Olympic Committee

May 2006: 1 4 Case studies/WikiHow

Jun 2006: 1 6 Case studies/International Olympic Committee

Jul 2006: 1 3 Case studies/International Olympic Committee

Aug 2006: 1 6 Case studies/WikiHow , 2 3 Case studies/International Olympic Committee

Sep 2006: 1 5 Case studies/ONE Campaign , 2 2 Case studies/WikiHow , 3 1 Case studies/International Olympic Committee

Oct 2006: 1 5 Case studies/WikiHow , 2 1 Case studies/International Olympic Committee

Nov 2006: 1 6 Case studies/WikiHow , 2 1 Case studies/International Olympic Committee

Dec 2006: 1 2 Case studies/ONE Campaign , 2 1 Case studies/International Olympic Committee

Jan 2007: 1 5 Case studies/ONE Campaign , 2 4 Case studies/International Olympic Committee

Feb 2007: 1 3 Case studies/ONE Campaign , 2 2 Case studies/WikiHow , 3 1 Case studies/International Olympic Committee

Mar 2007: 1 4 Case studies/WikiHow , 2 3 Case studies/Save the Children , 3 2 Case studies/International Olympic Committee

Apr 2007: 1 6 Case studies/ONE Campaign , 2 4 Case studies/International Olympic Committee

May 2007: 1 6 Case studies/International Olympic Committee , 2 5 Case studies/WikiHow

Jun 2007: 1 8 Case studies/ONE Campaign , 2 6 Case studies/International Olympic Committee

Jul 2007: 1 13 Case studies/International Olympic Committee

Aug 2007: 1 4 Case studies/ONE Campaign , 2 2 Case studies/WikiHow , 3 1 Case studies/International Olympic Committee

Sep 2007: 1 7 Case studies/WikiHow , 2 1 Case studies/International Olympic Committee

Oct 2007: 1 8 Case studies/WikiHow , 2 4 Case studies/International Olympic Committee

Nov 2007: 1 5 Case studies/WikiHow , 2 1 Case studies/International Olympic Committee

Dec 2007: 1 4 Case studies/International Olympic Committee , 2 4 Case studies/Save the Children , 3 3 Case studies/ONE Campaign

Jan 2008: 1 4 Case studies/WikiHow , 2 3 Case studies/International Olympic Committee

Feb 2008: 1 8 Case studies/Save the Children , 2 5 Case studies/International Olympic Committee

Mar 2008: 1 8 Case studies/WikiHow , 2 5 Case studies/International Olympic Committee

Apr 2008: 1 6 Case studies/WikiHow , 2 2 Case studies/International Olympic Committee

May 2008: 1 6 Case studies/WikiHow , 2 6 Case studies/Save the Children

Jun 2008: 1 9 Case studies/Save the Children , 2 1 Case studies/WikiHow

Jul 2008: 1 5 Case studies/WikiHow , 2 2 Case studies/Save the Children

Aug 2008: 1 2 Case studies/WikiHow

Sep 2008: 1 3 Case studies/WikiHow , 2 2 Case studies/Save the Children

Oct 2008: 1 5 Case studies/WikiHow

Nov 2008: 1 6 Case studies/Save the Children , 2 1 Case studies/WikiHow

Dec 2008: 1 7 Case studies/WikiHow

Jan 2009: 1 7 Case studies/WikiHow , 2 3 Case studies/Save the Children

Feb 2009: 1 8 Case studies/WikiHow

Mar 2009: 1 7 Case studies/WikiHow

Apr 2009: 1 3 Case studies/WikiHow , 2 2 Case studies/Save the Children

May 2009: 1 4 Case studies/WikiHow

Jun 2009: 1 4 Case studies/WikiHow

Jul 2009: 1 19 Key questions/en , 2 12 Wikimania 2009/en , 3 10 Village pump/Archive3 , 4 8 Process/Basic questions/en , 5 7 Site issues , 6 5 Purpose and principles/en , 7 4 Frequently asked questions/en , 8 4 Main Page/ms , 9 4 Call for proposals/en , 10 4 Process/Deliverables/en , 11 3 Case studies/Save the Children , 12 3 Main Page/Old , 13 3 Wikiversity , 14 3 Wikimedia stakeholders/en , 15 3 Support African languages , 16 2 Verify image donations (Bilderspenden)/de , 17 2 Process/Call for proposals CentralNotice , 18 2 Community guidelines/ar , 19 1 Case studies/WikiHow

