Estatísticas da Wikiversity inglês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataContributorsArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 20180% -7% +1%   -18%      +1%
nov 20180% -65% +1%   -63%      +1%
out 2018+1% +8% +1%   +75%      +1%
set 2018+2% +56% +1%   +35%      0%
ago 2018+1% +127% +1%   -6%      0%
jul 20180% -22% +1%   +4%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201849221057939 k1022,2 3,8 k      11 k
nov 2018491210611238 k1122,3 4,7 k      11 k
out 20184902441723038 k922,4 12 k      11 k
set 20184858881591438 k1422,2 7,1 k      11 k
ago 2018477043102737 k1222,2 5,3 k      11 k
jul 2018472712451037 k1422,3 5,6 k      11 k
jun 2018471511581136 k622,4 5,4 k      11 k
mai 2018470415721036 k822,4 7,5 k      10 k
abr 201846891470736 k622,4 4,6 k      10 k
mar 201846752074836 k622,3 5,9 k      10 k
fev 2018465527821136 k422,3 8,4 k      10 k
jan 2018462812521136 k422,1 6,7 k      10 k
dez 2017461617721035 k522 5,9 k      10 k
nov 2017459918831635 k421,9 4,9 k      10 k
out 20174581411873535 k821,9 13 k      10 k
set 20174540841671535 k1221,7 8,7 k      10,0 k
ago 2017445644115835 k1021,6 7,3 k      9,8 k
jul 2017441219601234 k521,6 9,9 k      9,7 k
jun 201743932482834 k821,4 7,7 k      9,6 k
mai 2017436932851234 k921,4 7,1 k      9,5 k
abr 2017433725681334 k621,3 8,2 k      9,5 k
mar 20174312857933 k421,2 3,9 k      9,1 k
fev 2017430428861033 k821,1 4,4 k      9,1 k
jan 201742761759933 k521,2 3,8 k      9,0 k
dez 2016425925801133 k621,2 4,8 k      8,9 k
nov 2016423419931033 k821,1 5,9 k      8,9 k
out 20164215901534732 k921,1 15 k      8,8 k
set 2016412535851332 k1020,8 7,8 k      8,8 k
ago 201640902257832 k720,8 3,4 k      8,6 k
jul 20164068729832 k620,8 2,6 k      8,6 k
jun 201640611249631 k420,8 3,6 k      8,6 k
mai 201640491851631 k620,8 6,1 k      8,6 k
abr 2016403126591531 k420,7 6,8 k      8,3 k
mar 2016400525871031 k520,6 6,5 k      8,2 k
fev 201639804284831 k520,5 6,5 k      8,0 k
jan 201639382476731 k820,4 8,9 k      8,0 k
dez 20153914721421330 k820,2 6,8 k      7,9 k
nov 20153842411261030 k1120,2 5,5 k      7,8 k
out 201538011552086530 k920,2 22 k      7,7 k
set 2015364633811130 k719,7 8,8 k      7,6 k
ago 201536131545929 k619,5 8,2 k      7,6 k
jul 20153598432629 k519,3 3,9 k      7,4 k
jun 201535941659929 k3319,3 8,4 k      7,2 k
mai 2015357827751328 k619,7 5,4 k      6,3 k
abr 2015355142791128 k919,6 7,1 k      6,2 k
mar 2015350960105928 k619,653595,3 k175 Mb21,4 M72 k2,2 k40 k95 k5,9 k
fev 201534491449327 k519,553452,8 k174 Mb21,2 M71 k2,2 k39 k94 k5,8 k
jan 20153435334427 k319,553232,6 k172 Mb21,0 M70 k2,2 k39 k92 k5,8 k
dez 20143432844527 k319,553123,0 k171 Mb20,8 M69 k2,2 k38 k91 k5,8 k
nov 20143424341001727 k719,453047,3 k170 Mb20,7 M69 k2,2 k38 k90 k5,8 k
out 201433901341855727 k619,3528418 k168 Mb20,5 M68 k2,2 k37 k89 k5,8 k
set 2014325629921027 k718,851706,0 k164 Mb19,9 M68 k2,2 k37 k87 k5,7 k
ago 2014322736951127 k918,751937,3 k163 Mb19,8 M67 k2,2 k36 k86 k5,4 k
jul 201431912058726 k818,651583,9 k160 Mb19,5 M66 k2,2 k36 k85 k5,3 k
jun 20143171644426 k718,751263,5 k157 Mb19,2 M65 k2,2 k35 k82 k5,3 k
mai 201431651685826 k618,751116,1 k155 Mb18,9 M64 k2,2 k35 k80 k5,2 k
abr 2014314921811226 k518,647505,1 k152 Mb17,6 M63 k2,1 k34 k78 k5,1 k
mar 201431283993925 k1118,547136,2 k151 Mb17,3 M63 k2,1 k34 k77 k5,1 k
fev 201430894068925 k818,546895,0 k148 Mb17,1 M62 k2,1 k33 k76 k5,0 k
jan 201430499481125 k718,446565,9 k147 Mb16,8 M61 k2,1 k32 k74 k4,9 k
dez 2013304034861025 k618,346496,7 k145 Mb16,6 M61 k2,1 k31 k73 k4,3 k
nov 20133006591844925 k1518,2463517 k144 Mb16,5 M61 k2,0 k31 k72 k4,0 k
out 20132947681282624 k917,945469,1 k139 Mb15,9 M59 k2,0 k30 k70 k4,0 k
set 201328793171424 k717,745032,8 k137 Mb15,6 M58 k2,0 k29 k68 k3,9 k
ago 201328481963924 k517,744974,2 k135 Mb15,4 M56 k2,0 k29 k66 k3,8 k
jul 201328291240823 k417,744993,2 k134 Mb15,3 M56 k2,0 k28 k65 k3,8 k
jun 20132817431323 k517,644592,1 k133 Mb15,2 M55 k2,0 k28 k65 k3,8 k
mai 201328131266423 k617,644583,2 k133 Mb15,1 M55 k2,0 k28 k64 k3,7 k
abr 2013280158123623 k717,644474,7 k131 Mb14,9 M55 k2,0 k27 k62 k3,7 k
mar 2013274342981223 k1417,643995,7 k129 Mb14,7 M53 k2,0 k27 k61 k3,7 k
fev 2013270155127722 k917,743885,9 k119 Mb14,4 M51 k2,0 k26 k59 k3,7 k
jan 201326461355922 k417,643693,4 k118 Mb14,2 M51 k2,2 k26 k58 k3,5 k
dez 201226332198622 k817,643555,0 k117 Mb14,1 M50 k2,2 k26 k58 k3,5 k
nov 2012261225110622 k817,543494,9 k115 Mb13,9 M50 k2,2 k25 k57 k3,4 k
out 2012258755137621 k717,543345,2 k114 Mb13,7 M50 k2,2 k25 k56 k3,4 k
set 2012253259123821 k917,443335,0 k113 Mb13,6 M49 k2,2 k24 k55 k3,4 k
ago 201224732154521 k417,443122,9 k111 Mb13,4 M48 k2,2 k24 k54 k3,4 k
jul 201224521344521 k917,442802,9 k110 Mb13,2 M47 k2,2 k24 k53 k3,4 k
jun 20122439632821 k417,443233,5 k108 Mb13,1 M47 k2,2 k21 k50 k3,4 k
mai 201224332386720 k417,443094,8 k107 Mb12,9 M46 k2,0 k21 k49 k3,3 k
abr 20122410201151620 k917,242806,8 k106 Mb12,7 M46 k1,9 k20 k47 k3,3 k
mar 2012239060153920 k1117,142596,3 k104 Mb12,5 M45 k1,8 k20 k46 k3,3 k
fev 2012233070156520 k817,142325,6 k101 Mb12,2 M44 k1,8 k19 k44 k3,3 k
jan 2012226049100820 k61742163,7 k100 Mb12,0 M43 k1,8 k19 k43 k3,3 k
dez 201122111980519 k31741512,8 k98 Mb11,8 M42 k1,9 k19 k41 k3,2 k
nov 20112192601722919 k1017411712 k97 Mb11,6 M42 k1,8 k18 k40 k3,2 k
out 20112132501391219 k1016,640447,2 k93 Mb11,2 M41 k1,8 k18 k39 k3,2 k
set 2011208267128819 k1116,540235,1 k90 Mb11,0 M40 k1,8 k17 k37 k3,2 k
ago 201120151959418 k516,540232,7 k89 Mb10,8 M40 k1,8 k17 k37 k3,1 k
jul 201119961448518 k716,540112,5 k88 Mb10,6 M39 k1,7 k17 k36 k3,1 k
jun 20111982946418 k616,540162,3 k87 Mb10,5 M39 k1,6 k17 k36 k3,1 k
mai 201119732392718 k1216,640274,2 k86 Mb10,4 M38 k1,6 k16 k35 k3,1 k
abr 20111950181141117 k1216,740215,2 k85 Mb10,2 M38 k1,5 k16 k34 k3,1 k
mar 20111932451531517 k1716,740218,6 k83 Mb10,0 M37 k1,5 k16 k33 k3,0 k
fev 2011188783161816 k1116,839057,3 k77 Mb9,3 M37 k1,4 k15 k32 k3,0 k
jan 2011180441103816 k1516,638704,8 k75 Mb9,0 M36 k1,4 k15 k31 k2,9 k
dez 201017632189816 k1616,839235,1 k73 Mb8,9 M35 k1,4 k15 k30 k2,9 k
nov 20101742621502415 k617396710 k72 Mb8,7 M35 k1,4 k15 k29 k2,8 k
out 2010168037109615 k716,538215,1 k69 Mb8,3 M35 k1,4 k14 k28 k2,8 k
set 2010164350102515 k816,437754,0 k67 Mb8,1 M34 k1,4 k14 k27 k2,8 k
ago 201015931966315 k1016,437634,2 k66 Mb8,0 M34 k1,4 k13 k26 k2,8 k
jul 201015741366214 k516,537442,5 k65 Mb7,8 M33 k1,4 k13 k26 k2,7 k
jun 201015612461314 k316,537372,7 k64 Mb7,8 M33 k1,4 k13 k26 k2,7 k
mai 201015371860414 k416,437203,5 k63 Mb7,7 M33 k1,3 k13 k25 k2,6 k
abr 201015192683714 k716,336935,6 k62 Mb7,6 M33 k1,3 k13 k25 k2,6 k
mar 201014932477814 k716,236565,4 k61 Mb7,4 M32 k1,3 k13 k24 k2,6 k
fev 201014693981313 k61636156,9 k59 Mb7,1 M31 k1,3 k12 k23 k2,5 k
jan 201014301458313 k415,735912,7 k58 Mb7,0 M30 k1,3 k12 k23 k2,5 k
dez 200914161962513 k415,635774,1 k57 Mb6,9 M29 k1,2 k12 k22 k2,5 k
nov 200913972373213 k515,535564,3 k57 Mb6,8 M29 k1,2 k12 k22 k2,5 k
out 200913741671513 k415,335083,4 k55 Mb6,7 M28 k1,2 k12 k21 k2,5 k
set 200913583593713 k1115,234945,8 k55 Mb6,6 M27 k1,2 k12 k21 k2,4 k
ago 200913232870312 k915,135034,2 k53 Mb6,4 M26 k1,1 k12 k20 k2,4 k
jul 200912951239512 k415,134893,2 k51 Mb6,2 M25 k1,0 k11 k19 k2,3 k
jun 200912832358212 k31535183,0 k51 Mb6,1 M25 k1,4 k11 k18 k2,3 k
mai 200912601961412 k514,934942,9 k50 Mb6,0 M25 k1,2 k11 k20 k2,3 k
abr 2009124164112312 k514,834664,3 k49 Mb5,9 M24 k1,2 k10 k20 k2,3 k
mar 200911771756312 k414,634162,6 k48 Mb5,8 M24 k1,1 k10 k19 k2,3 k
fev 200911601971812 k814,634133,9 k47 Mb5,7 M23 k1,1 k10 k19 k2,3 k
jan 2009114123761011 k1114,533814,4 k46 Mb5,5 M23 k1,1 k10 k18 k2,2 k
dez 200811181956611 k514,533573,7 k45 Mb5,3 M23 k1,1 k9,9 k18 k2,2 k
nov 200810993475911 k714,433115,0 k44 Mb5,2 M22 k1,1 k9,9 k18 k2,1 k
out 200810652387711 k814,233125,1 k43 Mb5,1 M22 k1,1 k9,5 k17 k2,1 k
set 2008104235106710 k814,133295,0 k42 Mb5,0 M21 k9779,3 k17 k1,9 k
ago 2008100718621010 k1313,933526,1 k41 Mb4,9 M21 k9719,1 k16 k1,8 k
jul 2008989216999,7 k1013,933635,3 k39 Mb4,7 M20 k9578,9 k15 k1,7 k
jun 20089681659129,4 k1313,833985,9 k39 Mb4,6 M20 k9078,7 k15 k1,6 k
mai 20089521872129,0 k1513,734716,8 k38 Mb4,5 M19 k8598,6 k14 k1,5 k
abr 2008934135210228,5 k2113,6355813 k37 Mb4,4 M19 k7088,4 k14 k1,4 k
mar 200879935116147,9 k1413,135278,1 k34 Mb4,1 M18 k6337,8 k12 k1,3 k
fev 2008764289047,5 k1412,836013,9 k32 Mb3,9 M17 k5627,5 k11 k1,1 k
jan 2008736409487,1 k912,936125,3 k31 Mb3,8 M16 k5557,3 k11 k1,1 k
dez 2007696216666,8 k912,735463,8 k29 Mb3,6 M16 k5367,0 k9,8 k921
nov 20076753711686,5 k912,734625,4 k28 Mb3,4 M15 k5036,7 k9,3 k899
out 200763835110106,2 k1812,432837,4 k26 Mb3,3 M16 k4266,9 k8,9 k859
set 200760352110115,7 k2412,233626,5 k25 Mb3,1 M15 k3706,6 k8,4 k641
ago 2007551368684,9 k2212,736105,2 k23 Mb2,9 M13 k3346,3 k7,8 k566
jul 2007515216944,3 k1313,636703,5 k21 Mb2,6 M12 k3195,8 k7,4 k521
jun 2007494226063,9 k121437213,6 k19 Mb2,5 M10 k3025,3 k6,9 k493
mai 2007472276393,5 k1014,439054,4 k18 Mb2,4 M9,5 k3084,8 k6,6 k457
abr 2007445379783,2 k1014,439945,3 k17 Mb2,1 M7,6 k1794,5 k6,2 k399
mar 20074084510682,9 k91441054,9 k15 Mb2,0 M6,8 k1734,0 k5,5 k329
fev 2007363379492,7 k1313,640694,3 k14 Mb1,8 M6,4 k2213,3 k4,8 k307
jan 2007326429172,3 k1113,841895,4 k13 Mb1,6 M5,7 k2152,7 k4,0 k254
dez 2006284429582,0 k1013,446414,4 k11 Mb1,4 M5,0 k1982,1 k3,2 k216
nov 2006242258061,7 k1013,346923,7 k9,9 Mb1,2 M3,7 k1641,6 k2,6 k175
out 2006217519361,4 k1213,349594,5 k8,7 Mb1,1 M3,2 k1099702,0 k137
set 2006166387011,0 k713,655542,4 k7,4 Mb946 k2,0 k1083831,4 k83
ago 200612829464801614,159672,5 k6,6 Mb827 k1,6 k982921,0 k56
jul 20069928 615 14,380115236,1 Mb725 k1,3 k902407149
jun 200697513 601113,881945565,8 Mb713 k1,2 k832346789
mai 200692717 579 13,384456945,7 Mb702 k1,2 k902166379
abr 2006859201564112,482576795,5 Mb671 k1,1 k792106888
mar 2006761019 538211,884175255,4 Mb654 k1,1 k782006227
fev 2006666141481212,188766415,3 Mb651 k1,1 k751755886
jan 20066017 420112,3100433785,1 Mb644 k1,0 k751235136
dez 2005595111382212,6105556345,1 Mb634 k1,0 k761074756
nov 2005546121329 12,6112444284,9 Mb617 k90698854245
out 200548151317111,8124554064,8 Mb595 k86770853945
set 20054728 297111,2106972153,7 Mb476 k742355813724
ago 2005457101273111,490473732,8 Mb364 k716230763624
jul 2005387151227212,12452766597 kb72 k66020753114
jun 200531915 163112,12240509387 kb45 k60018222294
mai 20052225 126111,62356252278 kb32 k41817161194
abr 20052036 107111,32209205227 kb27 k3391611812
mar 20051745 91 11,11843135172 kb20 k233127572
fev 20051333 81 10,81599118133 kb15 k143126392
jan 20051022 70 10,8163277117 kb14 k135105302
dez 20048 1 62 10,9203268107 kb12 k111105152
nov 20048   59 10,321235696 kb12 k10385152
out 2004821 54 10,220558284 kb12 k10574132
set 2004625 41111,5188113659 kb7,5 k7844111
ago 20044 1 23 14,616475627 kb3,6 k73436 
jul 200441  19 14,715192623 kb3,2 k78516 
jun 20043 1 16 15,818983421 kb3,1 k69815 
mai 2004311 14 15,620313719 kb2,8 k62411 
abr 20042 1 13 1418312614 kb2,1 k592   
mar 20042   12 132088714 kb2,1 k591   
fev 20042 1 11 13,520891714 kb2,1 k591   
jan 20042   10 13,219751211 kb1,7 k311   
dez 2003211 9 13,321562610 kb1,5 k271   
nov 20031 1 8 11,821541410 kb1,5 k251   
out 20031   7 11,4142354,6 kb721201   
set 20031   7 10,71423194,6 kb72120    
ago 20031   7 81057 3,4 kb52323    
jul 20031   7 8105733,4 kb52323    
jun 20031   7 7,6105763,4 kb52323    
mai 20031   6 7,886851,8 kb26817    
abr 20031   6 7812 1,7 kb25112    
mar 20031   6 781211,7 kb25112    
fev 20031   6 6,881221,7 kb25112    
jan 20031   6 6,581271,7 kb25112    
dez 20021   6 5,381241,7 kb25112    
nov 20021   6 4,781241,7 kb25112    
out 20021   5 4,881251,7 kb25112    
set 20021   5 3,882511,7 kb26010    
ago 20021   5 3,6825 1,7 kb26010    
jul 20021   5 3,6825 1,7 kb26010    
jun 20021   5 3,682541,7 kb26010    
mai 20021   4 3,5825 1,7 kb26010    
abr 20021   4 3,582511,7 kb26010    
mar 20021   4 3,2825 1,7 kb26010    
fev 20021   4 3,282571,7 kb26010    
jan 20021   3 2828 1,7 kb26310    
dez 20011   3 282831,7 kb26310    
nov 20011   2 1,574411,5 kb23710    
out 200111  2 174421,5 kb23710    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 20181111222 1      14
jul 20181111222 1      14
abr 20181111223 1      14
jan 20181221223 1      14
out 20171111223 1      14
jul 20171111223 1      14
abr 20171111233 1      14
jan 20171111223 1      14
out 20161111223 1      14
jul 20161111224 2      14
abr 20161211224 2      14
jan 20161113224 1      14
out 20151111224 1      14
jul 20151211224 1      14
abr 20151111224 1      14
jan 201515112343211221114
out 201411112243111221114
jul 201411112144111221114
abr 201412112345111221114
jan 201412111345211221114
out 201311111145111221114
jul 201311111245111221114
abr 201311111245111221114
jan 201311122434211221114
out 201211111234111221114
jul 201212121234211221114
abr 201211111234111221114
jan 201211111234211221114
out 201111111234111221114
jul 201111111234211211114
abr 201112111125111211114
jan 201111111135211211114
out 201011111224111211114
jul 201011111323111211114
abr 201011111211111111114
jan 201011131211111111114
out 200911111211111111114
jul 200911111211111111114
abr 200911121211111111114
jan 200911111111111111114
out 200811111111111111114
jul 200811111111111111114
abr 200811111121111111114
jan 200811111231111121114
out 200711111121111121112
jul 200712221221211141111
abr 200711111111111131110
jan 200711111111111131110
out 20061112111111113119
jul 20061221111111123119
abr 20061111111111123119
jan 20061321111111122119
out 20052211111111122119
jul 20052111111112224119
abr 20052211211112223228
jan 20053221211122223438
out 20043121211122223227
jul 20043131211142222237
abr 20044321211132222235
jan 20043111211112232233
out 20033221211133323233
jul 20033121211133323233
abr 20033211211133323233
jan 20033111211123323233
out 20022221111133312123
jul 20022111111122211123
abr 20022121111122211123
jan 20022221111122211122
out 20011111111111111111
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 ContributorsArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Contributors (usuários registrados)
A = Contributors que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de contributors que editaram pelo menos dez vezes desde que chegaram
C = Contributors que contribuíram cinco vezes ou mais este mês
D = Contributors que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000 
dez 20181336857372694  33  673323179  1    762620161262  321  
nov 201820692613723124  22  9548311592 1    10637262095   431  
out 2018270196172143106308  22  124694323101 21   1679368362072  421  
set 201828719315911451142  11  8542208421     1847645251051  311  
ago 20182351391026934731 32  9641231041 1    17910076381652  211  
jul 201812469453420105  321 552114521 21   90412713852  521  
jun 201814179583823115  33117332201563 2211 933726181175  5421 
mai 201815186725233105  1111662420104211111 1184435171284  4221 
abr 20181488470452773  221 8336271041 221111305236231082  422  
mar 20181629674472585  321 8637261642 2211 97463416762  322  
fev 201816299825332114  33117931141272      1083221171153  432  
jan 201814070524025119  33217937191493122   107443322131141 4221 
dez 201715488725833105  531 74282215102 22   140593021136   52   
nov 2017276113835734163  22  10754281373 11   1595337221341  43   
out 2017308223187154114358  22  13265421793111   29714184461862  53   
set 201724918816712256156  431 11251291551 2    2201118443154   42   
ago 2017249147115683084  211 8735181031      2111077639135   41   
jul 2017150806041211241 3211542114721 2    114442915861  521  
jun 20171509882623984  31  46201284  2    126543725164   421  
mai 201717199855931124  321 5621161162 21   1446247321851  52   
abr 20171558068482613621331 8329181052 21   133584026951  531  
mar 20172118557352195  33  7529181171 22   164533518133   32   
fev 2017204111865631103  44  7128181031 44   1676540271653  63   
jan 20172028359402294  431 6427191051 11   1817144271752  32   
out 2018270196172143106308  22  124694323101 21   1679368362072  421  
jul 201812469453420105  321 552114521 21   90412713852  521  
abr 20181488470452773  221 8336271041 221111305236231082  422  
jan 201814070524025119  33217937191493122   107443322131141 4221 
out 2017308223187154114358  22  13265421793111   29714184461862  53   
jul 2017150806041211241 3211542114721 2    114442915861  521  
abr 20171558068482613621331 8329181052 21   133584026951  531  
jan 20172028359402294  431 6427191051 11   1817144271752  32   
out 20162581751531411194710  32  12480603482 2    19811988643061  431  
jul 2016984129241682  331 5812863  11   127322014521  542  
abr 2016146785951311542 211 471914841 111  12854392113431 43211
jan 201616499763921761 4411592315873233   17885532212651 532  
out 20153102332081871546520  11  138936733142 11   22211692672951  21   
jul 20151054332221464  431 48201394  11   11839251572   21   
abr 2015193101796250114  11  571911841 3222219474421941   3111 
jan 20151234634221341  321 44181062  11   1444525181131  32   
out 20142802001851651345713  11  155107783883 22   3692281861235781  42   
jul 20142088758422273  331 552012731 11   1938357311051  32   
abr 201416898815933123  22  7330261152 33   239134115804462  54   
jan 2014157714834171161 331 5828161043132   17673553423101  3211 
out 20132711581289973266      145846130125      3021641309254112  21   
jul 20131536640271782  1   46191141       13748332211    11   
abr 2013250152123912864  2   58169321      24211810075384   33   
jan 20131748055371992  22  642314721 11   214936239184   65   
out 2012281167137984062  31  10958382431111   30917915312275131  65   
jul 20121446544261652  21  54181463  11   18862422214421 75   
abr 20122471441158943164  1   12153411651 11   299140997548101  55   
jan 2012231112100662682  11  94311493111    3511801481137418   64   
out 201127316913910461122  33  1841128753155211   33820016714495286  75   
jul 20111496248262251  31  692617962      2217245342271  53   
abr 20112611411148741112  22  6823181161 1    374127977550121  55   
jan 2011290149103582881  31  158543717921     46722318011361133  32   
out 2010311145109683562  1   15860361881 11   39217511577347   43   
jul 20101958366371521  11  96322317124 11   2749760361481  43   
abr 201022410583653371  11  143684421102 11   30213896672681  43   
jan 20102187658321831  111 1275130177  111  433191131642552  551  
out 20092369971432052  1   1366138195  221  535238135632771  22   
jul 20091875839261651  222 108372817112      3911588633157   321  
abr 200929414311277453   21  953518112       3901477740134   63   
jan 2009232106765023103  22  124563823134      421185114572261  441  
out 2008294122875424721 321 148725226188111   564316255199128266  321  
jul 200819893694019941 11  113513422154 11   34911061321252  33   
abr 2008375237210168112226  331 1094229171352311  343137915029114  431  
jan 200826912094683584  21  119503123154      35213088532462  321  
out 200727213511084361032 22  10339291611311    34311377462472  441  
jul 200724310269391742      11241301582      36011765301451  11   
abr 200724511597653982  11  133614225145 1    40915494512392  31   
jan 2007287131917030721     15259392581111   385138904824521 11   
out 200623712893572962  2   132573423144      40216290461891  2    
jul 20068915852       17851        1995533103         
abr 20068831201021       153          1485131185         
jan 20066514731       17621        146432391         
out 20054285221       6321        107231651         
jul 2005692515951       81          10531147          
abr 20054411631       81          1233322111         
jan 2005192221       7211        6531155          
out 200423311        42          5515931         
jul 200410          1           41138411        
abr 20041011         1           5222122          
jan 200471                     271162          
out 20031                      23973          
jul 20031                      258542         
abr 2003                       2             
jan 20033                      1             
out 200221                     31            
jul 2002                                     
abr 2002                                     
jan 2002                                     
out 20011                                    