Aug 2009: 1 29 Village pump/Archive3 , 2 25 Key questions/en , 3 21 Wikimania 2009/en , 4 19 Where is Wikimedia now?/en , 5 18 Call for proposals/en , 6 15 Translation/Archive 1 , 7 14 Site issues , 8 12 Quality/en , 9 11 Participation/en , 10 10 Reach/Wikimedia users/en , 11 10 How to participate/en , 12 10 Main Page/en , 13 10 Process/Basic questions/en , 14 9 Process/Administrators/volunteers , 15 9 Events (Ongoing support of community-run events) , 16 9 Call for proposals/de , 17 8 Less anonymity , 18 8 Key questions/question list , 19 8 Translator (Hire a sufficient number of professional translators) , 20 8 Picturebook , 21 8 Attracting and retaining participants/en , 22 8 Integration across languages and WMF projects , 23 8 Hosts/List , 24 8 Distributed backup of Wikimedia content , 25 8 Audio offerings

Sep 2009: 1 49 Village pump/Archive3 , 2 17 Emerging strategic priorities/en , 3 17 Key questions/question list , 4 15 Call for participation/Appeal letter/en , 5 10 Call for participation/Appeal letter/de , 6 10 Translation/Archive 1 , 7 10 Call for proposals/en , 8 9 Call for participation/Appeal letter/zh-hant , 9 9 Call for participation/Appeal letter/pt , 10 9 Call for participation/Appeal letter/nl , 11 8 Call for participation/Appeal letter/ja , 12 8 Call for participation/Appeal letter/pl , 13 8 Call for participation/Appeal letter/es , 14 8 Call for participation/Appeal letter/hu , 15 8 Call for participation/Appeal letter/fr , 16 8 Task forces , 17 8 Meetups , 18 7 Task Force Selection Committee/en , 19 7 Call for participation/Appeal letter/cs , 20 7 Call for participation/Appeal letter/ru , 21 7 Call for participation/Appeal letter/ar , 22 7 Call for participation/Appeal letter/ko , 23 7 Call for participation/Task force application/en , 24 7 Main Page/en , 25 7 Hosts/List

Oct 2009: 1 22 Village pump/Archive3 , 2 14 Task force/Community Health , 3 13 Emerging strategic priorities/en , 4 12 Task force/China , 5 11 Key questions/question list , 6 10 Task force/Reader Conversion , 7 9 Task force/Local language projects , 8 9 Emerging strategic priorities/ESP 1 key questions , 9 9 Expand reach within midsize and under-connected populations/en , 10 9 Optimize Wikimedia's operations/en , 11 8 Questions that need answers/en , 12 8 Task force/Alliances and Partnerships , 13 8 Task force/Expanding Content , 14 8 Task force/India , 15 8 Meetups , 16 7 Task force/Technology , 17 7 Task force/Increase contribution from groups with high potential to add value task force , 18 7 Strengthen the community/en , 19 7 Main Page/en , 20 6 Task force/Wikipedia Quality , 21 6 Task force/Movement Roles , 22 6 Task force/Offline , 23 6 Task force/Arabic , 24 6 Expand reach within large, well-connected populations/en , 25 5 Task force/en

Nov 2009: 1 18 Question of the day 2009-11-14 , 2 14 Question of the week/Archives/2009-11-14 , 3 14 Task force/India , 4 10 Task force/Arabic , 5 9 Task force/Wikipedia Quality , 6 9 Task force/China , 7 8 Task force/Community Health/Weekly Report 02 , 8 8 Task force/Community Health/resources , 9 8 Task force/Financial Sustainability , 10 8 Task force/Offline , 11 7 Question of the week/Archives/2009-11-23 , 12 7 Meetups/Chapters (November 2009) , 13 7 Task force/Alliances and Partnerships , 14 7 Task force/Expanding Content , 15 7 Task force/Community Health , 16 6 Task force/Community Health/Weekly Report 04 , 17 6 Task force/Community Health/Weekly Report 03 , 18 6 Task force/Recommendations/China , 19 6 Task force/Community Health/Weekly Report 01 , 20 6 Task force/en , 21 6 Task force/Advocacy Agenda , 22 6 Task force/Local language projects , 23 6 Interviews , 24 5 Task force/Alliances and Partnerships/Weekly Report 01 , 25 5 Task force/Offline/IRC