 

Distribuição de edições de artigos por contributors
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=ContributorsEdições total
118,453100.0%696,464100.0%
37,62041.3%680,40797.7%
104,92126.7%664,68195.4%
322,69714.6%624,83489.7%
1001,0245.5%531,41276.3%
3162241.2%398,45557.2%
1000610.3%316,29345.4%
3162220.1%241,42634.7%
1000070.0%169,99924.4%
3162330.0%105,84215.2%

 

50 contributors recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
JtneillUC1 036,74116617,677131dez 10, 200547681,4252--
Guy vandegriftUC2 035,71428618,079152set 06, 201319411,0124--
Dave BraunschweigUC3 033,38713125,46191out 24, 201222581,2894--
MarshallsumterUC4 031,01938921,417383ago 28, 200934111,04121--
Young1limUC7 010,4021709,749228jun 18, 2008384777---
AtcoviUC8 06,8551476,549168mai 09, 201320612701--
SaltrabookUC9+16,11135378-fev 12, 2016105222328--
LbeaumontUC11 05,1424038511fev 09, 201128812252--
WnholmesUC12 04,843912-mai 11, 2016963552---
Efex3UC13+54,783478167-mar 17, 20176531,418205--
Bert NiehausUC19 04,297396552ago 18, 201512302173--
Mikael HäggströmUC27 03,041252,11236nov 08, 20074070571--
Evolution and evolvabilityUC28+22,9421025,279622jul 10, 2016903898--
FedosinUC40 02,0392542111jan 20, 2010326635---
SophivorusUC42 01,961271,13031jun 30, 201691324---
DavidMCEddyUC45 01,6068210912fev 03, 20132156511--
Tech201805UC55+31,0925819-mai 22, 2018222421--
ErtuncUC59 01,04091776out 07, 2010300612---
Michael TenUC60 01,03335186dez 18, 2012220336---
VictorPortonUC81 078210203out 15, 20093363291--
RAYLEIGH22UC82 07754298-jun 19, 201320201---
Jon michael swiftUC105+1577140-abr 14, 201699079---
EmmagchUC109+2548829-fev 02, 20176967---
BenrattrayUC116+251153044jan 07, 2010327916---
Lionel ScheepmansUC121+18505491262mai 20, 20112781153--
KoavfUC132-14751351-abr 21, 2008390540---
HistorybuffUC138-146119094jan 12, 2007437021---
TsirelUC184+40369541,059131jul 29, 2009344121--
Logan520UC190 0358144-fev 02, 201769617---
TegelUC314+52452195-mar 09, 20112853----
Igabriel85UC374+38216123-fev 17, 20141777551--
Jonathan Sheehan UCUC506+33018060241ago 02, 20181501---
TreedesignerUC512+21771112-nov 21, 200740578---
FnielsenUC547+5167114-jul 14, 2010309111---
KaihsuUC562+216312,679102out 11, 200740989---
Ozzie10aaaaUC612+7301558044165out 30, 201861----
BrainistUC621+391537132jan 03, 20183611---
Rubbish computerUC656+394147516-nov 11, 20151145----
Diptanshu DasUC978+1131051236463jul 11, 20169024---
Biochemistry&LoveUC995+291034233fev 20, 2018313----
RadiXUC1017+252100211291dez 12, 20102940----
Graham BeardsUC1029+99927-mar 31, 20176391---
OhanaUnitedUC1184+27852952nov 30, 20102952----
George HoUC1295+14781893mar 01, 20176694---
MiciannelliUC1410+53071219-ago 09, 20175081---
HibbajavedUC1439+8497030121ago 14, 20181381---
Esteban16UC1654+2216089-dez 14, 2017381----
1997kBUC1878+357052445729jul 31, 2018152----
HakanISTUC1997+284814-mai 06, 2016968----
RogerhcUC2168+124423285-set 23, 200644817---

 

20 contributors recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
SB JohnnyUC512,235ago 17, 20064518jan 30, 2018334
Green GiantUC610,501ago 18, 20141595jun 11, 2018202
LeighblackallUC105,891set 27, 20054842mai 03, 2018241
Robert ElliottUC144,744set 24, 20064480jun 18, 20083847
JWSchmidtUC154,568ago 17, 20054883mai 15, 20151325
Mike's bot accountUC164,499set 26, 20074113nov 19, 20083693
FastenUC174,333fev 14, 20074337ago 07, 2018145
Nobody60UC184,319mar 24, 20112838set 01, 2016850
RemiUC203,943mai 06, 20074256out 17, 20083726
JomegatUC213,587mar 21, 20074302out 26, 20122256
Erkan YilmazUC223,512nov 27, 20064416nov 18, 20141503
LeuthaUC233,142ago 08, 20103066dez 01, 201829
AbdUC243,141abr 09, 20103187dez 11, 2017384
Mu301UC253,127dez 01, 20064412fev 20, 2018313
TimboliuUC263,120set 26, 20131921ago 11, 2017506
HAPE3512UC292,933mar 20, 20122476out 30, 2016791
GmastermanUC302,860jun 04, 20093496nov 19, 20112598
1sfoersterUC312,673ago 19, 20112690abr 04, 20151366
Thierry613UC322,660fev 14, 20151415jun 25, 2016918
Danielito el traviesitoUC332,296dez 01, 20151125set 17, 2018104

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 110.879 edições foram feitas por usuários anônimos, de um total de 857.459 edições ( 12e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
MaintenanceBotUC129,958dez 02, 20131854dez 04, 201826827-
JackBotUC27,413ago 13, 20103061dez 29, 20181--
Crochet.david.botUC35,997ago 10, 20074160mai 02, 20141703--
CommonsDelinkerUC42,276abr 30, 20074262dez 31, 2018---
Mu301BotUC52,275ago 31, 20093408fev 06, 2018327--
タチコマ robotUC6641mar 12, 20083945jul 02, 2017546--
AdambroBotUC7479jul 03, 20093467jun 17, 20103118--
DexbotUC8265set 01, 20141581jul 19, 2016894--
Tsca.botUC985fev 25, 20064691mai 14, 20064613--
SmackBotUC1072mar 25, 20064663jun 30, 20112740--
ArthurBotUC1170jan 01, 20093650ago 11, 20112698--
YobotUC1267fev 03, 20093617dez 13, 2016747--
ArchiveBot (usurped)~enwikiversityUC1360out 08, 20083735mai 25, 201127765-
VolkovBotUC1450jul 30, 20074171mar 15, 20132116--
AnomieBOTUC1545dez 16, 20102936jan 31, 2017698--
BG19botUC1645nov 27, 20122224dez 30, 2016730--
Luckas-botUC1731jun 20, 20093480mai 20, 20122415--
AvocatoBotUC1830out 22, 20112626mai 18, 20122417--
RussBotUC1927out 30, 20064444dez 04, 20112583--
FrescoBotUC2024mar 12, 20103215dez 24, 2016736--
Aiman titiBotUC2119jul 13, 20112727jul 13, 20112727--
JAnDbotUC2215dez 14, 20064399set 21, 20122291--
EmausBotUC2315ago 05, 20103069abr 27, 20176121-
RjwilmsiBotUC2412dez 17, 20093300dez 03, 20112584--
DinybotUC259mar 27, 20074296mar 27, 20074296--
Helpful Pixie BotUC269ago 19, 20112690mai 12, 20122423--
MetalrobotUC278ago 19, 20064516out 22, 200644522-
GrouchoBotUC288fev 16, 20093604jul 18, 20112722--
MerlLinkBotUC298out 12, 20093366fev 04, 20112886--
ZéroBotUC308jun 28, 20112742fev 14, 20132145--
DumZiBoTUC317fev 05, 20083981mai 11, 20093520--
MonkbotUC327jan 17, 20141808jan 08, 2017721--
Bibcode BotUC336ago 08, 20122335jun 07, 20151302--
EscarbotUC345nov 28, 20074050jun 01, 20112769--
AlexbotUC355jan 23, 20083994jul 24, 20103081--
ZorrobotUC365nov 07, 20083705jul 31, 20103074--
MystBotUC375jun 23, 20103112dez 09, 20112578--
ChobotUC384jan 01, 20084016out 29, 20112619--
MastiBotUC394ago 27, 20093412out 06, 20122276--
BattyBotUC404fev 26, 20122499set 29, 20151188--
LegobotUC414fev 20, 20132139jul 05, 20132004--
RedBotUC423jul 10, 20093460mai 06, 20122429--
QUBotUC433out 25, 20122257out 25, 20122257--
KasparBotUC443mai 18, 20151322jun 22, 20151287--
GerakibotUC452out 15, 20074094ago 04, 20122339--
Idioma-botUC462dez 25, 20074023nov 27, 20093320--
SamatBotUC472mai 26, 20083870jan 09, 20122547--
CarsracBotUC482jul 19, 20083816abr 20, 20093541--
DragonBotUC492out 15, 20083728jan 02, 20132188--
DASHBotUC502mai 16, 20112785mar 23, 20122473--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJpgMidOggOgvPdfPngSvgSxwTifTiffWavWebmXcf
dez 201850 k26 k1,8 k27 k2108,1 k2557,4 k5594,5 k58050   3799428,3 k164494411 k5,4 k61411381824
nov 201849 k26 k1,8 k27 k2108,0 k2557,4 k5594,5 k58050   3799428,3 k164494411 k5,4 k61311381824
out 201849 k26 k1,8 k26 k2108,0 k2557,4 k5594,5 k58050   3799428,3 k164494410 k5,4 k61111381824
set 201848 k26 k1,8 k26 k2108,0 k2557,4 k5594,5 k57950   3799428,3 k164494410 k5,3 k61111381824
ago 201848 k25 k1,7 k26 k2108,0 k2557,3 k5594,5 k57949   3799188,3 k16449449,9 k5,3 k61011381824
jul 201848 k25 k1,7 k26 k2108,0 k2557,3 k5584,5 k57949   3799188,3 k16449449,7 k5,3 k61011381824
jun 201847 k25 k1,7 k26 k2108,0 k2557,3 k5574,3 k57948   3799188,3 k16449449,6 k5,3 k61011381824
mai 201847 k25 k1,7 k25 k2108,0 k2557,2 k5574,3 k57948   3799188,3 k16449449,4 k5,3 k60911381824
abr 201846 k25 k1,7 k25 k2107,9 k2557,2 k5564,3 k57948   3799188,3 k16449449,3 k5,3 k60911381824
mar 201846 k25 k1,7 k25 k2087,9 k2557,2 k5564,1 k57948   3799148,3 k16449449,1 k5,2 k60811381824
fev 201846 k25 k1,7 k25 k2087,9 k2557,2 k5564,1 k57948   3799148,3 k16449448,9 k5,2 k60811381824
jan 201846 k25 k1,7 k25 k2087,9 k2557,1 k5564,1 k57948   3799148,2 k16449448,8 k5,2 k60711381824
dez 201746 k25 k1,7 k24 k2047,9 k2557,1 k5564,1 k57947   3799148,2 k16449448,6 k5,2 k60711381824
nov 201745 k25 k1,7 k24 k2047,8 k2557,0 k5564,1 k57946   3799148,2 k16449448,4 k5,2 k60711381824
out 201745 k25 k1,7 k24 k2047,8 k2557,0 k5564,1 k57746   3799088,2 k16449448,3 k5,2 k60611381824
set 201745 k25 k1,7 k24 k2037,7 k2557,0 k5554,1 k57646   3798818,2 k16449448,1 k5,2 k60611381824
ago 201744 k25 k1,7 k24 k2037,7 k2556,9 k5524,1 k57546   3798818,1 k16449447,9 k5,1 k60411381824
jul 201744 k24 k1,7 k23 k2037,7 k2556,9 k5524,1 k57544   3798808,1 k16449447,8 k5,1 k60011371824
jun 201744 k24 k1,7 k23 k2037,7 k2556,9 k5214,1 k57344   3798808,1 k16449447,7 k5,1 k60011361824
mai 201743 k24 k1,7 k23 k2037,7 k2556,9 k5184,1 k57344   3798788,1 k16449447,5 k5,0 k60011361824
abr 201743 k24 k1,7 k23 k2037,6 k2546,9 k5184,1 k57343   3798768,0 k16449447,4 k5,0 k60011361824
mar 201743 k24 k1,7 k23 k2037,6 k2546,8 k5174,0 k57343   3798748,0 k16449447,2 k5,0 k60011361824
fev 201742 k24 k1,7 k22 k2027,6 k2546,8 k5154,0 k57342   3798748,0 k16449447,1 k5,0 k60011361824
jan 201742 k24 k1,7 k22 k2027,5 k2546,7 k4804,0 k57142   3798748,0 k16447446,8 k5,0 k60011361824
dez 201642 k24 k1,7 k22 k2027,5 k2546,7 k4794,0 k57041   3798718,0 k16447446,6 k5,0 k60011361824
nov 201642 k24 k1,7 k22 k2017,5 k2546,6 k4794,0 k57041   3798697,9 k16447446,4 k4,9 k60011361824
out 201641 k24 k1,6 k21 k1997,4 k2536,5 k4794,0 k57040   3798657,9 k16447446,2 k4,9 k60011361724
set 201641 k24 k1,6 k21 k1997,4 k2536,5 k4784,0 k56940   3798637,9 k16446436,0 k4,9 k60011361724
ago 201640 k24 k1,6 k21 k1997,4 k2536,4 k4784,0 k56840   3798617,9 k16446435,9 k4,9 k59911361724
jul 201640 k23 k1,6 k21 k1997,4 k2536,3 k4784,0 k56738   3798617,9 k16446435,7 k4,9 k59911361724
jun 201640 k23 k1,6 k21 k1997,3 k2536,3 k4784,0 k56736   3798617,9 k16446435,6 k4,9 k59811361724
mai 201640 k23 k1,6 k21 k1997,3 k2536,3 k4774,0 k47736   3798617,9 k16446435,5 k4,9 k59811361724
abr 201639 k23 k1,6 k21 k1997,3 k2536,1 k4644,0 k46734   3798607,9 k16446435,4 k4,9 k59811361724
mar 201639 k23 k1,6 k20 k1997,3 k2535,9 k4633,9 k31934   3798597,9 k16446435,3 k4,9 k59811351724
fev 201639 k23 k1,6 k20 k1997,3 k2535,9 k4613,9 k18034   3798557,9 k16444435,2 k4,9 k59811351724
jan 201639 k23 k1,6 k20 k1997,3 k2535,8 k4613,9 k15633   3798537,8 k16444435,1 k4,9 k59811351724
dez 201538 k23 k1,6 k20 k1977,2 k2525,8 k4553,7 k15332   3798517,8 k16442435,0 k4,8 k59811351724
nov 201538 k23 k1,6 k20 k1967,2 k2525,8 k3933,7 k14931   3798417,8 k16442434,8 k4,8 k59711351724
out 201538 k23 k1,6 k20 k1967,2 k2525,8 k3853,7 k14830   3798407,7 k16442434,7 k4,8 k59711351724
set 201537 k23 k1,6 k19 k1967,2 k2525,7 k3853,7 k14830   3798367,6 k16442434,6 k4,8 k59611351724
ago 201537 k23 k1,6 k19 k1947,1 k2525,6 k3843,7 k14430   3798367,6 k16442434,6 k4,7 k59611351724
jul 201537 k22 k1,6 k19 k1947,1 k2515,5 k3833,7 k14429   3798297,6 k16442434,5 k4,7 k59611351724
jun 201536 k22 k1,6 k19 k1947,0 k2515,5 k3833,7 k14329   3798287,6 k16442434,4 k4,7 k59611351724
mai 201534 k22 k1,6 k19 k1947,0 k2515,4 k3833,7 k14328   3798257,5 k16442434,3 k4,7 k59611351724
abr 201534 k22 k1,5 k19 k1947,0 k2515,4 k3833,7 k14127   3798217,5 k16442434,2 k4,6 k59611351724
mar 201534 k22 k1,5 k18 k1937,0 k2515,4 k3833,7 k14127  46453798207,4 k16442414,1 k4,6 k59611351724
fev 201533 k22 k1,5 k18 k1927,0 k2515,4 k3833,6 k14126  23493798087,3 k16442414,0 k4,6 k59611351724
jan 201533 k22 k1,5 k18 k1927,0 k2515,4 k3833,6 k14126  17383798037,3 k16442413,9 k4,6 k59611351724
dez 201433 k22 k1,5 k18 k1927,0 k2515,3 k3833,6 k14126  26763798037,3 k16442413,8 k4,6 k59611351724
nov 201433 k22 k1,5 k18 k1926,9 k2515,3 k3833,6 k14126  64653797887,1 k16442413,8 k4,5 k59611251724
out 201433 k22 k1,5 k17 k1886,9 k2515,3 k3833,6 k14125  158123797857,0 k16441413,7 k4,3 k59511241724
set 201432 k21 k1,5 k17 k1886,9 k2515,3 k3813,6 k14125  46103797746,8 k16441413,7 k4,3 k59411241 24
ago 201432 k21 k1,5 k17 k1886,9 k2515,2 k3803,6 k14125  51323797686,7 k16441413,6 k4,3 k59311241 24
jul 201432 k21 k1,5 k17 k1886,9 k2515,2 k3803,6 k14024  32763797666,7 k16441413,5 k4,3 k59311241 24
jun 201431 k20 k1,5 k17 k1886,9 k2515,2 k3803,5 k14023  29523797626,7 k16441413,5 k4,3 k59311241 24
mai 201431 k20 k1,5 k17 k1886,9 k2515,1 k3803,5 k14022  47403797606,6 k16441413,4 k4,3 k58611241 24
abr 201431 k20 k1,5 k16 k1866,8 k2515,1 k3803,5 k11721  44043797556,4 k16441413,3 k4,2 k5851124  24
mar 201431 k20 k1,5 k16 k1856,8 k2515,1 k3803,5 k11721  55753797476,3 k16441413,2 k4,1 k5851124  24
fev 201430 k20 k1,5 k16 k1856,8 k2505,0 k3803,5 k11720  45943797106,1 k16441413,1 k4,1 k5851124  24
jan 201430 k20 k1,5 k15 k1856,8 k2505,0 k3783,5 k11720  51153797086,0 k16441413,0 k4,1 k5851124  24
dez 201329 k20 k1,5 k15 k1856,7 k2505,0 k3783,5 k11620  57683796916,0 k16441412,8 k4,1 k5851123  24
nov 201329 k19 k1,4 k15 k1856,7 k2505,0 k3783,5 k11620  153503796916,0 k16441412,7 k4,1 k5851123  24
out 201328 k19 k1,4 k15 k1846,7 k2504,9 k3783,5 k11620  83733796915,9 k16441412,6 k4,0 k5851123  24
set 201328 k19 k1,4 k14 k1846,7 k2504,9 k3683,5 k11520  23783796885,8 k16441412,5 k4,0 k5851123  24
ago 201327 k19 k1,4 k14 k1846,7 k2504,9 k3683,5 k11520  34943796885,7 k16441412,3 k4,0 k5851123  24
jul 201327 k19 k1,4 k14 k1846,6 k2504,9 k3683,5 k11520  30223796885,7 k16441412,2 k4,0 k5811123  24
jun 201327 k18 k1,4 k14 k1846,6 k2504,9 k3683,4 k11419  18553796885,7 k16441412,1 k4,0 k5811123  24
mai 201327 k18 k1,4 k14 k1846,6 k2504,9 k3683,4 k11419  27833796885,7 k16441412,1 k4,0 k5671123  24
abr 201327 k18 k1,4 k14 k1836,4 k2504,9 k3673,4 k11418  40033796875,6 k16441412,0 k4,0 k5261123  24
mar 201326 k18 k1,4 k14 k1836,4 k2504,9 k3673,4 k11418  45613786585,6 k16441411,9 k4,0 k5151121  24
fev 201326 k18 k1,4 k13 k1826,4 k2504,9 k3673,4 k11418  46323736105,5 k16441381,8 k3,9 k5081121  24
jan 201326 k17 k1,4 k13 k1816,3 k2504,8 k3673,4 k11418  28213706095,4 k16441381,7 k3,8 k4821121  24
dez 201225 k17 k1,4 k13 k1796,3 k2504,8 k3673,4 k11417  42873606075,4 k16441381,7 k3,8 k4801121  24
nov 201225 k17 k1,4 k13 k1786,3 k2504,7 k3673,4 k11417  41533606075,3 k16441381,6 k3,8 k4771121  24
out 201225 k17 k1,4 k12 k1786,3 k2494,7 k3673,4 k11317  43183516025,2 k16441381,5 k3,7 k4761121  3
set 201225 k17 k1,4 k12 k1786,3 k2494,7 k3673,4 k11315  42623415985,0 k16441381,5 k3,7 k4761121  3
ago 201224 k16 k1,4 k12 k1786,2 k2494,7 k3623,3 k11314  22493155965,0 k16441381,4 k3,6 k4761121  3
jul 201224 k16 k1,4 k12 k1786,2 k2244,7 k3403,3 k11314  23153115965,0 k16441381,4 k3,6 k4751121  3
jun 201224 k16 k1,4 k12 k1786,0 k2134,6 k3403,2 k11313  27643115955,0 k16441381,3 k3,6 k4531121  3
mai 201224 k16 k1,4 k12 k1786,0 k2134,6 k3403,2 k11312  41953115955,0 k16441381,2 k3,6 k4531121  3
abr 201224 k16 k1,4 k12 k1784,5 k2134,5 k3403,2 k11312  56643115944,9 k16441381,2 k3,6 k4521121  3
mar 201223 k16 k1,4 k11 k1744,5 k2134,5 k3403,2 k11212  53753055864,8 k16441381,1 k3,5 k4511121  3
fev 201223 k15 k1,4 k11 k1744,4 k2134,5 k3403,2 k11212  44952955854,7 k16441381,0 k3,4 k4511121  3
jan 201223 k15 k1,4 k11 k1624,4 k2134,5 k3323,2 k11211  31692825824,6 k16441389623,3 k4481121  3
dez 201123 k15 k1,4 k10 k1404,4 k2104,5 k3313,2 k11211  24822705814,5 k16441389433,2 k4351121  3
nov 201122 k14 k1,4 k10 k1404,2 k2104,4 k3313,2 k11210  107802705814,5 k16441389163,2 k4291121  3
out 201122 k14 k1,4 k10 k1404,0 k2094,4 k3313,2 k1129  59482615804,3 k16435348653,2 k4061121  3
set 201122 k14 k1,3 k10,0 k1394,0 k2094,4 k3313,2 k1129  44652495764,3 k16434278213,2 k3791121  3
ago 201121 k13 k1,3 k9,9 k1323,9 k2094,3 k3313,2 k1129  20812345624,2 k16434277993,2 k3541121  3
jul 201121 k13 k1,3 k9,8 k1313,9 k2094,3 k3303,1 k1129  22862305624,2 k16433277563,2 k3221121  3
jun 201121 k13 k1,3 k9,7 k1303,9 k2094,3 k3303,1 k1119  18502295624,2 k16433277203,1 k2911121  3
mai 201121 k13 k1,3 k9,6 k1303,8 k2064,2 k3303,1 k1118  36722265624,2 k16433267043,1 k2611121  3
abr 201120 k13 k1,3 k9,4 k1303,7 k2054,2 k3293,1 k1118  43362255594,2 k16432266523,1 k2091121  3
mar 201120 k12 k1,3 k8,7 k1293,7 k2054,1 k3293,1 k1118  63532185513,9 k16432246332,8 k2071121  3
fev 201119 k12 k1,3 k7,9 k1233,7 k2054,1 k3293,1 k1108  59561934983,5 k16432245622,5 k19313   2
jan 201119 k12 k1,3 k7,5 k1233,6 k2054,1 k3293,1 k1106  36001704893,3 k16432245442,3 k18812   2
dez 201019 k11 k1,3 k7,1 k1153,6 k2054,1 k3293,1 k1105  41701442913,3 k16432245232,3 k16912   2
nov 201018 k11 k1,2 k7,0 k1153,6 k2034,0 k3263,1 k1095  83211412483,2 k16430245122,2 k16511   2
out 201018 k11 k1,2 k6,9 k1123,5 k2034,0 k3253,1 k1095  40981312483,2 k16430245072,2 k16511   2
set 201018 k11 k1,2 k6,7 k1083,5 k2024,0 k3253,1 k1094  3342942463,2 k16430245032,1 k1651    2
ago 201017 k10 k1,2 k6,7 k1083,5 k2014,0 k3253,1 k1093  3284762423,1 k16430245012,1 k1641    2
jul 201017 k10 k1,2 k6,6 k1073,4 k1994,0 k3223,1 k1093  1842622423,1 k16430244972,1 k1321    2
jun 201017 k10 k1,2 k6,6 k1053,4 k1984,0 k3203,1 k1092  2202622383,1 k16429244942,1 k1251    2
mai 201017 k10,0 k1,2 k6,5 k1043,4 k1983,9 k3203,1 k1092  2624602383,1 k16422244912,0 k1211    2
abr 201016 k9,9 k1,2 k6,5 k1043,4 k1973,9 k3203,1 k1092  3611602383,1 k16422244832,0 k1211    2
mar 201016 k9,7 k1,2 k6,3 k1023,3 k1943,9 k3203,1 k109   3685542363,0 k1642084672,0 k1211    2
fev 201016 k9,5 k1,1 k6,2 k993,3 k1943,8 k3203,0 k109   3862432352,9 k1641984582,0 k1201    2
jan 201016 k9,3 k1,1 k6,1 k963,3 k1943,8 k3203,0 k108   192512322,9 k1641884522,0 k1201    2
dez 200916 k9,0 k1,1 k6,0 k963,3 k1943,8 k3193,0 k108   208212302,9 k16404 4192,0 k1201    2
nov 200915 k8,9 k1,1 k6,0 k963,3 k1943,8 k3193,0 k106   309712302,9 k16404 4142,0 k1201    2
out 200915 k8,7 k1,1 k6,0 k963,3 k1903,8 k3193,0 k106   272712292,9 k16404 4022,0 k1191    2
set 200915 k8,3 k1,1 k5,9 k963,2 k1853,8 k3193,0 k106   374712292,8 k16404 3841,9 k1171    2
ago 200915 k8,0 k1,1 k5,9 k963,1 k1833,7 k3193,0 k106   278012292,8 k16404 3731,9 k1121    2
jul 200914 k7,8 k1,1 k5,9 k953,1 k1823,7 k3172,9 k106   212012272,8 k16404 3701,9 k1121    2
jun 200914 k7,5 k1,1 k5,9 k923,1 k1823,7 k3172,9 k106   167912272,8 k16404 3661,9 k1121    2
mai 200914 k7,4 k1,1 k5,8 k913,1 k1813,6 k3152,9 k105   198212272,8 k16404 3661,9 k1121    2
abr 200914 k7,2 k1,1 k5,8 k903,0 k1713,6 k3132,9 k104   359012232,8 k16404 3631,9 k1121    2
mar 200914 k6,9 k1,1 k5,7 k883,0 k1713,6 k3132,9 k103   197812162,8 k16404 3451,9 k1101    2
fev 200914 k6,8 k1,1 k5,7 k883,0 k1683,6 k3132,3 k103   325012162,8 k16401 3331,9 k1061    2
jan 200913 k6,6 k1,0 k5,6 k883,0 k1663,5 k3121,5 k103   356712152,7 k16401 3181,8 k1041    2
dez 200813 k6,4 k1,0 k5,6 k842,9 k1653,5 k3121,4 k102   307312152,7 k16400 2981,8 k1031    1
nov 200813 k6,1 k1,0 k5,3 k842,9 k1643,4 k3011,1 k99   407011962,5 k16400 2841,7 k951    1
out 200813 k5,6 k1,0 k4,6 k762,8 k1603,4 k3001,1 k99   399711642,0 k16398 2671,6 k691    1
set 200812 k5,0 k9844,0 k722,8 k1593,4 k2871,1 k96   443611561,6 k16394 2351,6 k451    1
ago 200812 k4,3 k9203,6 k702,7 k1533,3 k2471,1 k95   532811401,3 k16389 2001,5 k451    1
jul 200811 k4,1 k8723,5 k692,6 k1513,3 k2471,0 k95   460411371,2 k16376 1981,5 k441    1
jun 200811 k3,9 k8543,5 k682,5 k1463,2 k2411,0 k91   538911371,2 k16375 1981,5 k441    1
mai 200810 k3,7 k8333,5 k672,4 k1062,9 k2381,0 k90   616511371,2 k16373 1881,5 k441    1
abr 20089,9 k3,5 k8183,5 k662,2 k942,1 k23198386   1144111371,2 k16363 1861,5 k411    1
mar 20089,2 k3,4 k7863,2 k632,1 k621,9 k21493576   6961113698816359 1621,5 k411    1
fev 20088,6 k3,2 k7473,0 k632,0 k601,8 k20590368   2995113693816333 1521,4 k231     
jan 20088,1 k3,1 k7363,0 k631,9 k581,7 k20582967   4328112791116321 1431,4 k231     
dez 20077,7 k2,9 k7142,9 k611,9 k581,5 k18878766   2976112485616311 1411,4 k231     
nov 20077,4 k2,8 k7062,7 k491,7 k561,4 k18875965   4229112479316283 1291,3 k231     
out 20077,1 k2,7 k7012,6 k491,7 k561,4 k18773063   6374111276616265 1191,3 k201     
set 20076,3 k2,5 k6952,4 k491,6 k561,3 k17562361   5478111071416255 1031,2 k171     
ago 20075,5 k2,4 k6832,3 k451,5 k551,1 k17462253   4208110970316190 961,2 k151     
jul 20074,8 k2,2 k6551,9 k441,5 k531,1 k17056252   2893110562216147 72886151     
jun 20074,3 k2,0 k6511,7 k431,4 k491,0 k16053151   299319960516115 57760151     
mai 20074,0 k1,9 k6391,5 k421,3 k4798715752647   35441575851481 5172081     
abr 20073,6 k1,7 k5381,4 k361,1 k4478015550643   4406154569 62 4364181     
mar 20073,2 k1,5 k5251,2 k361,0 k4065215149436   3855142498 57 3754371     
fev 20072,9 k1,3 k515990349713663614547635   3548140438 55 2442471     
jan 20072,5 k1,1 k490667326623455514244430   4533132351 22 2023371     
dez 20062,2 k912427478325353041212117025   3792 15328 8 1610551     
nov 20061,8 k763395369314422738311114524   3009 12258 4 147551     
out 20061,5 k620361176313782231211012522   3593 10102 4 65031     
set 20061,1 k4343185231320202549310118   1935 310 3 2322      
ago 2006842246264133127218186818410   2093  4   27       
jul 200661115123148152132394   344  1   1        
jun 200659815023140152030384   397  1   1        
mai 2006578132 3132152029354   471               
abr 2006562132 3117152028354   463               
mar 2006535131 396141928354   387               
fev 2006477128 388141926334   435               
jan 2006417124 385141824334   221               
dez 2005379124 376141823324   386               
nov 2005325121 362141822303   340               
out 2005313115 35871819302   227               
set 2005292114 35271717302   152               
ago 2005268114 34871717292   280               
jul 2005223113 34271517292   565               
jun 2005159113 33671515292   284               
mai 2005122113 33271414292   172               
abr 2005102113 33071314292   141               
mar 200586113 32371313242   91               
fev 200576112 32071313192   85               
jan 200566110 387 13171                   
dez 200458110 387 12151                   
nov 200455110 367 10131                   
out 200450110 367 10131                   
set 200437110 367 8111                   
ago 200419110 366 791                   
jul 20041518 346 46                    
jun 20041218 315 34                    
mai 20041017 214  2                    
abr 2004916 114                       
mar 2004816 113                       
fev 20047 6 1 3                       
jan 20046 6 1 3                       
dez 20035 6 1 3                       
nov 20034 6   3                       
out 20033 5   3                       
set 20033 5   3                       
ago 20033 5   1                       
jul 20033 3                           
jun 20033 3                           
mai 20032 2                           
abr 20032 1                           
mar 20032 1                           
fev 20032 1                           
jan 20032 1                           
dez 20022 1                           
nov 20022 1                           
out 20022 1                           
set 20022                             
ago 20022                             
jul 20022                             
jun 20022                             
mai 20022                             
abr 20022                             
mar 20022                             
fev 20022                             
jan 20022                             
dez 20012                             
nov 20011                             
out 20011                             