Dec 2009: 1 16 Wikimedia chapters/en , 2 11 Case studies/WikiHow , 3 7 Wikimedia chapters/Activities/en , 4 7 Story of Wikimedia Editors , 5 7 Task force/Community Health/Former contributors survey , 6 7 Interviews , 7 6 Question of the week/Archives/2009-12-07 , 8 6 Task force/Wikipedia Quality/Barriers to quality , 9 6 Task force/Community Health/Weekly Report 05 , 10 6 Task force/Offline/IRC , 11 5 Localisation , 12 5 Task force/Community Health/Recommendation evaluation , 13 5 Task force/Movement Roles/Additional Structures Rough Work , 14 5 Task force/Community Health/Weekly Report 07 , 15 5 Question of the week/Archives , 16 5 Task force/Recommendations/Community health 1 , 17 5 Task force/en , 18 5 Task force/Wikipedia Quality , 19 5 Task force/Financial Sustainability , 20 5 Task force/Offline , 21 4 Case studies/ONE Campaign , 22 4 Question of the week/Archives/2009-12-14 , 23 4 Wikimedia movement/Organizational structure , 24 4 Case studies/Fan History , 25 4 Question of the week/Archives/2009-11-30

Jan 2010: 1 16 Hosts/List , 2 11 Wiktionary , 3 10 Wikimedia chapters/Activities/en , 4 9 Task force/Recommendations/en , 5 7 Strategic Plan/2010-2015 WMF Business Plan Draft/en , 6 7 Task force/Recommendations/Wikipedia Quality , 7 7 Task force/Recommendations/China , 8 6 Task force/Recommendations/Community health 4 , 9 6 Task force/Recommendations/Financial sustainability 2 , 10 6 Interviews , 11 6 Main Page/en , 12 5 Financial sustainability/sv , 13 5 Task force/Recommendations , 14 5 Task force/Local language projects/Outreach , 15 5 Regional bandwidth , 16 5 Case studies/WikiHow , 17 5 Task force/Recommendations/Financial sustainability 3 , 18 5 Task force/Recommendations/Financial sustainability 1 , 19 5 Task force/Recommendations/Offline 2 , 20 5 Task force/Recommendations/Offline 1 , 21 5 Wikimedia-pedia/en , 22 5 Task force/en , 23 4 Wikimedia Foundation/Feb 2010 Letter to the Board , 24 4 Translation , 25 4 About strategy task forces

Feb 2010: 1 24 Task force/Strategy , 2 7 Interviews/Requests , 3 5 Easier categorisation , 4 5 Task force/Living People/Drafting pages/Recommendations to the Board of Trustees/Findings outline , 5 5 Case studies/Save the Children , 6 4 Task force/NASA Collaboration , 7 4 Task force/Living People/Internet relay chat meetings/02.15.2010 , 8 4 Task force/Recommendations/en , 9 4 Task force/en , 10 3 Task force/Living People/Drafting pages/Recommendations to the Board of Trustees/Draft , 11 3 Task force/NASA Collaboration/OpenNASA/emailtojimbo , 12 3 Task force/Living People/IRC Agendas , 13 3 Thematic Chapters/es , 14 3 Task force/Strategy/I believe , 15 3 Task force/Living People/Internet relay chat meetings , 16 3 Task force/Living People/Internet relay chat meetings/02.08.2010 , 17 3 Task force/Living People/Minutes , 18 3 Task force/Living People/Quotations , 19 3 Task force/Living People , 20 3 Case studies/WikiHow , 21 3 Task force/Recommendations/Advocacy , 22 3 Task force/Recommendations/Local Language , 23 2 Volunteer Action Manual , 24 2 Former Contributors Survey Results , 25 2 Task force/Community Health/Former Contributors Survey Results

Mar 2010: 1 8 List of things that need to be free , 2 7 Task force/Analytics/Requirements , 3 6 Task force/Analytics , 4 6 Task force/Living People/Drafting pages/Recommendations to the Board of Trustees/Draft , 5 4 IRC office hours/2010-03-16 , 6 4 Task force/Living People/Drafting pages/Recommendations to the Board of Trustees/Findings outline , 7 4 Task force/en , 8 3 Training , 9 3 Wikimania 2010 , 10 3 Task force/Strategy/What we agree on , 11 3 Task force/Living People/Internet relay chat meetings/03.08.2010 , 12 3 IRC office hours/2010-03-09 , 13 3 Task force/Strategy/Plan overview , 14 3 IRC office hours/2010-03-02 , 15 3 Task force/Living People/Drafting pages/Living People Policy , 16 3 IRC office hours/en , 17 2 Task force/Strategy/Goal guidelines , 18 2 Task force/Living People/Drafting pages/Recommendations to the Board of Trustees/Draft 2 , 19 2 Task force/Content scope , 20 2 IRC office hours/2010-03-23 , 21 2 Advocacy agendas , 22 2 Strategic Plan/Movement Priorities/Theory of Change (Virtuous Circle)

Apr 2010: 1 8 List of things that need to be free , 2 7 Task force/Content scope/Project policy draft , 3 7 Task force/Content scope , 4 4 Strategic Plan/Movement Priorities , 5 3 Piwik , 6 3 Task force/Content scope/What Wikimedia is , 7 2 Wikimedia chapters/Members of chapters vs unaffiliated volunteer contributors , 8 2 Process/Evaluation/Deliverables/fr , 9 2 Process/Evaluation/Deliverables , 10 2 Process/Evaluation/Process/fr , 11 2 Process/Evaluation/Process , 12 2 Process/Evaluation/Community engagement/fr , 13 2 Process/Evaluation/Community engagement , 14 2 Proposal evaluation , 15 2 Case studies/Baidu and Hudong/Google SEO , 16 2 Case studies/Baidu and Hudong/Questionnaire on comparison , 17 2 Case studies/Baidu and Hudong/Questionnaire on comparison/en , 18 2 Case studies/Baidu and Hudong/Google SEO/en , 19 2 Task force/Content scope/Project costs , 20 2 Call for action/en , 21 2 Task force/Strategy/Goal guidelines , 22 2 Task force/Strategy/What we agree on , 23 2 Task force/Analytics/Requirements , 24 2 Task force/Living People/Drafting pages/Recommendations to the Board of Trustees/Draft , 25 2 Former Contributors Survey Results

May 2010: 1 24 Strategic Plan/Movement Priorities , 2 4 Task force/Community Health/Former administrators survey , 3 4 Task force/Content scope , 4 3 Task force/Community Health/Implementation , 5 3 Wikimania 2010 , 6 2 Wikipedia Junior , 7 2 IRC office hours/2010-05-25 , 8 2 Process/Activating volunteers , 9 2 Provide services to facilitate \"child-safe\" and selective mirror sites , 10 2 Conversion design , 11 2 Task force/Content scope/Project policy draft , 12 2 Strategic Plan/What do we believe?-Principles of the Wikimedia movement , 13 2 Task force/Analytics , 14 2 Task force/Living People/Drafting pages/Living People Policy , 15 2 Task force/Recommendations , 16 2 Task force/Recommendations/en , 17 2 Wikimedia-pedia/en , 18 2 Wikimedia-pedia , 19 2 Wikiversity assistant teacher program laboratory school

Jun 2010: 1 13 Strategic Plan/Movement Priorities , 2 8 Strategic Plan/What do we believe?-Principles of the Wikimedia movement , 3 5 Call for action/es , 4 5 Strategic Plan/Background and Context/en , 5 4 Task force/Community Health/Former administrators survey , 6 4 A central wiki for interlanguage links , 7 4 Expert review , 8 3 Call for action/bg , 9 3 Call for action/de , 10 3 Call for action/fr , 11 3 Strategic Plan/Role of the WMF , 12 3 Provide services to facilitate \"child-safe\" and selective mirror sites , 13 3 Call for action/en , 14 3 Strategic Plan/2010-2015 WMF Business Plan Draft , 15 3 More multi dialect wikis , 16 3 Better View History , 17 3 Brand name consolidation , 18 3 A \"be bold\" campaign , 19 3 Process/Administrators/volunteers , 20 2 Africa/fr , 21 2 Study administrative contributions , 22 2 Call for action/it , 23 2 Call for action/be-tarask , 24 2 Strategic Plan/Movement Initiatives Helping to Grow the Movement and the Projects , 25 2 Call for action/sv