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2001: 1 1 Experiment/In vitro

nov 2001: 1 1 Experiment/In vitro

dez 2001: 1 2 Progressive education

fev 2002: 1 1 Electric Mobility/Engineering/Aerodynamics

jun 2002: 1 1 Digital Signature

set 2002: 1 1 Experiment/In vitro

out 2002: 1 1 Electric Mobility/Engineering/Aerodynamics

nov 2002: 1 1 Electric Mobility/Engineering/Aerodynamics

dez 2002: 1 1 Random number

jan 2003: 1 3 Electric Mobility/Engineering/Aerodynamics

fev 2003: 1 1 Digital Signature

mar 2003: 1 1 Random number

mai 2003: 1 2 Experiment/In vitro

jun 2003: 1 2 Low-Cost Precision Farming

jul 2003: 1 1 Electric Mobility/Engineering/Aerodynamics

set 2003: 1 3 Operating Systems/Unix/Security , 2 1 Electric Mobility/Engineering/Aerodynamics

out 2003: 1 1 Electric Mobility/Engineering/Aerodynamics

nov 2003: 1 1 Electric Mobility/Engineering/Aerodynamics

dez 2003: 1 3 Electric Mobility/Engineering/Aerodynamics , 2 1 WikiJournal Preprints/Hepatitis E

jan 2004: 1 3 Electric Mobility/Engineering/Aerodynamics

fev 2004: 1 2 Arboriculture/Pruning

mar 2004: 1 2 Digital Signature , 2 1 WikiJournal Preprints/Hepatitis E

abr 2004: 1 2 Electric Mobility/Engineering/Aerodynamics , 2 2 Plant propagation , 3 2 Digital Signature , 4 1 Photogrammetry

mai 2004: 1 3 Photogrammetry , 2 2 Electric Mobility/Engineering/Aerodynamics

jun 2004: 1 2 Electric Mobility/Engineering/Aerodynamics , 2 2 Arboriculture/Pruning , 3 2 Geochronology/Ice cores , 4 1 WikiJournal Preprints/Hepatitis E

jul 2004: 1 2 Houseplant care/Houseplant , 2 2 Digital Signature , 3 1 Electric Mobility/Engineering/Aerodynamics

ago 2004: 1 3 Electric Mobility/Engineering/Aerodynamics , 2 2 WikiJournal Preprints/Hepatitis E , 3 2 Low-Cost Precision Farming , 4 2 Geochronology/Ice cores , 5 2 Houseplant care/Houseplant

set 2004: 1 4 Houseplant care , 2 3 Random number , 3 2 Arboriculture/Pruning , 4 2 Geochronology/Ice cores , 5 2 Wiki as a time saver for researchers , 6 2 Operating system , 7 1 WikiJournal Preprints/Template:Navbox

out 2004: 1 4 Digital Signature , 2 3 Swarm intelligence , 3 2 Houseplant care , 4 1 WikiJournal Preprints/Hepatitis E

nov 2004: 1 3 Wikiversity-Translation practice course , 2 2 Mathematics Assistance , 3 1 WikiJournal Preprints/Template:Main

dez 2004: 1 4 Digital Signature , 2 4 Random number , 3 3 Electric Mobility/Engineering/Aerodynamics , 4 3 Wikiversity-Translation practice course , 5 2 WikiJournal Preprints/Hepatitis E , 6 2 Geochronology/Ice cores

jan 2005: 1 3 Electric Mobility/Engineering/Aerodynamics , 2 3 Digital Signature , 3 2 WikiJournal Preprints/Template:Main , 4 2 Plant propagation , 5 2 Wikiversity-Translation practice course

fev 2005: 1 3 Wikiversity-Translation practice course , 2 2 WikiJournal Preprints/Template:Cite web , 3 2 WikiJournal Preprints/Template:Cite journal , 4 2 Electric Mobility/Engineering/Aerodynamics , 5 2 Drinking water/Distillation , 6 2 Houseplant care/Houseplant

mar 2005: 1 5 Geochronology/Ice cores , 2 3 WikiJournal Preprints/Hepatitis E , 3 3 Electric Mobility/Engineering/Aerodynamics , 4 3 Digital Signature , 5 3 Wikiversity-Translation practice course , 6 2 Drinking water/Distillation , 7 2 Geographic coordinate conversion

abr 2005: 1 5 Geochronology/Ice cores , 2 3 Operating Systems/Unix/Security , 3 3 Experiment/In vitro , 4 3 Random number , 5 2 Artificial intelligence/prospects , 6 2 Wikiversity-Translation practice course , 7 2 Primary mathematics/Factors and primes , 8 2 Anthropology , 9 1 WikiJournal Preprints/Template:Main

mai 2005: 1 7 WikiJournal Preprints/Template:Main , 2 6 Geochronology/Ice cores , 3 4 Wikiversity-Translation practice course , 4 2 Swarm intelligence , 5 2 Plant propagation , 6 2 Houseplant care , 7 2 Survival kit , 8 1 WikiJournal Preprints/Hepatitis E

jun 2005: 1 5 WikiJournal of Science/Spaces in mathematics , 2 4 Houseplant care/Houseplant , 3 3 Aquaria/Congo tetras , 4 3 Houseplant care , 5 3 Operating system , 6 3 The Great War and Versailles , 7 2 WikiJournal Preprints/Template:Main , 8 2 WikiJournal Preprints/Template:Cite journal , 9 2 Electric Mobility/Engineering/Aerodynamics , 10 2 Geochronology/Ice cores

jul 2005: 1 11 WikiJournal Preprints/Template:Main , 2 6 The Great War and Versailles , 3 5 Military studies , 4 4 WikiJournal Preprints/Template:Cite web , 5 3 Representation theory of the Lorentz group , 6 3 Web Design/Useful Applications , 7 3 Web Design/Build a basic web page , 8 2 Geochronology/Ice cores , 9 2 Digital Signature , 10 2 Fire and emergency management/Rescuing victims of a building collapse , 11 2 The Great War and Versailles/Further Reading , 12 2 Philosophy/Resources , 13 2 Initial questions in philosophy , 14 2 Basic economics , 15 2 Web Design/Using the Internet as a Learning Tool , 16 2 Web Design/Build a small website

ago 2005: 1 5 Broken/About , 2 4 WikiJournal Preprints/Template:Main , 3 4 Progressive education , 4 3 Digital Signature , 5 3 Study Group For Relativity , 6 2 Electric Mobility/Engineering/Aerodynamics , 7 2 Houseplant care/Houseplant , 8 1 WikiJournal Preprints/Hepatitis E

set 2005: 1 5 Digital Signature , 2 3 WikiJournal Preprints/Template:Main , 3 3 Electric Mobility/Engineering/Aerodynamics , 4 3 Web Design/CSS challenges

out 2005: 1 7 WikiJournal Preprints/Template:Main , 2 3 Geochronology/Ice cores , 3 3 Houseplant care/Houseplant , 4 2 Electric Mobility/Engineering/Aerodynamics , 5 2 Digital Signature , 6 2 Introduction to Programming C/Lectures/Variables , 7 2 Introduction to C programming/Lectures/BooleanLogic

nov 2005: 1 8 WikiJournal Preprints/Template:Cite web , 2 7 WikiJournal Preprints/Template:Main , 3 5 Drinking water/Solar disinfection , 4 3 WikiJournal Preprints/Template:Cite journal , 5 3 Swarm intelligence , 6 3 Geochronology/Ice cores , 7 3 Houseplant care/Houseplant , 8 3 Digital Signature , 9 3 Cell biology , 10 2 Electric Mobility/Engineering/Aerodynamics , 11 2 Progressive education , 12 2 Introduction to C programming/Quizes/Variables , 13 2 Transwiki:Wikiversity-School of Computer Science/IntroProgramingCPP , 14 2 Operating system , 15 2 Study Group For Relativity

dez 2005: 1 6 WikiJournal Preprints/Template:Main , 2 6 Photogrammetry , 3 5 Web design , 4 4 WikiJournal Preprints/Template:Cite web , 5 4 Digital Signature , 6 3 WikiJournal Preprints/Template:Cite journal , 7 3 Electric Mobility/Engineering/Aerodynamics , 8 3 Survival kit , 9 3 Fire and emergency management/Fire officer IV , 10 2 WikiJournal Preprints/Template:Flagicon

jan 2006: 1 7 Digital Signature , 2 6 WikiJournal Preprints/Template:Main , 3 6 WikiJournal Preprints/Template:Cite journal , 4 4 Houseplant care/Houseplant , 5 3 Electric Mobility/Engineering/Aerodynamics , 6 2 Photogrammetry , 7 2 Swarm intelligence , 8 2 Volleyball/Template:JPN , 9 2 Plant propagation , 10 2 Progressive education

fev 2006: 1 15 Electric Mobility/Engineering/Aerodynamics , 2 7 WikiJournal Preprints/Template:Cite web , 3 4 Wikiversity-Translation practice course , 4 3 WikiJournal Preprints/Template:Cite journal , 5 3 WikiJournal Preprints/Template:Cite book , 6 3 Arboriculture/Pruning , 7 3 Geochronology/Ice cores , 8 3 Houseplant care/Houseplant , 9 3 Digital Signature , 10 3 Jet engine performance , 11 2 Swarm intelligence , 12 2 Drinking water/Solar disinfection , 13 2 Operating Systems/Unix/Security , 14 2 Fire and emergency management/Hazardous Materials

mar 2006: 1 7 WikiJournal Preprints/Template:Cite web , 2 7 Electric Mobility/Engineering/Aerodynamics , 3 6 WikiJournal Preprints/Template:Cite journal , 4 5 WikiJournal Preprints/Template:Cite book , 5 5 Introduction to political science , 6 5 Very Small Information Systems/Spring 2006 , 7 4 Wikiversity-Translation practice course , 8 4 Political theory , 9 3 Swarm intelligence , 10 3 Operating Systems/Unix/Security , 11 3 Geochronology/Ice cores , 12 3 Houseplant care/Houseplant , 13 3 Very Small Information Systems , 14 2 WikiJournal Preprints/Hepatitis E , 15 2 Arboriculture/Pruning , 16 2 Plant propagation/Cloning , 17 2 Bible/King James/Documentary Hypothesis/Deuteronomist source/Secondary Deuteronomist Additions/Blessing of Moses , 18 2 Fire and emergency management/Wildland fire fighter I , 19 2 Transwiki:Wikiversity-School of Fire and Emergency Management/Water Rescue Awareness , 20 2 Fire and emergency management/Public Safety Telecommunicator II , 21 2 Fire and emergency management/Public safety telecommunicator I , 22 2 Fire and emergency management/Public Safety Telecommunicator , 23 2 Fire and emergency management/Fire and Life Safety Educator III

abr 2006: 1 9 WikiJournal Preprints/Template:Cite journal , 2 8 WikiJournal Preprints/Template:Cite book , 3 7 WikiJournal Preprints/Template:Cite web , 4 6 Digital Signature , 5 5 Wikiversity-Translation practice course , 6 4 Operating Systems/Unix/Security , 7 4 Houseplant care/Houseplant , 8 3 WikiJournal Preprints/Template:Main , 9 3 IB History Review Guide , 10 2 Electric Mobility/Engineering/Aerodynamics , 11 2 Low-Cost Precision Farming , 12 2 Geochronology/Ice cores , 13 2 Plant propagation , 14 2 Survival kit , 15 2 IB History Review Guide/Totalitarian Europe , 16 1 WikiJournal Preprints/Hepatitis E

mai 2006: 1 15 WikiJournal Preprints/Template:Cite web , 2 9 Digital Signature , 3 7 WikiJournal Preprints/Template:Cite book , 4 6 Electric Mobility/Engineering/Aerodynamics , 5 6 Teaching Assistant in France Survival Guide/Directory , 6 5 Introduction to C programming/EnrollmentPage , 7 4 Drinking water/Distillation , 8 4 Operating Systems/Unix/Security , 9 4 Hexpixel Code , 10 4 Introduction to Philosophy , 11 3 Experiment/In vitro , 12 3 Romance of the Three Kingdoms , 13 2 WikiJournal Preprints/Template:Cite journal , 14 2 Photogrammetry , 15 2 Low-Cost Precision Farming , 16 2 Houseplant care/Houseplant , 17 2 Survival kit

jun 2006: 1 11 WikiJournal Preprints/Template:Cite web , 2 6 WikiJournal Preprints/Template:Cite book , 3 5 Houseplant care/Houseplant , 4 4 WikiJournal Preprints/Template:Cite journal , 5 4 Electric Mobility/Engineering/Aerodynamics , 6 4 Drinking water/Scarcity , 7 4 Operating Systems/Unix/Security , 8 4 Aquaria/Congo tetras , 9 4 Digital Signature , 10 3 Survival kit , 11 3 Wikiversity-Translation practice course , 12 1 WikiJournal Preprints/Template:Main

jul 2006: 1 10 Digital Signature , 2 8 WikiJournal Preprints/Template:Cite book , 3 7 Geochronology/Ice cores , 4 6 WikiJournal Preprints/Template:Cite web , 5 6 WikiJournal Preprints/Template:Cite journal , 6 3 Operating Systems/Unix/Security , 7 3 Introduction to C programming/EnrollmentPage , 8 3 Teaching Assistant in France Survival Guide/Directory , 9 3 Computer Architecture Lab/Summer2006 , 10 2 WikiJournal Preprints/Template:Flagicon/core , 11 2 Electric Mobility/Engineering/Aerodynamics , 12 2 Visual C++ name mangling , 13 2 Houseplant care/Houseplant , 14 2 Experiment/In vitro , 15 2 Towards a better India/Major Problems , 16 2 IB History Review Guide/The USSR and Stalin , 17 2 Speech fundamentals , 18 2 Introduction to political science , 19 2 Computer Architecture Lab , 20 1 WikiJournal Preprints/Template:Main

ago 2006: 1 11 Hello, world! , 2 8 Physics Bachelor of Science , 3 7 College Algebra , 4 7 Houseplant care/Houseplant , 5 7 Digital Signature , 6 6 Wikiversity the Movie , 7 6 Introduction to physics/lecture , 8 5 Electric Mobility/Engineering/Aerodynamics , 9 5 Hitler's Germany , 10 5 Network+/Architecture/Media/Introduction , 11 5 Introduction to German , 12 4 WikiJournal Preprints/Template:Main , 13 4 Swarm intelligence , 14 4 Astronomy Project , 15 4 Calculus , 16 4 Basic thermodynamics , 17 4 English as a second language , 18 4 Engineering Help Desk , 19 4 Saxophone , 20 4 Abnormal psychology , 21 4 Psychology , 22 4 SLS Reading List , 23 4 Financial Accounting , 24 4 Freelance academics , 25 4 Ecological sustainability

set 2006: 1 14 Drinking water/Scarcity , 2 11 Media literacy , 3 9 Hitler's Germany , 4 7 Chain mail , 5 7 Hello, world! , 6 6 Houseplant care/Houseplant , 7 6 Computer science program , 8 5 WikiJournal Preprints/Hepatitis E , 9 5 WikiJournal Preprints/Template:Cite book , 10 5 Electric Mobility/Engineering/Aerodynamics , 11 5 Main Page/Concept/2006/August/Content , 12 5 Main Page/Concept/2006/August/Communications and community , 13 5 Wikiversity the Movie/Interviews , 14 5 Introduction to Computer Science , 15 5 Plagiarism , 16 5 Calculus/Limits , 17 5 Wikiversity the Movie , 18 5 Great Debates in Media Literacy , 19 5 Ohm's law , 20 4 Aquaria/Glowlight tetras , 21 4 Types and variables , 22 4 Hedonic modelling , 23 4 Chain mail/Getting Rings , 24 4 Political science , 25 4 Cell biology

out 2006: 1 12 Computer Architecture Lab/WS2006 , 2 9 Hello, world! , 3 8 Electric Mobility/Engineering/Aerodynamics , 4 7 Media literacy , 5 6 Introduction to PHP , 6 6 Great Debates in Media Literacy , 7 4 WikiJournal Preprints/Template:Flagicon , 8 4 Computer Architecture Lab/Winter2006/PoettschacherRosenblattlWolf/iMISC , 9 4 Computer Architecture Lab/Winter2006/LechnerWalterStadlerTrinkl/Workplace , 10 4 Computer Architecture Lab/Winter2006/JeitMossFrühRamb/ThreeMicroDiscussion , 11 4 Computer Architecture Lab , 12 4 Free online peer reviewed journals , 13 4 Philosophy of science , 14 4 Learning Java/Basic Java Language , 15 4 Fundamentals of Music , 16 4 Hitler's Germany , 17 3 College Algebra , 18 3 Aquaria/Glowlight tetras , 19 3 Houseplant care/Houseplant , 20 3 Digital Signature , 21 3 Computer Architecture Lab/Winter2006/PoettschacherRosenblattlWolf/ThreeMicroDiscussion , 22 3 Computer Architecture Lab/Winter2006/LechnerWalterStadlerTrinkl/ThreeMicroDiscussion , 23 3 Computer Architecture Lab/FPGA Hello World Example , 24 3 Quenya/Root Words , 25 3 Quenya

nov 2006: 1 8 Electric Mobility/Engineering/Aerodynamics , 2 7 Spanish/Students , 3 6 Football (soccer) , 4 6 Facilitating Online , 5 6 Random number , 6 5 Visual Basic/Control Structures and Logical Expressions , 7 4 Introduction to Calculus/Quiz 1 , 8 4 Theoretical physics , 9 4 CisLunarFreighter/Introduction to game design and production processes , 10 4 Spanish , 11 4 Networked Learning , 12 4 Introductory Ancient Greek Language/Lesson 1 , 13 4 Learning Java/Introduction to Java , 14 4 Japanese stream , 15 4 Political science , 16 4 Wikiversity translations , 17 4 Wiki , 18 4 Hello, world! , 19 4 Other Free Learning Resources , 20 3 Drinking water/Scarcity , 21 3 Drinking water/Distillation , 22 3 Digital Signature , 23 3 The Special Cubic Formula , 24 3 Typography , 25 3 School of Mathematics Help Desk

dez 2006: 1 13 Spanish/Students , 2 12 Survival kit , 3 12 Learning to learn a wiki way , 4 9 Electric Mobility/Engineering/Aerodynamics , 5 6 WikiJournal Preprints/Template:Reflist , 6 6 One Laptop Per Teacher , 7 5 Houseplant care/Houseplant , 8 5 Convolution , 9 5 Historical Introduction to Philosophy/Arguments for God , 10 5 Historical Introduction to Philosophy/Faith and Reason , 11 5 Screensaver Project , 12 5 Russian Revolution , 13 4 Learning the basics of French , 14 4 Collaborate and Create In-service , 15 4 C++ , 16 4 Historical Introduction to Philosophy/General Introduction , 17 4 Computer Communications , 18 4 Women's studies , 19 3 WikiJournal Preprints/Template:Cite web , 20 3 Drinking water/Scarcity , 21 3 Arboriculture/Pruning , 22 3 Aquaria/Salt and pepper catfish , 23 3 Aquaria/Lemon tetras , 24 3 Plant propagation/Cloning , 25 3 Digital Signature

jan 2007: 1 17 Spanish/Students , 2 10 C++ , 3 9 Hitler's Germany , 4 8 Electric Mobility/Engineering/Aerodynamics , 5 6 Arabic/Roster , 6 6 Learning the Basics of French/Lesson:Introducing Yourself/1 , 7 5 Arboriculture/Pruning , 8 5 Survival kit , 9 5 Introduction to Programming , 10 4 Project proposal:global warming/Brainstorming , 11 4 Skype , 12 4 Web Page/Dreamweaver/links , 13 4 Web Page/Flash/Project 1 , 14 4 C/Variables and Expressions , 15 4 Everyday Japanese phrases , 16 4 Indian Law , 17 4 WINAPI Programming , 18 4 Toward a theory of corporate governance in China's socialist market economy , 19 4 Boolean algebra , 20 4 Introductory Ancient Greek Language/Review , 21 4 C/Flow Control , 22 4 C/Before You Start , 23 4 Sunken relief , 24 4 Historical Introduction to Philosophy/Ethics , 25 4 Historical Introduction to Philosophy/Personal Identity

fev 2007: 1 29 Spanish/Registration , 2 15 Electric Mobility/Engineering/Aerodynamics , 3 10 Survival kit , 4 9 Spanish/Students , 5 7 Digital Signature , 6 6 Instructional Design , 7 5 Instructional design/Affective behaviors , 8 5 Instructional design/Psychomotor behaviors , 9 5 C++ , 10 5 Conic sections , 11 5 Creationism/Science teaching materials , 12 4 Historical Introduction to Philosophy/Theories of Mind , 13 4 Historical Introduction to Philosophy/General Introduction , 14 4 Getting started with sound recording , 15 4 Introduction to Programming , 16 3 WikiJournal Preprints/Template:Cite journal , 17 3 Web development , 18 3 College Algebra , 19 3 Houseplant care/Houseplant , 20 3 WikiCast , 21 3 Network Administration , 22 3 Developing Scripts and Case Studies for cisLunarFreighter/Radio Communications/STC/implementation , 23 3 Science and the nonphysical , 24 3 CisLunarFreighter/Scripts and case studies/Radio communications/Space traffic control , 25 3 Fundraising

mar 2007: 1 25 Spanish/Students , 2 17 Electric Mobility/Engineering/Aerodynamics , 3 12 Spanish/Registration , 4 9 Teletraffic engineering , 5 7 Action research/AREOL25 , 6 7 C++ , 7 6 Survival kit , 8 6 Spanish: An Introduction , 9 5 Photogrammetry , 10 5 Digital Signature , 11 5 Instructional design/Affective behaviors , 12 5 Japanese I/Vocabulary/Intro , 13 4 WikiJournal Preprints/Template:Cite journal , 14 4 Swarm intelligence , 15 4 Houseplant care , 16 4 Concept Classification, Page 4 , 17 4 Concept Classification, Page 2 , 18 4 Teletraffic engineering/Limited availability , 19 4 Teletraffic engineering/What is Congestion control? , 20 4 Pre-school education , 21 4 Instructional design/Psychomotor behaviors , 22 4 Historical Introduction to Philosophy/Descartes Scratch Page , 23 3 Drinking water/Scarcity , 24 3 Houseplant care/Houseplant , 25 3 Introduction to algebra and calculus

abr 2007: 1 9 Electric Mobility/Engineering/Aerodynamics , 2 7 Geochronology/Ice cores , 3 7 Spanish: An Introduction , 4 6 Digital Signature , 5 6 German stream , 6 5 Houseplant care/Houseplant , 7 5 Survival kit , 8 5 Quiz , 9 5 English Language Reference Desk , 10 5 Legendre differential equation , 11 4 WikiJournal Preprints/Template:Cite book , 12 4 Swarm intelligence , 13 4 Invariant Tasks: Skill Builder Practice , 14 4 Bloom clock project/Seen Lately (Northern Hemisphere) , 15 4 Spanish/Bilingual Spanish-English Dictionary , 16 4 Instructional design/Psychomotor behaviors/Introduction , 17 4 Skill Builder: Invariant Tasks Synthesis , 18 4 Instructional design/Affective behaviors/What is the Affective Domain? , 19 4 Web Design/Embedded CSS Embedded CSS , 20 4 Wikimania/2007 , 21 4 Instructional design/Cognitive behaviors , 22 4 Requested kanji diagrams , 23 4 Japanese I/Vocabulary/Intro , 24 4 Research grant collaboration group , 25 4 Humane Quality

mai 2007: 1 10 Electric Mobility/Engineering/Aerodynamics , 2 7 German stream , 3 7 Spanish/Students , 4 6 Digital Signature , 5 6 Spanish: An Introduction , 6 5 C++ , 7 4 Drinking water/Scarcity , 8 4 Houseplant care/Houseplant , 9 4 WikiCast , 10 4 Teaching Assistant in France Survival Guide/Directory , 11 4 Generating dynamic content with MediaWiki , 12 4 Debugging Challenges , 13 4 Adobe Illustrator/Introduction , 14 4 Ear training/Perfect pitch , 15 4 C++/Classes and Inheritance , 16 4 Sundance Raphael/poem/Entfesselt , 17 4 Spanish: An Introduction/About Spanish , 18 4 Science and the nonphysical , 19 4 Fundraising , 20 4 Bloom Clock/2007 part one , 21 4 School of Mathematics Help Desk , 22 4 Filmmaking Basics/Thumbnail Storyboard/Step by Step/b , 23 4 Wiki Campus Radio , 24 4 Test and Quiz , 25 4 Wikiversity the Movie

jun 2007: 1 9 Electric Mobility/Engineering/Aerodynamics , 2 7 German stream , 3 6 Drinking water/Scarcity , 4 6 Digital Signature , 5 6 Wikipedia service-learning courses , 6 6 Bloom Clock/Contributors , 7 5 Swarm intelligence , 8 4 Colonial America , 9 4 Introduction to Wikiversity , 10 4 Bloom Clock/2007 part one , 11 4 C++ , 12 3 Low-Cost Precision Farming , 13 3 New media arts , 14 3 Nursing , 15 3 BCP/Rudbeckia laciniata , 16 3 Islamic political thought/Muhammad's Life and his political contributions to the first Islamic State , 17 3 BCP/Alliaria petiolata , 18 3 Quiz , 19 3 Film Scoring/Creating the sound of fear , 20 3 Mad Max's - Computer Set Up for Film Scoring , 21 3 Graphic Design , 22 3 Learning to learn a wiki way , 23 3 Web Design/JavaScript Challenges , 24 3 Hitler's Germany , 25 3 Russian Revolution

jul 2007: 1 8 Electric Mobility/Engineering/Aerodynamics , 2 8 German stream , 3 7 Digital Signature , 4 7 Technical writing Requirements analysis , 5 7 Bloom Clock/2007 part two , 6 6 English Language Reference Desk , 7 6 Bloom Clock/Contributors , 8 5 College Algebra , 9 5 Photoproject , 10 4 Drinking water/Scarcity , 11 4 Operating Systems/Unix/Security , 12 4 Main page project , 13 4 Spanish: An Introduction/About Spanish , 14 4 Spanish: An Introduction , 15 4 C++ , 16 3 WikiJournal Preprints/Hepatitis E , 17 3 Volleyball/Template:Country data China , 18 3 Geochronology/Ice cores , 19 3 Houseplant care/Houseplant , 20 3 Plant propagation/Cloning , 21 3 New media arts , 22 3 Introduction to Christianity/The Christian Faith , 23 3 Futures studies , 24 3 Spanish/Students , 25 3 Graphic Design

ago 2007: 1 15 Technical writing , 2 12 Technical writing tools , 3 8 Technical writing Requirements analysis , 4 7 Houseplant care/Houseplant , 5 7 Bloom Clock/2007 part two , 6 7 Spanish/Students , 7 6 Bloom Clock/Contributors , 8 5 WikiJournal Preprints/Hepatitis E , 9 5 Electric Mobility/Engineering/Aerodynamics , 10 5 Drinking water/Scarcity , 11 5 College Algebra , 12 5 Geochronology/Ice cores , 13 5 Social Entrepreneurship Curriculum , 14 5 BCP/Phlox paniculata , 15 5 C++ , 16 4 WikiJournal Preprints/Template:Navbox , 17 4 Survival kit , 18 4 BCP/Echinacea purpurea/Logs , 19 4 BCP/Linaria vulgaris/Logs , 20 4 Technical writing research , 21 4 Introduction to Art History-- M. Davis , 22 4 Spanish: An Introduction/About Spanish , 23 4 Media literacy , 24 3 Photogrammetry , 25 3 Drinking water/Solar disinfection

set 2007: 1 43 Introduction to Computers/Processor , 2 42 Introduction to Computers/Peripherals , 3 32 Introduction to Computers/System software , 4 24 Introduction to Computers/Introduction , 5 10 Electric Mobility/Engineering/Aerodynamics , 6 8 Bloom Clock , 7 6 Drinking water/Scarcity , 8 6 Survival kit , 9 6 Bloom Clock/2007 part two , 10 6 C++ , 11 6 Technical writing , 12 6 Media literacy , 13 5 Intellectual Traditions in Media Literacy , 14 4 Making sense of quantum mechanics , 15 4 Cow eye dissection , 16 4 The Neurodiversity Movement , 17 4 BCP/Asclepias curassavica/Logs , 18 4 Nonlinear finite elements , 19 4 BCP/Oxalis stricta/Logs , 20 4 BCP/Trifolium repens/Logs , 21 4 BCP/Daucus carota/Logs , 22 4 BCP/Impatiens capensis/Logs , 23 4 BCP/Securigera varia/Logs , 24 4 BCP/Galium aristatum , 25 4 BCP/Hemerocallis fulva

out 2007: 1 36 Introduction to Computers/Application software , 2 36 Introduction to Computers/Personal , 3 35 Introduction to Computers/Security , 4 33 Introduction to Computers/Networks , 5 32 Introduction to Computers/Internet , 6 9 Electric Mobility/Engineering/Aerodynamics , 7 8 Computer Architecture Lab/WS2007 , 8 8 Bloom Clock/2007 part two , 9 6 Digital Signature , 10 6 The Crafting Freedom Project , 11 5 BCP/Trifolium pratense , 12 5 BCP/Trifolium repens , 13 5 BCP/Linaria vulgaris , 14 5 BCP/Oxalis stricta , 15 4 Drinking water/Scarcity , 16 4 Geochronology/Ice cores , 17 4 Survival kit , 18 4 Reading groups , 19 4 BCP/Rosa , 20 4 Harvard chart method , 21 4 Technical writing specification , 22 4 BCP/Aster divaricatus , 23 4 BCP/Solidago canadensis/Logs , 24 4 BCP/Solidago canadensis , 25 4 BCP/Oxalis stricta/Logs

nov 2007: 1 34 Introduction to Computers/AI , 2 33 Introduction to Computers/Databases , 3 32 Introduction to Computers/Development , 4 22 Introduction to Computers/Personal , 5 7 Electric Mobility/Engineering/Aerodynamics , 6 7 Swarm intelligence , 7 7 Learning theories in practice/Project-Based Language Learning , 8 7 Learning theories in practice/Content-Based Learning , 9 7 Ivan Illich: Deschooling Society , 10 7 Computer Architecture Lab/WS2007 , 11 6 Survival kit , 12 6 Learning theories in practice/Picture books , 13 6 Learning theories in practice , 14 6 Linux/Reading the Linux Kernel Sources , 15 6 Introduction to Computers/Security , 16 5 Learning theories in practice/WebQuests as Second Language contexts , 17 5 Learning theories in practice/Task-Based Learning , 18 5 Learning theories in practice/Self-Regulated Learning , 19 5 Learning theories in practice/Multiple Intelligences , 20 5 Learning theories in practice/Motivation , 21 5 Learning theories in practice/Language learning , 22 5 Reading groups , 23 4 Digital Signature , 24 4 BCP/Nepeta x faassenii , 25 4 Bloom Clock/2007 part two

dez 2007: 1 7 Electric Mobility/Engineering/Aerodynamics , 2 6 Wikipedia arbitration committee/Pedophilia userbox wheel war , 3 6 Wikipedia arbitration committee , 4 5 Swarm intelligence , 5 5 Drinking water/Scarcity , 6 5 Learning theories in practice , 7 5 Participant of the composing free and open online educational resources course , 8 4 Survival kit , 9 4 Main page learning project/QOTD , 10 4 Fairy Rings , 11 4 Composing free and open online educational resources , 12 4 Reading groups , 13 4 Bloom Clock/Unknown Plants , 14 4 Learning to learn a wiki way , 15 3 WikiJournal Preprints/Hepatitis E , 16 3 Photogrammetry , 17 3 Aquaria/Glowlight tetras , 18 3 Geochronology/Ice cores , 19 3 Progressive education , 20 3 Lunarpedia , 21 3 Museum photography , 22 3 Main page learning project , 23 3 Stanford Open Source Lab , 24 3 Holidays of Hope , 25 3 Ivan Illich: Deschooling Society

jan 2008: 1 21 Introduction to Computers/Peripherals , 2 19 Introduction to Computers/Introduction , 3 17 Introduction to Computers/System software , 4 16 Introduction to Computers/Processor , 5 13 Vital Ideation , 6 11 Participant of the composing free and open online educational resources course , 7 10 Electric Mobility/Engineering/Aerodynamics , 8 10 Survival kit , 9 6 Future media class/Media Fads Versus Paradigm Shifts , 10 5 Arboriculture/Pruning , 11 5 Main page learning project/QOTD , 12 4 Houseplant care/Houseplant , 13 4 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Vegetation , 14 4 Future media class , 15 4 Museum photography , 16 4 Main page learning project , 17 4 C++ , 18 3 Photogrammetry , 19 3 Swarm intelligence , 20 3 Digital Signature , 21 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Study Area , 22 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Introduction , 23 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba , 24 3 Future media class/Media Convergence , 25 3 Future media class/Emerging Technologies: Preparing For The Next Job Market

fev 2008: 1 36 Participant of the composing free and open online educational resources course , 2 18 Introduction to Computers/Application software , 3 17 Introduction to Computers/Networks , 4 15 Introduction to Computers/Personal , 5 9 Electric Mobility/Engineering/Aerodynamics , 6 8 Survival kit , 7 6 Software Process Improvement Models , 8 5 World History/Global Civilization I , 9 5 Composing free and open online educational resources , 10 4 Arboriculture/Pruning , 11 4 Software metrics and measurement , 12 4 Agile software development , 13 4 Wikiversity learning model/Discussion group , 14 4 Main page learning project/QOTD , 15 4 Thucydides: The Peloponnesian War , 16 3 WikiJournal Preprints/Template:Cite journal , 17 3 Low-Cost Precision Farming , 18 3 Aquaria/Lemon tetras , 19 3 Houseplant care/Houseplant , 20 3 Wittgenstein reading group , 21 3 Software process management , 22 3 TEFL-TESOL , 23 3 Third Law of Thermodynamics , 24 3 Radio Discussion/Living on Earth/2008.1.18/Segment 4 , 25 3 Radio Discussion/Living on Earth/2008.1.18

mar 2008: 1 15 Introduction to Computers/Security , 2 14 Introduction to Computers/Databases , 3 14 Introduction to Computers/Internet , 4 13 Electric Mobility/Engineering/Aerodynamics , 5 12 Participant of the composing free and open online educational resources course , 6 11 Introduction to Computers/Development , 7 7 Learning the basics of French/Participants , 8 6 Open educational resources and globalization , 9 6 Composing free and open online educational resources , 10 5 Living With a Narcissist , 11 5 Design for the Environment/Office Chair Foam , 12 5 Education and collaboration , 13 5 BCP/Crocus/Logs , 14 5 Bloom Clock/Master List , 15 5 Thucydides: The Peloponnesian War , 16 5 BCP/Stellaria media/Logs , 17 5 Bloom Clock/Unknown Plants , 18 5 Futures studies , 19 5 Bloom Clock/Contributors , 20 4 Drinking water/Scarcity , 21 4 Survival kit , 22 4 Workshop for Australian education policy , 23 4 Composing free and open online educational resources/Participants , 24 4 Introduction to Futures Studies , 25 4 Creating development environments

abr 2008: 1 37 Design for the Environment , 2 16 Introduction to Computers/AI , 3 9 Electric Mobility/Engineering/Aerodynamics , 4 9 BCP/Forsythia x intermedia/Logs , 5 8 Writing discipline specific research papers , 6 8 BCP/Taraxacum officinale/Logs , 7 7 Introduction to Computers/Personal , 8 6 Progressive education , 9 6 Survival kit , 10 6 Design for the Environment/Metal Cleaning , 11 6 Design for the Environment/Bus Fuel Alternatives , 12 6 DFE2008 Oil Sands Extraction Technique , 13 6 Design for the Environment/Disposable Water Bottle , 14 6 Design for the Environment/Internal Combustion Engines , 15 6 DFE2008 Power Generation , 16 6 Design for the Environment/Grocery Bags , 17 6 Design for the Environment/Residential Roofing Materials , 18 6 Instructional design/Content prioritization , 19 6 BCP/Narcissus/Logs , 20 6 BCP/Lamium purpureum/Logs , 21 6 BCP/Forsythia x intermedia , 22 6 BCP/Taraxacum officinale , 23 5 Drinking water/Distillation , 24 5 Plant propagation/Cloning , 25 5 Digital Signature