Jul 2010: 1 13 Expert review , 2 9 A central wiki for interlanguage links , 3 7 Process/Celebration , 4 7 List of things that need to be free , 5 7 Strategic Plan/Movement Priorities , 6 7 Process/Administrators/volunteers , 7 6 A \"be bold\" campaign , 8 4 Strategic Plan/Role of the WMF , 9 4 Strategic Plan/What do we believe?-Principles of the Wikimedia movement , 10 4 Run an annual prize for best featured content , 11 4 Process/Administrators , 12 3 Discussion Interface Study , 13 3 Call for action , 14 3 Call for action/vi , 15 3 Call for action/it , 16 3 Call for action/fr , 17 3 Editor awards and rewards , 18 3 Strategic Plan/Background and Context/en , 19 3 More multi dialect wikis , 20 3 Main Page/de , 21 2 Accessibility initiative , 22 2 Call for action/zh-hant , 23 2 Call for action/af , 24 2 Call for action/ca , 25 2 Call for action/id

Aug 2010: 1 4 Strategic Plan/Movement Priorities , 2 3 Using a comments namespace on Wikipedia , 3 3 Free Translation Memory , 4 3 Wikimedia-pedia , 5 2 Sponsor development of automated and assisted tools for combating vandalism , 6 2 Wikipedia Fundraising Strategy (small donations) , 7 2 Strategic Plan/What do we believe?-Principles of the Wikimedia movement , 8 2 Former Contributors Survey Results , 9 2 Wikimedia penetration

Sep 2010: 1 5 SEO Market and Contributor Funnel , 2 3 Offline Wikipedia , 3 2 SEO Magnet and Contributor Funnell , 4 1 Merge with the Khan Academy

Oct 2010: 1 6 Mobile , 2 5 Editor Trends Study , 3 5 Offline/Target Market , 4 5 Offline , 5 4 Offline/Product , 6 2 Editor Trends Study/Progress , 7 2 Selective sponsorship , 8 1 Wikilytics

Nov 2010: 1 4 Mobile , 2 4 Offline/Offline Wikimedia projects , 3 4 Offline Wikipedia , 4 3 Mobile/Forecasts/India , 5 3 Mobile/Forecasts , 6 3 Wikilytics , 7 3 Editor Trends Study , 8 3 Offline/Product , 9 3 Offline/List of Offline Wikimedia projects , 10 1 Improve CommonsHelper

Dec 2010: 1 2 Global South , 2 2 Editor Trends Study , 3 2 Offline/Offline Wikimedia projects , 4 2 Wiki-assisted University and School , 5 1 Outreech directed at senior citizens

Jan 2011: 1 6 Task force/Analytics/Feature prioritization , 2 2 Product Whitepaper , 3 2 Wikilytics , 4 2 Main Page , 5 2 Expert review , 6 1 Oral citations

Feb 2011: 1 5 Wikimedia Movement Strategic Plan Summary , 2 5 Product Whitepaper , 3 4 Wikimedia Movement Strategic Plan Summary/Summary , 4 4 Wikimedia Movement Strategic Plan Summary/The Resources We'll Need , 5 4 Wikimedia Movement Strategic Plan Summary/Increase Reach , 6 4 Wikimedia Movement Strategic Plan Summary/Increase Participation , 7 4 Wikimedia Movement Strategic Plan Summary/The Opportunity , 8 4 Task force/Analytics/Feature prioritization , 9 3 Wikimedia Movement Strategic Plan Summary/Acknowledgements , 10 3 Wikimedia Movement Strategic Plan Summary/The Role of the Wikimedia Chapters

Mar 2011: 1 19 March 2011 Update/de , 2 19 Editor Trends Study , 3 18 Translation/Sidebar , 4 15 March 2011 Update/es , 5 15 March 2011 Update/fr , 6 14 March 2011 Update/ru , 7 11 March 2011 Update/pt , 8 10 March 2011 Update/nl , 9 9 March 2011 Update , 10 9 March 2011 Update/it , 11 8 Product Whitepaper , 12 7 Editor Trends Study/Results , 13 7 Editor survey feedback , 14 6 Process/Administrators/done , 15 6 Process/Administrators/volunteers , 16 5 March 2011 Update/uk , 17 5 Wikilytics , 18 5 Process , 19 4 March 2011 Update/zh-hans , 20 4 March 2011 Update/zh-hant , 21 4 March 2011 Update/vi , 22 4 March 2011 Update/ko , 23 4 Task force/Analytics/Feature prioritization , 24 3 March 2011 Update/cs , 25 3 March 2011 Update/hr