mai 2008: 1 8 Composing free and open online educational resources/Critique and feedback , 2 8 C , 3 7 Electric Mobility/Engineering/Aerodynamics , 4 7 Drinking water/Scarcity , 5 7 Survival kit , 6 6 Digital Signature , 7 6 Bloom Clock/Master List , 8 6 Bloom Clock/Unknown Plants , 9 6 BCP/Forsythia x intermedia , 10 6 BCP/Taraxacum officinale , 11 5 Arbitrary Hour , 12 5 BCP/Convallaria majalis , 13 5 BCP/Tulipa , 14 5 BCP/Syringa vulgaris/Logs , 15 5 BCP/Aesculus hippocastanum/Logs , 16 5 BCP/Taraxacum officinale/Logs , 17 5 Bloom Clock/Contributors , 18 4 BCP/Convallaria majalis/Logs , 19 4 Learning the basics of French/Introducing Yourself , 20 4 How to be a Wikimedia sysop , 21 4 BCP/Tulipa/Logs , 22 4 BCP/Rhododendron , 23 4 BCP/Forsythia x intermedia/Logs , 24 4 BCP/Syringa vulgaris , 25 4 BCP/Narcissus

jun 2008: 1 9 Digital Signature , 2 7 Electric Mobility/Engineering/Aerodynamics , 3 6 Composing free and open online educational resources/Participants/Next start , 4 6 Arbitrary Hour , 5 6 Electric Circuit Analysis/Circuit Analysis Quiz 1 , 6 5 WikiJournal Preprints/Template:Cite journal , 7 5 Open science , 8 5 Collective learning , 9 5 Open educational resources and globalization , 10 5 Bloom Clock/Master List , 11 5 BCP/Iris/Logs , 12 5 C , 13 4 Drinking water/Distillation , 14 4 Houseplant care/Houseplant , 15 4 Medical School Curriculum , 16 4 How to design programs , 17 4 Chess , 18 4 OpenOffice.org , 19 4 Brain Imaging , 20 4 Composing free and open online educational resources/Participants , 21 4 Bloom Clock/Unknown Plants , 22 4 Anthropomorphic Robotics Project , 23 4 Real estate , 24 4 Post-structuralism , 25 4 CisLunarFreighter

jul 2008: 1 14 Wikimedia Ethics , 2 7 Drinking water/Solar disinfection , 3 7 Wikimedia Ethics/Brainstorming , 4 6 Wikimedia Ethics/Introduction , 5 6 Wikimedia Ethics/Suggested essays , 6 4 Wikimedia Ethics/Ethics on Wikipedia and the Internet , 7 4 Wikimedia Ethics/Overview , 8 4 Composing free and open online educational resources/Participants/Next start , 9 4 Electric Circuit Analysis/Passive Sign Convention , 10 3 WikiJournal Preprints/Template:Cite book , 11 3 Photogrammetry , 12 3 Drinking water/Scarcity , 13 3 Living With a Narcissist , 14 3 Houseplant care/Houseplant , 15 3 Experiment/In vitro , 16 3 Survival kit , 17 3 Digital Signature , 18 3 Democracy Project , 19 3 Wikiversity community blog , 20 3 Precipitation detection , 21 3 Optimal classification , 22 3 Lecture 2.0 , 23 3 Spanish 1 , 24 3 Firefox , 25 3 English classics

ago 2008: 1 13 Wikimedia Ethics/Case Studies/Case 1 , 2 10 Wikimedia Ethics/Participants and objectives , 3 8 Expanding your professional vocabulary , 4 8 Wikimedia Ethics , 5 7 Drinking water/Scarcity , 6 7 Wikimedia Ethics/Feedback 1 , 7 7 Composing free and open online educational resources/Participants/Next start , 8 6 Digital Signature , 9 6 Wikimedia Ethics/Case Studies , 10 6 OLPC peripheral development , 11 5 Survival kit , 12 5 Wikimedia Ethics/Case Studies2 , 13 5 Follicular Dendritic Cells , 14 5 Wikimedia Ethics/List of questions , 15 4 Wikimedia Ethics/Moulton, JWSchmidt's investigation , 16 4 Wikimedia Ethics/Feedback 2 , 17 4 Lecture 2.0 , 18 4 Social psychology (psychology)/Assessment/Essay/Topics , 19 4 Wikimedia Ethics/Overview , 20 4 Wikimedia Ethics/Brainstorming , 21 3 Progressive education , 22 3 Wikimedia Ethics/Social contract , 23 3 Wikiversity the Movie/Kickoff meeting , 24 3 Wikiversity participants who choose to leave , 25 3 Assuming good faith

set 2008: 1 19 Expanding your professional vocabulary , 2 11 Electric Mobility/Engineering/Aerodynamics , 3 11 Learning from conflict and incivility , 4 10 Wikimedia Ethics/Moulton, JWSchmidt's investigation , 5 8 Survival kit , 6 8 Wikimedia Ethics/Case Studies/Concordances, Dossiers, Scathing Indictments, and Ethics , 7 8 Wikimedia Ethics , 8 7 Wikimedia Ethics/Case Studies/Biographies of Living People , 9 7 Wikimedia Ethics/Case Studies/Case 1 , 10 6 Geochronology/Ice cores , 11 6 Ethical Management of the English Language Wikiversity/Case Studies/Deletionism , 12 6 Wikimedia Ethics/Case Studies , 13 5 WikiJournal Preprints/Template:Cite web , 14 5 Geographic coordinate conversion , 15 5 Creationism/Intelligent design/Study project , 16 5 Wikimedia Ethics/Moulton, JWSchmidt's investigation/Final report , 17 5 Painting/Acrylic Painting Development Ideas , 18 5 Web design , 19 5 Etiquette , 20 4 WikiJournal of Science/Spaces in mathematics , 21 4 Progressive education , 22 4 University of Florida/Eml4500/f08.qwiki , 23 4 University of Florida/Eml4500/f08.FEABBQ/HW1 , 24 4 Eas4200c.f08.radsam/Structures and Materials , 25 4 Study Guide:Mathematical Mesoscopic Physics/Mesoscopic Physics Glossary

out 2008: 1 57 Internet and Project Competence , 2 11 Electric Mobility/Engineering/Aerodynamics , 3 10 Computer Architecture Lab/WS2008 , 4 8 Digital Signature , 5 7 Expanding your professional vocabulary , 6 6 Consensus in a wiki environment/An introduction to Consensus , 7 6 Open Source ERP/Executive Diploma , 8 5 Survival kit , 9 5 Internet and Project Competence/groups , 10 5 Consensus in a wiki environment , 11 5 Random , 12 4 WikiJournal Preprints/Template:Cite journal , 13 4 Consensus in a wiki environment/Measuring Consensus , 14 4 Managing a private wiki , 15 4 Introduction to US History/Justification , 16 4 Web 2.0 for Professional Use/Blogs and Blogging , 17 4 Introduction to US History , 18 4 Beowulf , 19 4 Wikimedia Ethics , 20 4 Introduction to German , 21 3 Photogrammetry , 22 3 Swarm intelligence , 23 3 Geochronology/Ice cores , 24 3 Houseplant care/Houseplant , 25 3 Progressive education

nov 2008: 1 12 French/Mentoring/Participants , 2 8 Electric Mobility/Engineering/Aerodynamics , 3 8 Internet and Project Competence , 4 7 Drinking water/Scarcity , 5 6 Digital Signature , 6 6 Internet and Project Competence/group4 , 7 6 English Language Reference Desk , 8 5 7d Physics , 9 5 Internet and Project Competence/group3 , 10 5 Expanding your professional vocabulary , 11 5 Wiki Campus Radio , 12 4 Houseplant care/Houseplant , 13 4 Progressive education , 14 4 Plant propagation/Cloning , 15 4 Amateur astronomy/Initial experiences , 16 4 History of Europe to 1648 , 17 4 Stargazing , 18 4 Biomembrane Transport , 19 4 Internet and Project Competence/group6a , 20 4 Random , 21 4 Wikipedia , 22 4 Wikipedia service-learning courses , 23 3 WikiJournal Preprints/Template:Cite journal , 24 3 Swarm intelligence , 25 3 Experiment/In vitro

dez 2008: 1 8 Comparison between Roman and Han Empires , 2 5 Geochronology/Ice cores , 3 5 7d Physics , 4 5 English Language Reference Desk , 5 4 Electric Mobility/Engineering/Aerodynamics , 6 4 Swarm intelligence , 7 4 Houseplant care/Houseplant , 8 4 Survival kit , 9 4 Internet and Project Competence/group5 , 10 4 Internet and Project Competence/group1 , 11 3 WikiJournal Preprints/Template:Cite web , 12 3 WikiJournal Preprints/Template:Cite book , 13 3 Photogrammetry , 14 3 Drinking water/Scarcity , 15 3 Operating Systems/Unix/Security , 16 3 Plant propagation , 17 3 Ethics/Nonkilling/Political Science , 18 3 Being a sustainable engineer , 19 3 Internet and Project Competence/group6a , 20 3 Internet and Project Competence/group3 , 21 3 Internet and Project Competence/group2 , 22 3 United States Law/Introduction , 23 2 WikiJournal Preprints/Hepatitis E , 24 2 Experiment/In vitro , 25 2 Learning theories in practice

jan 2009: 1 14 Electric Mobility/Engineering/Aerodynamics , 2 5 HTML , 3 4 WikiJournal Preprints/Template:Cite web , 4 4 Swarm intelligence , 5 4 Houseplant care/Houseplant , 6 4 Experiment/In vitro , 7 4 Survival kit , 8 4 Digital Signature , 9 4 Conservation Entrepreneurship/Resources , 10 4 Egyptology/Monuments project , 11 4 Wikipedia and the 2008 US elections , 12 4 Wikis in scholarly communication , 13 4 Museum photography , 14 4 Web design , 15 3 Geochronology/Ice cores , 16 3 Progressive education , 17 3 Evolutionary Synthesis , 18 3 Theology as Seen in Prophets and Psalms , 19 3 Djoser's Step Pyramid in Saqqara , 20 3 Conservation Entrepreneurship/Business Plans/Examples , 21 3 Artificial Consciousness/(AC) , 22 3 Conservation Entrepreneurship/Business Plans , 23 3 Appropedia , 24 3 Brezhoneg Unan/Lesson 1/Saludiñ/Quiz , 25 3 Conservation Entrepreneurship/Definition

fev 2009: 1 17 Electric Mobility/Engineering/Aerodynamics , 2 7 Open Source ERP/Class01 , 3 6 Conservation Entrepreneurship/Local Initiatives , 4 5 Houseplant care/Houseplant , 5 5 Progressive education , 6 5 Learning the basics of French/Participants , 7 4 Plant propagation/Cloning , 8 4 Spacetime metrics explained for biologists , 9 4 Conservation Entrepreneurship/Resources , 10 4 Conservation Entrepreneurship , 11 4 Introduction to Programming/About Programming , 12 3 Swarm intelligence , 13 3 Drinking water/Scarcity , 14 3 Survival kit , 15 3 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition , 16 3 Conservation Entrepreneurship/Community Projects , 17 3 Pandemic flu , 18 3 Introduction to Non-Genetic Darwinism/Physics of Self-Organization , 19 3 Introduction to Non-Genetic Darwinism/Darwin's Theory of Natural Selection , 20 3 Introduction to Non-Genetic Darwinism/Non-Biological Darwinism , 21 3 Introduction to Non-Genetic Darwinism/Darwinism, Culture and Philosophy , 22 3 Conservation Entrepreneurship/Assignments , 23 3 Introduction to Non-Genetic Darwinism , 24 3 Conservation Entrepreneurship/Class Outlines and Readings , 25 3 GreySmith Courseware Forum

mar 2009: 1 13 Electric Mobility/Engineering/Aerodynamics , 2 8 Digital Signature , 3 4 Swarm intelligence , 4 4 Low-Cost Precision Farming , 5 3 WikiJournal Preprints/Template:Navbox , 6 3 Houseplant care/Houseplant , 7 3 Software testing , 8 3 Filmmaking Basics/Introduction , 9 3 Design for the Environment , 10 3 C , 11 2 Photogrammetry , 12 2 Drinking water/Scarcity , 13 2 Arboriculture/Pruning , 14 2 Geochronology/Ice cores , 15 2 Houseplant care , 16 2 Experiment/In vitro , 17 2 Progressive education , 18 2 Microprocessors/Learning project , 19 2 C Programming , 20 2 Introduction to C programming/Hello World , 21 2 Introduction to C programming/What you need before you can learn , 22 2 Artificial Consciousness/Neural Correlates/Inter-Organ Connection Models/Cerebral Hippocampus Connections , 23 2 Chimpanzee , 24 2 Research Mentoring Program , 25 2 Reflections on Feuer

abr 2009: 1 16 Design for the Environment , 2 10 ISO 639-1 language matrix , 3 8 Electric Mobility/Engineering/Aerodynamics , 4 6 Geochronology/Ice cores , 5 6 Survival kit , 6 6 Design for the Environment/Power Generation for Ontario , 7 5 Design for the Environment/Alternatives To Traditional Book Publishing , 8 5 Design for the Environment/Flashlights , 9 5 Design for the Environment/Energy Storage for Wind Power Generation , 10 5 Design for the Environment/Residential Heating and Cooling , 11 5 Design for the Environment/Disposable Coffee Cups , 12 5 Design for the Environment/Automobile Engines III , 13 5 Random , 14 4 WikiJournal Preprints/Template:Cite web , 15 4 Design for the Environment/All Purpose Residential Cleaning , 16 4 Design for the Environment/Hydrogen Production , 17 4 Design for the Environment/Worldwide Package Cushioning , 18 4 Design for the Environment/Converting Garbage to Energy , 19 4 C++ , 20 3 WikiJournal Preprints/Hepatitis E , 21 3 Drinking water/Solar disinfection , 22 3 Drinking water/Distillation , 23 3 Progressive education , 24 3 Digital Signature , 25 3 Jet engine performance

mai 2009: 1 6 Electric Mobility/Engineering/Aerodynamics , 2 5 Digital Signature , 3 5 Learning the basics of French/Participants , 4 4 Drinking water/Distillation , 5 4 Fuel oil management system , 6 4 Plant propagation/Cloning , 7 4 Data Analysis using the SAS Language , 8 4 French/Mentoring/Participants , 9 4 Wikiversity Reports , 10 3 WikiJournal Preprints/Template:Cite web , 11 3 Geochronology/Ice cores , 12 3 Jet engine performance , 13 3 Learning by failing , 14 3 Numerical Linear Algebra , 15 3 C++ , 16 2 WikiJournal Preprints/Hepatitis E , 17 2 WikiJournal Preprints/Template:Navbox , 18 2 WikiJournal Preprints/Template:Cite journal , 19 2 Swarm intelligence , 20 2 Drinking water/Solar disinfection , 21 2 Drinking water/Scarcity , 22 2 Example of a non-associative algebra , 23 2 Living With a Narcissist , 24 2 Arboriculture/Pruning , 25 2 Plant propagation

jun 2009: 1 10 Web 2.0 , 2 4 Electric Mobility/Engineering/Aerodynamics , 3 4 Northern Arizona University/Socialism , 4 4 NAU-POS254-Classical liberalism and conservatism , 5 4 Introduction to the Dutch language , 6 4 C++ , 7 3 Introduction to the Dutch language/Lesson 1: Greetings , 8 3 NAU-POS254-Radical challenges to Enlightenment Ideologies , 9 3 Carlos Castaneda , 10 3 NAU-POS254-Fascism , 11 3 Random , 12 3 Featured content/9 , 13 3 Learning the basics of French/Participants , 14 3 Zen proverb , 15 3 English Language Reference Desk , 16 2 WikiJournal Preprints/Template:Cite web , 17 2 Progressive education , 18 2 Survival kit , 19 2 Digital Signature , 20 2 Learning theories in practice/Behavioral changes , 21 2 Jet engine performance , 22 2 Lesson 2: To Be in Dutch , 23 2 Aquaria/Reefkeeping , 24 2 Underwater Diving , 25 2 Anatomy/Thorax

jul 2009: 1 18 United Kingdom Law/Great Repeal Bill 2008 , 2 17 Facilitating Online/Participants , 3 8 United Kingdom Law/Great Repeal Bill 2008/Debate , 4 4 WikiJournal Preprints/Hepatitis E , 5 4 Low-Cost Precision Farming , 6 4 Survival kit , 7 4 Facilitating Online , 8 3 Drinking water/Scarcity , 9 3 Digital Signature , 10 3 MediaWiki namespace , 11 3 Blogs , 12 3 Wikis , 13 3 Ejump/e-Portfolios , 14 3 Appropedia , 15 3 Wikis in scholarly communication , 16 3 Lecture 2.0 , 17 3 Assistant teacher course , 18 3 BCP/Thalictrum pubescens/Logs , 19 3 C++ , 20 3 Blues basics , 21 3 HTML , 22 3 Educational wikis , 23 2 Aquaria/Glowlight tetras , 24 2 Plant propagation , 25 2 Progressive education

ago 2009: 1 11 United Kingdom Law/Great Repeal Bill 2008 , 2 10 Facilitating Online/Participants , 3 6 Active learning , 4 6 United Kingdom Law/Great Repeal Bill 2008/Debate , 5 6 French/Mentoring/Participants , 6 5 Facilitating Online/course mini conference , 7 3 WikiJournal Preprints/Template:Cite web , 8 3 Electric Mobility/Engineering/Aerodynamics , 9 3 Geographic coordinate conversion , 10 3 HHF/Biology , 11 3 The Inevitability of Globalism/From animism to objective language , 12 3 Comparative law and justice , 13 3 Facilitating Online/Meetings , 14 3 How to be a Wikimedia sysop/Wikiversity , 15 3 Learning the basics of French/Participants , 16 3 Why cats present dead mice to their owners , 17 3 Web 2.0 , 18 3 Facilitating Online , 19 3 C++/Introduction , 20 2 WikiJournal Preprints/Template:Cite journal , 21 2 WikiJournal Preprints/Template:Cite book , 22 2 WikiJournal of Science/Spaces in mathematics , 23 2 Drinking water/Distillation , 24 2 Arboriculture/Pruning , 25 2 Comparative law and justice/United States

set 2009: 1 43 AP Language/Education , 2 5 Electric Mobility/Engineering/Aerodynamics , 3 5 Geochronology/Ice cores , 4 5 University of Florida/Egm6321/f09.Team2/HW2 , 5 4 Geochronology/Dye 3 , 6 4 Postgraduate Use of English at Dhurakij Pundit University , 7 4 Introduction to CAD , 8 4 Pollution Control and Monitoring , 9 4 Environmental Legislation and Management Systems , 10 3 Swarm intelligence , 11 3 Drinking water/Scarcity , 12 3 Aquaria/Glowlight tetras , 13 3 Progressive education , 14 3 Postgraduate Use of English at Dhurakij Pundit University/DBA Roundtable , 15 3 Postgraduate Use of English at Dhurakij Pundit University/MBA Roundtable , 16 3 Postgraduate Use of English at Dhurakij Pundit University/Appendices , 17 3 Postgraduate Use of English at Dhurakij Pundit University/References , 18 3 Postgraduate Use of English at Dhurakij Pundit University/Conclusions, Implications, and Recommendations , 19 3 Postgraduate Use of English at Dhurakij Pundit University/Findings , 20 3 Postgraduate Use of English at Dhurakij Pundit University/Methodology , 21 3 Postgraduate Use of English at Dhurakij Pundit University/Literature Review , 22 3 Postgraduate Use of English at Dhurakij Pundit University/Introduction , 23 3 Intro Emerging Tech , 24 3 Emerging tech Africa , 25 3 UV Sensitive Beads

out 2009: 1 22 AP Language/Education , 2 7 Digital Signature , 3 6 Electric Mobility/Engineering/Aerodynamics , 4 5 Facilitating Online/Participants , 5 3 WikiJournal Preprints/Template:Cite journal , 6 3 WikiJournal Preprints/Template:Cite AV media notes , 7 3 Swarm intelligence , 8 3 Drinking water/Solar disinfection , 9 3 Experiment/In vitro , 10 3 Comparative law and justice/Pakistan , 11 3 Comparative law and justice/Finland , 12 3 Comparative law and justice/Canada , 13 3 Comparative law and justice/Sweden , 14 3 Comparative law and justice/Jordan , 15 3 Connectivism/Glossary , 16 3 French/Mentoring/Participants , 17 3 Comparative law and justice/Australia , 18 3 University of Canberra , 19 3 Ubuntu , 20 3 How to be a Wikimedia sysop , 21 3 Technical writing , 22 2 WikiJournal Preprints/Template:Cite web , 23 2 Photogrammetry , 24 2 Python Concepts , 25 2 Geochronology/Ice cores

nov 2009: 1 17 Electric Mobility/Engineering/Aerodynamics , 2 16 UTPA STEM/CBI Courses , 3 15 Facilitating Online/course mini conference , 4 6 French/Mentoring/Participants , 5 5 Photogrammetry , 6 5 Geochronology/Ice cores , 7 5 Children, Schools and Families Bill , 8 5 Technical writing , 9 4 Digital Signature , 10 4 Postgraduate Use of English at Dhurakij Pundit University , 11 4 Managing Human Resource Flows , 12 3 WikiJournal Preprints/Hepatitis E , 13 3 WikiJournal of Science/Spaces in mathematics , 14 3 UTPA STEM/CBI Courses/Calculus2 , 15 3 Comparative law and justice/Saudi Arabia , 16 3 Comparative law and justice/Jordan , 17 3 Angles , 18 3 Calculus , 19 2 WikiJournal Preprints/Template:Navbox , 20 2 WikiJournal Preprints/Template:Cite web , 21 2 WikiJournal Preprints/Template:Cite journal , 22 2 WikiJournal Preprints/Template:Cite book , 23 2 Swarm intelligence , 24 2 Survival kit , 25 2 Postgraduate Use of English at Dhurakij Pundit University/Findings/Discussion

dez 2009: 1 6 Electric Mobility/Engineering/Aerodynamics , 2 5 Children, Schools and Families Bill , 3 5 Managing Human Resource Flows , 4 4 WikiJournal of Science/Spaces in mathematics , 5 4 Facilitating Online/course mini conference , 6 4 French/Mentoring/Participants , 7 4 Technical writing audience , 8 3 WikiJournal Preprints/Yolmo people , 9 3 Geochronology/Ice cores , 10 3 Digital Signature , 11 3 Learning theories in practice , 12 3 Postgraduate Use of English at Dhurakij Pundit University , 13 3 Children, Schools and Families Bill/Amendments to Section 19B of Schedule 1 , 14 2 WikiJournal Preprints/Hepatitis E , 15 2 Photogrammetry , 16 2 Swarm intelligence , 17 2 Drinking water/Scarcity , 18 2 Living With a Narcissist , 19 2 Survival kit , 20 2 Plant propagation/Cloning , 21 2 Learning theories in practice/Process writing in L2 Classrooms , 22 2 Wiki Campus Radio/Active audio stream/01-25 , 23 2 Children, Schools and Families Bill/Amendments to Section 19H of Schedule 1 , 24 2 Children, Schools and Families Bill/Amendments to Section 19G of Schedule 1 , 25 2 Children, Schools and Families Bill/Amendments to Section 19F of Schedule 1

jan 2010: 1 11 Managing Human Resource Flows , 2 11 Technical writing UI Design , 3 5 Electric Mobility/Engineering/Aerodynamics , 4 5 Digital Signature , 5 5 Children, Schools and Families Bill , 6 5 Web Design/What is HTML , 7 4 Survival kit , 8 4 University of Florida/Egm6341/s10.Team2/HW1 , 9 4 Icns141/Homework , 10 3 WikiJournal Preprints/Yolmo people , 11 3 Representation theory of the Lorentz group , 12 3 UCL anatomy , 13 3 Wikiworld - Commons and Education/Wiki Pedagogy , 14 3 The periodic table/Noble gases , 15 3 Children, Schools and Families Bill/Wish-list for Amendments , 16 3 Comparison between Roman and Han Empires , 17 3 Filmmaking Basics/Introduction , 18 3 How to be a Wikimedia sysop , 19 3 Technical writing courses , 20 3 Technical writing overview , 21 2 WikiJournal Preprints/Hepatitis E , 22 2 WikiJournal Preprints/Template:Cite journal , 23 2 Swarm intelligence , 24 2 Drinking water/Solar disinfection , 25 2 Drinking water/Scarcity

fev 2010: 1 14 Web 2.0 , 2 9 Romanticism and Revolution , 3 7 18th century European scholarly societies and academies , 4 6 History Essay Format & Thesis Statement , 5 4 Electric Mobility/Engineering/Aerodynamics , 6 4 Progressive education , 7 4 Reviewing My Semester with the FUN WITH ENGLISH 7A & 8A Textbooks , 8 4 UTPA STEM/CBI Courses , 9 3 Photogrammetry , 10 3 Swarm intelligence , 11 3 Drinking water/Solar disinfection , 12 3 Houseplant care/Houseplant , 13 3 Phytochemicals/Apigenin , 14 3 UTPA STEM/CBI Courses/Physics (Calculus Based)/Angular Momentum and its Conservation , 15 3 Value chains and new media , 16 3 Search and rescue/SAR mission 2008 02 , 17 3 Russian Roulette (Drinking Game) , 18 3 Turing/Variables and Types , 19 3 Turing/Introduction , 20 3 Turing , 21 3 Other Free Learning Resources , 22 2 Plant propagation/Cloning , 23 2 UCNISS , 24 2 UTPA STEM/CBI Courses/Thermal Systems Design and Optimization/Economics , 25 2 Marine Biology Lesson Plan

mar 2010: 1 9 Open academia in practice/Participants , 2 8 Wikiversity open letter project/WMF Board March 2010 , 3 6 French/Mentoring/Participants , 4 5 Houseplant care/Houseplant , 5 5 Digital Signature , 6 5 Going naked - Openism and freedom in academia , 7 5 HTML , 8 4 Electric Mobility/Engineering/Aerodynamics , 9 4 Drinking water/Scarcity , 10 4 Wikizens with a Second Life account , 11 4 Using social media for teaching and research , 12 4 Wikimedia Ethics , 13 3 What is the sixth sense? , 14 3 Swarm intelligence , 15 3 Drinking water/Solar disinfection , 16 3 Drinking water/Distillation , 17 3 Aquaria/Bleeding heart tetra , 18 3 University of Canberra/Things that don't work , 19 3 Inflammatory bowel disease , 20 3 MergeSort , 21 3 Open academia in practice , 22 3 UCL anatomy/Hand , 23 3 Instructional design/Technology-based lessons/Elements of a good TBL , 24 3 Sport sponsorship and media , 25 3 ExtraDix

abr 2010: 1 16 Wikiversity open letter project/WMF Board March 2010 , 2 7 Progressive education , 3 7 Survival kit , 4 6 Digital Signature , 5 5 Electric Mobility/Engineering/Aerodynamics , 6 5 Conway's Game of Life , 7 3 Plant propagation/Cloning , 8 3 Response testing/WMF Projects , 9 3 Comparative law and justice/United Arab Emirates , 10 3 Normal distribution , 11 3 Bloom Clock/Master List , 12 3 BCP/Forsythia x intermedia/Logs , 13 3 BCP/Taraxacum officinale/Logs , 14 3 Bloom Clock/Unknown Plants , 15 3 C , 16 2 WikiJournal Preprints/Template:Flagicon , 17 2 Arboriculture/Pruning , 18 2 Geochronology/Ice cores , 19 2 Plant propagation , 20 2 Houseplant care/Houseplant , 21 2 Teaching EFL Listening via FUN WITH ENGLISH Books/7B/Lesson 9 , 22 2 Plant identification/Acer saccharum , 23 2 UTPA STEM/CBI Courses/Business Math/Business Algebra/Linear Programming , 24 2 UTPA STEM/CBI Courses/Microbiology/Genetic Engineering Using Bacteria , 25 2 UTPA STEM/CBI Courses/Physics (Calculus Based)/Faraday's Law

mai 2010: 1 16 United Kingdom Law/Great Repeal Bill 2008 , 2 14 United Kingdom Law/Great Repeal Bill 2008/Debate , 3 9 Electric Mobility/Engineering/Aerodynamics , 4 6 Drinking water/Solar disinfection , 5 4 C++ , 6 3 Arboriculture/Pruning , 7 3 Progressive education , 8 3 Survival kit , 9 3 Greek and Roman military traditions , 10 3 UC-IP , 11 3 Intellectual Property/Proposed policy and procedures for Australian research and education , 12 3 BCP/Trifolium repens/Logs , 13 2 Drinking water/Scarcity , 14 2 Drinking water/Distillation , 15 2 Plant propagation/Cloning , 16 2 Digital Signature , 17 2 Mapudungun language , 18 2 Chemical Equilibrium , 19 2 Fundamental Electrochemistry , 20 2 Otago Polytechnic's policy on intellectual property , 21 2 Limit (mathematics) , 22 2 Looking at World War II - Text and Media , 23 2 Vision for open education and research using popular internet , 24 2 University of Canberra/OpenUC , 25 2 Photographic Composition

jun 2010: 1 6 KinderCalculus , 2 5 UC-IP , 3 4 Electric Mobility/Engineering/Aerodynamics , 4 4 Swarm intelligence , 5 4 Survival kit , 6 4 KinderCalculus/blead , 7 4 KinderCalculus/Nouns & Verbs , 8 4 Improving Technical Topics At Wikiversity , 9 4 NAU-POS254-Fascism , 10 4 Northern Arizona University/Socialism , 11 4 Introduction to Computer Science , 12 3 WikiJournal Preprints/Yolmo people , 13 3 Drinking water/Scarcity , 14 3 Houseplant care/Houseplant , 15 3 KinderCalculus/syntax , 16 3 Department of Regional Anatomy of the Human Body , 17 3 Eukaryotic gene example , 18 3 Martin Lohse/Music style , 19 3 Martin Lohse , 20 3 Wikineighborhoods , 21 3 Motivation and emotion , 22 3 Multilingual Pages , 23 3 United Kingdom Law/Great Repeal Bill 2008 , 24 3 NAU-POS254-Radical challenges to Enlightenment Ideologies , 25 3 Tourism/Stages

jul 2010: 1 14 University of Canberra/RCC2010/Registration , 2 10 18th century European scholarly societies and academies , 3 6 Human Legacy Course , 4 5 Electric Mobility/Engineering/Aerodynamics , 5 4 KinderCalculus/Nouns & Verbs , 6 4 United Kingdom Law/Great Repeal Bill 2008 , 7 3 Information theory , 8 3 Geochronology/Ice cores , 9 3 Survival kit , 10 3 United Kingdom Law/Reform/Parliamentary Reform Bill , 11 3 How to build a pykrete bong , 12 3 University of Canberra/RCC2010/Schedule , 13 3 KinderCalculus/Dress , 14 3 KinderCalculus/syntax , 15 3 KinderCalculus/blead , 16 3 Motivation and emotion , 17 3 University of Canberra , 18 3 Learning mathematics , 19 2 Swarm intelligence , 20 2 Geochronology/Dye 3 , 21 2 Plant propagation , 22 2 Phytochemicals/Apigenin , 23 2 Digital Signature , 24 2 World War I , 25 2 Limitations of Scientific Research

ago 2010: 1 42 Motivation and emotion/Participants/2011/2010 , 2 19 Motivation and emotion/Textbook , 3 10 Ideas in Geometry , 4 10 University of Canberra/RCC2010/Registration , 5 9 Motivation and emotion , 6 6 English basics/101 , 7 5 Motivation and emotion/Tutorials/Emotion/List , 8 4 Electric Mobility/Engineering/Aerodynamics , 9 4 Dramaturgy , 10 4 Dinosaurs , 11 4 Exercise and metabolic disease , 12 4 English basics , 13 4 History of the Ottoman Empire , 14 4 C++ , 15 3 WikiJournal Preprints/Yolmo people , 16 3 Digital Signature , 17 3 Motivation and emotion/Textbook/Motivation/Addiction , 18 3 Motivation and emotion/Book/2010/Procrastination , 19 3 University of Canberra/RCC2010/Conversations behind wikis , 20 3 University of Canberra/RCC2010/Wikis for applied learning , 21 3 University of Canberra/RCC2010/Wikiversity , 22 3 Survey about Wikipedia , 23 3 University of Canberra/RCC2010/Schedule , 24 3 Motivation and emotion/References , 25 3 StrategyHeuristics

set 2010: 1 23 Ideas in Geometry , 2 16 Motivation and emotion/Participants/2011/2010 , 3 11 University of Canberra/Wikis for research , 4 8 Motivation and emotion/Textbook , 5 6 WikiJournal Preprints/Yolmo people , 6 6 Houseplant care/Houseplant , 7 5 Electric Mobility/Engineering/Aerodynamics , 8 5 Progressive education , 9 5 Motivation and emotion/Book/2010/Procrastination , 10 5 UTPA STEM/CBI Courses , 11 4 Digital Signature , 12 4 Human Legacy Course , 13 4 Web 2.0 , 14 3 16th century: Growth of the Empire, Part 2, Suleiman I (\"the Magnificent\") , 15 3 The sport workplace , 16 3 UC Women's Group Mentoring Program , 17 3 Protestantism , 18 2 WikiJournal Preprints/Template:Cite AV media notes , 19 2 Swarm intelligence , 20 2 Volleyball/Template:Silver2 , 21 2 Volleyball/Template:Gold1 , 22 2 Volleyball/Template:Bronze3 , 23 2 Motivation and emotion/Book/2010/Empathy , 24 2 Drinking water/Distillation , 25 2 Living With a Narcissist

out 2010: 1 26 Ideas in Geometry/Instructive examples , 2 16 Electric Mobility/Engineering/Aerodynamics , 3 7 Laboratory on Mathematics and Mathematics Education/Fermi Questions/Scaffolds , 4 4 WikiJournal Preprints/Template:Reflist , 5 4 Arboriculture/Pruning , 6 4 Geochronology/Ice cores , 7 4 Progressive education , 8 4 Survival kit , 9 4 Digital Signature , 10 4 Wikistution/Article II (The Executive) , 11 4 Wikistution/Amendment XXI (Prohibition Repealed) , 12 4 Wikistution , 13 4 Obstetrics and Gynecology/Gynecological Examination , 14 4 Bloom Clock , 15 3 Experiment/In vitro , 16 3 Ideas in Geometry/Instructive examples/Section 1.3 , 17 3 Ideas in Geometry/Instructive examples/Section 2.1 , 18 3 Ideas in Geometry/Instructive examples/Section 3.2 , 19 3 Wikistution/Article V (Amendments) , 20 3 Wikistution/Amendment XXVIII , 21 3 Wikistution/Amendment XIX (Woman Suffrage) , 22 3 Wikistution/Amendment II (Right to Bear Arms) , 23 3 Ideas in Geometry/Instructive examples/Proving the Pythagorean Theorem By Picture , 24 3 Laboratory on Mathematics and Mathematics Education , 25 3 Fluid Mechanics for MAP/Introduction

nov 2010: 1 11 Why academics do and do not participate on wikis , 2 10 Numerical Analysis , 3 8 Ideas in Geometry/Instructive examples , 4 6 Electric Mobility/Engineering/Aerodynamics , 5 6 Bloom Clock , 6 5 Survival kit , 7 4 Progressive education , 8 4 Motivation and emotion/Textbook/Motivation/Anxiety , 9 4 Motivation and emotion/Book/2010/Sleep and emotion , 10 3 Swarm intelligence , 11 3 Experiment/In vitro , 12 3 Wikilitigation , 13 3 Stability of RK methods , 14 3 Numerical Analysis/stability of RK methods , 15 3 Motivation and emotion/Textbook/Emotion/Theories/Cognitive , 16 3 Motivation and emotion/Textbook/Emotion/Stress, arousal and coping , 17 3 Motivation and emotion/Textbook/Emotion/Facial expression , 18 3 Motivation and emotion/Textbook/Emotion/Anxiety , 19 3 Motivation and emotion/Textbook/Emotion/Psychopathy , 20 3 Motivation and emotion/Textbook/Emotion/Sport , 21 3 Motivation and emotion/Textbook/Motivation/Sexual motivation , 22 3 Motivation and emotion/Book/2010/Student motivation theories , 23 3 Human Legacy Course , 24 3 Moodle , 25 3 Tourism/Introduction

dez 2010: 1 11 Conservation Entrepreneurship/Annotated Bibliography , 2 10 Why academics do and do not participate on wikis , 3 5 Conservation Entrepreneurship/Student Essays , 4 5 Ideas in Geometry , 5 4 Swarm intelligence , 6 4 Drinking water/Solar disinfection , 7 4 Ideas in Geometry/Instructive examples , 8 4 Comparative law and justice/Fiji , 9 4 C , 10 3 WikiJournal Preprints/Template:Reflist , 11 3 Low-Cost Precision Farming , 12 3 Drinking water/Scarcity , 13 3 Houseplant care/Houseplant , 14 3 Phytochemicals/Erythravine , 15 3 Survival kit , 16 3 Digital Signature , 17 3 Learning civility , 18 3 Motivation and emotion/Textbook/Motivation/Gender differences in sexual motivation , 19 3 Stars/Evolutions , 20 3 Media literacy , 21 2 WikiJournal Preprints/Hepatitis E , 22 2 Photogrammetry , 23 2 Aquaria/Leopard bush fish , 24 2 ISO 639-1 language matrix , 25 2 Phytochemicals/Scoulerine