Apr 2011: 1 30 Editor survey feedback , 2 5 Mobile/Research/Quantitative Study , 3 5 Editor survey FAQ , 4 3 Readership survey , 5 3 Openness and Participation , 6 3 March 2011 Update/Reactions , 7 3 Mobile/Research , 8 3 Wiki-assisted University and School , 9 2 March 2011 Update , 10 2 The Identity and Names of Wikipedia Editors

May 2011: 1 10 Openness and Participation , 2 7 May 2011 Update/fr , 3 7 May 2011 Update/ru , 4 7 May 2011 Update/de , 5 6 Process/Administrators/volunteers , 6 5 May 2011 Update/pt , 7 5 May 2011 Update/he , 8 5 Product Whitepaper , 9 5 Editor Trends Study , 10 4 Prevent vandalisation of basic information , 11 4 May 2011 Update/nl , 12 4 May 2011 Update/zh-hant , 13 4 May 2011 Update/es , 14 4 Mobile/Research , 15 4 Process/en , 16 3 Don't \"bite\" campaign , 17 3 Mobile/Research/Qualitative Studies/Brazil CFP , 18 3 May 2011 Update/ta , 19 3 May 2011 Update/ar , 20 3 May 2011 Update/fa , 21 3 May 2011 Update/id , 22 3 May 2011 Update/pl , 23 3 May 2011 Update/el , 24 3 May 2011 Update/it , 25 3 May 2011 Update

Jun 2011: 1 6 Process/Administrators/volunteers , 2 4 Process/Administrators , 3 3 Main Page/en , 4 2 LiveHelp , 5 2 Wikipedia2 , 6 2 Tablet interface , 7 2 May 2011 Update/zh-hans , 8 1 IPad app

Jul 2011: 1 2 Oral citations , 2 2 Change name of operation \"move\" to \"rename\" , 3 1 StickyNotes

Aug 2011: 1 2 StickyNotes , 2 2 Global Development/Brazil , 3 2 Process/Administrators/volunteers , 4 1 MENA Region Catalyst Projects

Sep 2011: 1 3 Main Page/en , 2 2 Implement and deploy checksum revision table , 3 1 StratPlan/Quality

Oct 2011: 1 4 Process/Administrators , 2 3 Spreading Wikinews , 3 3 Process/Administrators/volunteers , 4 2 Search access to help and project , 5 2 Create WikiProject Nanotechnology , 6 2 Identify donors with an icon , 7 2 Delete All Wikimedia Projects , 8 2 Host Wikipedia from Space

Nov 2011: 1 3 Process/Administrators/volunteers , 2 2 Wikiciudades o Wikicities , 3 1 Online Compendium of Pharmaceuticals and Specialties

Dec 2011: 1 1 Departed contributors study

Jan 2012: 1 2 March 2011 Update

Feb 2012: 1 3 Journal (A peer-review journal to allow/encourage academics to write Wikipedia articles) , 2 2 Automatic translation of any article to any language , 3 2 Global Development , 4 1 Alliances and partnerships/es

Mar 2012: 1 6 Journal (A peer-review journal to allow/encourage academics to write Wikipedia articles) , 2 2 Process/Administrators/volunteers , 3 1 SourceIt

Apr 2012: 1 8 Journal (A peer-review journal to allow/encourage academics to write Wikipedia articles) , 2 7 List of things that need to be free , 3 1 Needing free knowledge

May 2012: 1 1 Wikimedia users/bn

Jun 2012: 1 2 Journal (A peer-review journal to allow/encourage academics to write Wikipedia articles) , 2 1 Split-screen edit-preview and edit-form

Jul 2012: 1 1 User pages should work more like social networking sites

Aug 2012: 1 2 Journal (A peer-review journal to allow/encourage academics to write Wikipedia articles) , 2 1 Wikimedia Movement Strategic Plan Summary/Acknowledgements

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Thursday August 30, 2012 22:22 a partir de cópias do banco de dados SQL de Thursday August 30, 2012
Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.