jan 2011: 1 51 Psycholinguistics/Participants , 2 47 Psycholinguistics , 3 11 SPIR608 Political Simulations and Gaming/2011 , 4 6 Swarm intelligence , 5 6 Composing free and open online educational resources/Participants/Next start , 6 5 Complex socio-ecological systems/Complex Adaptive Systems , 7 5 Complex socio-ecological systems/System dynamics , 8 5 Communication and Identities in Institutional Arenas - Part I/Tuesday 25 January , 9 5 University of Canberra/RCC2011 , 10 4 Doctor of Philosophy , 11 4 Psycholinguistics/What is a Word? , 12 4 SPIR608 Political Simulations and Gaming , 13 4 GRD Capstone , 14 4 Communication and Identities in Institutional Arenas - Part I , 15 3 Electric Mobility/Engineering/Aerodynamics , 16 3 Geochronology/Ice cores , 17 3 Plant propagation , 18 3 Experiment/In vitro , 19 3 Learning theories in practice/Constructivism/Math , 20 3 University of Canberra/RCC2011/Participants , 21 3 University of Canberra/RCC/Navigation , 22 3 Communication and Identities in Institutional Arenas - Part I/Monday-Tuesday 16-17 May , 23 3 Paideia High School/Cosmic View , 24 3 Fluid Mechanics for MAP/Analytical solutions of internal and external flows , 25 3 HiFi

fev 2011: 1 13 Web 2.0 , 2 9 SPIR608 Political Simulations and Gaming/2011 , 3 7 Plant propagation , 4 6 Electric Mobility/Engineering/Aerodynamics , 5 6 University of Canberra/RCC2011/RecentChangesCamp Expanded/Melbourne , 6 6 Paideia High School/Gettysburg Address , 7 5 Survival kit , 8 5 UCNISS/Sport Wiki Academy/Using Wikimedia Foundation projects , 9 5 Computer Architecture Lab/SS2011 , 10 5 University of Canberra/RCC2011 , 11 4 Drinking water/Scarcity , 12 4 Digital Signature , 13 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM4 , 14 4 University of Canberra/RCC2011/RecentChangesCamp Expanded , 15 4 Paideia High School/Heliganstadt Testament; Symphony No. 9, op. 125, IV , 16 4 Psycholinguistics , 17 4 Workshop for Australian education policy/The Bruce Declaration , 18 4 Game design , 19 3 Swarm intelligence , 20 3 Low-Cost Precision Farming , 21 3 WikiJournal of Science/Spaces in mathematics , 22 3 Plant propagation/Cloning , 23 3 Institutions and communities , 24 3 The History of the Paralympic Movement in Australia/Tender , 25 3 Dignity/when your dignity was threatened or abridged

mar 2011: 1 6 Progressive education , 2 5 Electric Mobility/Engineering/Aerodynamics , 3 5 Collaborative Scenario , 4 5 Open Educational Resources for School Teachers from Developing Nations/Participants , 5 5 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team HelioDrive (Team PM4) , 6 5 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM5 , 7 4 WikiJournal Preprints/Template:Cite journal , 8 4 One Health , 9 4 Digital Signature , 10 4 Web 2.0 Tools for Teaching , 11 4 The History of the Paralympic Movement in Australia/Tender , 12 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team AM5 , 13 4 Psycholinguistics , 14 3 Geochronology/Ice cores , 15 3 Plant propagation , 16 3 Survival kit , 17 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM7/Design rapport , 18 3 Preparing an Online Collaborative Environment Plan , 19 3 Creative Teaching Techniques for Teaching I&E , 20 3 Open Web Sources , 21 3 Institutions and communities , 22 3 Observational astronomy/Meteor observing , 23 3 Innovation and Entrepreneurship , 24 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl , 25 3 Wikimedia Ethics/Moulton, JWSchmidt's investigation

abr 2011: 1 5 Openness and collaboration , 2 5 Open Educational Resources for School Teachers from Developing Nations/Participants , 3 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM5 , 4 3 Progressive education , 5 3 Phytochemicals/Apigenin , 6 3 Digital Signature , 7 3 Open Educational Resources for School Teachers from Developing Nations , 8 3 SPIR608 Political Simulations and Gaming/2011/BRIC , 9 3 Psycholinguistics , 10 3 Nonstandard physics/Gravitomagnetism , 11 3 Tourism/Stages , 12 2 Living With a Narcissist , 13 2 Geochronology/Ice cores , 14 2 Experiment/In vitro , 15 2 Plant propagation/Cloning , 16 2 Continuous versus Discrete Manufacturing in ERP , 17 2 Icns141/Term 3, 2010/2011 , 18 2 Rogers 19 point theory , 19 2 Openness and collaboration/Edit using your real name , 20 2 SPIR608 Political Simulations and Gaming/2011/Evaluation , 21 2 Instructional design/LMS interactivity/Lesson 1 , 22 2 Instructional design/LMS interactivity , 23 2 English Composition I , 24 2 Sample Collaborative Environment Plan , 25 2 Computer Forensics/Information Assurance

mai 2011: 1 5 Digital Signature , 2 4 Electric Mobility/Engineering/Aerodynamics , 3 4 Progressive education , 4 4 The History of the Paralympic Movement in Australia/All pages , 5 4 The History of the Paralympic Movement in Australia , 6 4 Open academic practice and Excellence in Research for Australia , 7 4 Human Legacy Course , 8 3 Swarm intelligence , 9 3 Low-Cost Precision Farming , 10 3 Research in education: Open and networked practices , 11 3 Digital portfolio/Patricia Zavella , 12 3 Fiji Hindi , 13 3 Continuous versus Discrete Manufacturing in ERP , 14 3 Latin American and Latina/o Cultural Studies , 15 3 UsEGM6321.F10.TEAM1.WILKS/Mtg3 , 16 3 UsEGM6321.F10.TEAM1.WILKS/Mtg1 , 17 2 Photogrammetry , 18 2 Geochronology/Dye 3 , 19 2 Drinking water/Solar disinfection , 20 2 Phytochemicals/Scoulerine , 21 2 Survival kit , 22 2 Plant propagation/Cloning , 23 2 UCNISS/Women and children's sport research centre proposal , 24 2 EGM6341.s11.TEAM1.WILKS/Mtg1 , 25 2 New Zealand Law/System/Baigents Case

jun 2011: 1 4 Open academic practice and Excellence in Research for Australia , 2 4 Human Legacy Course , 3 4 C , 4 3 WikiJournal Preprints/Hepatitis E , 5 3 Electric Mobility/Engineering/Aerodynamics , 6 3 Digital Signature , 7 3 United States History , 8 3 Open academia survey , 9 3 Applied linear operators and spectral methods , 10 3 Filmmaking Basics/Camera Lenses , 11 2 Drinking water/Distillation , 12 2 Survival kit , 13 2 NTEU discussion on TEQSA framework for standards in teaching and learning , 14 2 Literature/1975/Pask , 15 2 Factor of urbanization , 16 2 Java Tutorial/Trail: Javolution , 17 2 UTPA STEM/CBI Courses/Graphics/Pictorial Sketching , 18 2 United States History/Feedback , 19 2 Tongue Twisters , 20 2 Organometallic chemistry/Cone Angles , 21 2 Luísa Ourique Lau/Canabinóides , 22 2 UCNISS/Women and children's sport research centre proposal , 23 2 Harbor wave , 24 2 The History of the Paralympic Movement in Australia/List of contributors , 25 2 Climate control/An artificial \" tornado\" to supplant the real thing

jul 2011: 1 4 EGM6341.s11.team1.Gong/Mtg8 , 2 4 Educational wikis , 3 3 Greater Access Choice and Flexibility: Learning at University of Canberra , 4 3 Occupational health , 5 3 Necator Americanus , 6 3 The History of the Paralympic Movement in Australia/Library , 7 3 United States History , 8 3 The History of the Paralympic Movement in Australia , 9 3 Human Legacy Course , 10 3 Spanish 1/The Basics , 11 3 Albert Einstein quote , 12 3 Spanish/Spanish One , 13 2 WikiJournal Preprints/Template:Reflist , 14 2 Photogrammetry , 15 2 Aquaria/Glowlight tetras , 16 2 Phytochemicals/Apigenin , 17 2 Effective EU Simulations , 18 2 Euroscience response to EU Consultation on scientific information in the digital age , 19 2 Averages , 20 2 String instruments , 21 2 First aid techniques , 22 2 Behavioral Finance , 23 2 Archive of Simulations and Games/Annotated Bibliography , 24 2 Virtues , 25 2 Country music

ago 2011: 1 68 Motivation and emotion/Participants/2011 , 2 28 Motivation and emotion/Book/2011 , 3 7 Swarm intelligence , 4 6 Wiki 101 , 5 5 Electric Mobility/Engineering/Aerodynamics , 6 4 One Health , 7 4 Motivation and emotion/Book/2011/Competitiveness and happiness , 8 4 Human Legacy Course , 9 4 Moodle , 10 3 Houseplant care/Houseplant , 11 3 Phytochemicals/Apigenin , 12 3 Salticid studies/First records of Hakka (Araneae: Salticidae) in North America , 13 3 Naturality , 14 3 Types of computers , 15 3 The History of the Paralympic Movement in Australia/List of contributors , 16 3 Boubaker Polynomials , 17 3 Motivation and emotion/Definitions , 18 3 C , 19 2 Arboriculture/Pruning , 20 2 Geochronology/Ice cores , 21 2 Plant propagation , 22 2 Phytochemicals/Scoulerine , 23 2 Survival kit , 24 2 Plant propagation/Cloning , 25 2 Digital Signature

set 2011: 1 14 Poppit/Howard Community College/Fall2011 , 2 14 Motivation and emotion/Participants/2011 , 3 11 Motivation and emotion/Book/2011 , 4 6 One Health , 5 6 Teaching and Learning Online , 6 5 Digital Signature , 7 5 Solar/Howard Community College/Fall2011 , 8 5 Poppit/Howard Community College/Fall2011/501 superior , 9 5 Poppit/Howard Community College/Fall2011/501 jupiters , 10 5 Poppit/Howard Community College/Fall2011/501 jdjengineers , 11 5 Poppit/Howard Community College/Fall2011/501 EME , 12 5 The History of the Paralympic Movement in Australia/Meetings/Perth 18 Sept 2011 , 13 5 Motivation and emotion/Book/2011/Aggression , 14 4 Progressive education , 15 4 Escher/Howard Community College/fall2011/502 ABM , 16 4 Model boat/Howard Community College/fall2011/502 bottle , 17 4 HAM/Howard Community College/Fall 2011 , 18 4 Rube Goldberg/Howard Community College/Fall2011/550 FKJ , 19 4 BallBot/Howard Community College/Fall2011/501 BBotz , 20 4 HoverCraft/Howard Community College/Fall2011 , 21 4 Helicopter/Howard Community College/Fall2011/501 Flyers , 22 4 Airplane Float , 23 4 Poppit/Howard Community College/Fall2011/502 1+1=11 , 24 4 Poppit/Howard Community College/Fall2011/502 ZNC , 25 4 Poppit/Howard Community College/Fall2011/550 cjf

out 2011: 1 8 Motivation and emotion/Participants/2011 , 2 7 Motivation and emotion/Book/2011 , 3 6 Motivation and emotion/Book/2011/Gambling , 4 5 Geochronology/Ice cores , 5 5 Digital Signature , 6 5 Motivation and emotion/Book/2011/Emotional intelligence , 7 5 University of Canberra/RCC2012 , 8 4 University of Canberra/RCC2012/Participants , 9 4 Motivation and emotion/Book/2011/Dealing with conflict , 10 4 1000 Songs/Give ear, O heavens and I will speak Deut 32:1-43 , 11 4 StrandBeest/Howard Community College/fall2011/550 Kapachi , 12 4 BallBot/Howard Community College/Fall2011/501 BBotz , 13 4 Motivation and emotion/Book/2011/Shame , 14 4 Motivation and emotion/Book/2011/Relationships and happiness , 15 4 Other Free Learning Resources , 16 3 Houseplant care/Houseplant , 17 3 Motivation and emotion/Book/2011/Sport participation , 18 3 TAO , 19 3 Motivation and emotion/Book/2011/Peer influence in adolescence , 20 3 Rubberband gun/Howard Community College/fall2011/550 JHK , 21 3 Helicopter/Howard Community College/Fall2011/501 Eagles , 22 3 Engines/Howard Community College/Fall2011/501 BigBlock , 23 3 Corn Starch/Howard Community College/Fall 2011/501 Speakers , 24 3 1000 Songs/The Lord abides upon my head like a crown (ode 01) , 25 3 1000 Songs/Oxyrhynchus hymn fragment

nov 2011: 1 11 Motivation and emotion/Book/2011 , 2 8 University of Canberra/RCC2012/Participants , 3 8 Web design , 4 6 Plant propagation/Cloning , 5 6 Motivation and emotion/Book/2011/Dealing with conflict , 6 5 Motivation and emotion/Book/2011/Time management , 7 4 Classic energy problem in open-channel flow , 8 4 Bridges/Howard Community College/fall2011/501 DAS 3 , 9 4 Motivation and emotion/Book/2011/Leaving home , 10 4 Motivation and emotion/Book/2011/Sensation seeking , 11 4 Motivation and emotion/Book/2011/Competitiveness , 12 4 Motivation and emotion/Book/2011/Diet, weight loss, and emotion , 13 4 Helicopter/Howard Community College/Fall2011/501 Eagles , 14 4 Motivation and emotion/Book/2011/Criminality , 15 4 Motivation and emotion/Book/2011/Learned optimism , 16 4 Shock , 17 3 Geochronology/Ice cores , 18 3 Progressive education , 19 3 Survival kit , 20 3 Sleep , 21 3 Controversies in Science/RNA world vs metabolism first , 22 3 Motivation and emotion/Book/2011/Spiritual and religious motivation , 23 3 Bernoulli/Howard Community College/Fall2011/502 Desi'z , 24 3 Robot arm/Howard Community College/Fall2011/502 TFCWNS , 25 3 Model boat/Howard Community College/fall2011/502 AHZ

dez 2011: 1 7 TAO/Community members , 2 6 University of Canberra/RCC2012/Participants , 3 5 Electric Mobility/Engineering/Aerodynamics , 4 5 Survival kit , 5 4 Classic energy problem in open-channel flow , 6 4 Phytochemicals/Apigenin , 7 4 Helicopter/Howard Community College/Fall2011/550 Helicopter , 8 4 What is a computer? , 9 3 WikiJournal Preprints/Hepatitis E , 10 3 Swarm intelligence , 11 3 Digital Signature , 12 3 Rubberband gun/Howard Community College/fall2011/501 Rubberman2 , 13 3 Rubberband gun/Howard Community College/fall2011/550 JK , 14 3 Bridges/Howard Community College/fall2011/501 DAS 3 , 15 3 Escher/Howard Community College/fall2011/502 BMproject3 , 16 3 Robot arm/Howard Community College/Fall2011/502 TFCWNS , 17 3 Model boat/Howard Community College/fall2011/502 AHZ , 18 3 HoverCraft/Howard Community College/Fall2011/501 Glorious3 , 19 3 TAO/How to participate in the TAO Community of Practice? , 20 3 History of the Ottoman Empire , 21 2 WikiJournal Preprints/Template:Notelist , 22 2 Houseplant care/Houseplant , 23 2 Progressive education , 24 2 Irish/Pronunciation , 25 2 Sound and psychology

jan 2012: 1 21 Big bang , 2 15 Panspermia , 3 13 Controversies in Science/Water fluoridation , 4 11 Electric Mobility/Engineering/Aerodynamics , 5 11 University of Canberra/RCC2012/Participants , 6 7 University of Florida/Egm4313/s12.team7/Report1 , 7 6 University of Florida/Egm4313/s12.team5.R1 , 8 5 WikiJournal Preprints/Hepatitis E , 9 5 University of Florida/Egm4313/s12.team6 , 10 5 University of Canberra/RCC2012/Thursday dinner , 11 5 Katie Harwood , 12 4 University of Canberra/RCC2012 , 13 3 Plant propagation , 14 3 Big bang/A Critique of NASA scientist: Evidence of alien life on meteorite , 15 3 University of Florida/Egm4313/s12.team11.R1 , 16 3 UCusingwikis , 17 3 Big bang/A critique of Compton effect interpretation of solar red shift , 18 3 Panspermia/A critique of The dark side of the universe: from Zwicky to accelerated expansion , 19 2 Geochronology/Dye 3 , 20 2 Arboriculture/Pruning , 21 2 Operating Systems/Unix/Security , 22 2 Geochronology/Ice cores , 23 2 Houseplant care/Houseplant , 24 2 Keynote lectures/Mars , 25 2 Caregiving and dementia

fev 2012: 1 18 Controversies in Science/Are humans causing global warming , 2 13 Invariant Tasks: Skill Builder Practice , 3 9 Concept Classification/Skill Builder Practice , 4 9 Understanding: Example , 5 8 Cardboard boats , 6 8 Teaching Procedures, page 8 , 7 7 Experiment/In vitro , 8 7 University of Florida/Egm4313/s12.team7/Report2 , 9 7 University of Florida/Egm4313/s12.team6.reports/R1 , 10 6 University of Florida/Egm4313/s12.teamboss/R3 , 11 6 Controversies in Science/Are humans causing global warming/a critique of Global warming and the export of dissolved organic carbon from boreal peatlands , 12 6 University of Florida/Egm4313/s12.team12.R2 , 13 6 University of Florida/Egm4313/s12.team5.R2 , 14 6 Panspermia/A Critique of Protection of bacterial spores in space, a contribution to the discussion on panspermia , 15 5 Digital Signature , 16 5 Helicopter/Howard Community College/Spring2012/p502JASS , 17 5 3D Scan/Howard Community College/Spring2012/P1550jme , 18 5 Controversies in Science/Are humans causing global warming/A critique of Fingerprints of global warming on wild animals and plants , 19 5 Controversies in Science/Are humans causing global warming/A critique of Contributions of past and present human generations to committed warming caused by carbon dioxide , 20 5 University of Florida/Egm4313/s12.team5.R3 , 21 5 University of Florida/Egm4313/s12.team14.report2 , 22 5 A critique of The microbiologist looks at panspermia , 23 4 Swarm intelligence , 24 4 Survival kit , 25 4 Blood cooler

mar 2012: 1 18 Nuclear power/Greener , 2 16 Controversies in Science/Was there a mitochondrial Eve? , 3 10 Electric Mobility/Engineering/Aerodynamics , 4 8 Survival kit , 5 7 University of Florida/Egm4313/s12.teamboss/R5 , 6 7 University of Florida/Egm4313/s12.teamboss/R4 , 7 6 University of Florida/Egm4313/s12.team5.R5 , 8 6 Nuclear power greener/a critique of Nuclear power: renaissance or relapse? Global climate change and long-term Three Mile Island activists’ narratives. , 9 6 Nuclear power greener/A Critique of The role of nuclear energy in 21st century for sustainable development in Korea , 10 6 University of Florida/Egm4313/s12.team5.R4 , 11 5 Controversies in Science/Was there a mitochondrial Eve?/A Critique of Simulating the mitochondrial dna inheritance , 12 5 Controversies in Science/Was there a mitochondrial Eve?/a critique of Human demographic history: refining the recent African origin model , 13 5 Nuclear power greener/A critique of Leukaemia in young children living in the vicinity of German nuclear power plants , 14 5 3D Scan/Howard Community College/Spring2012/P1550jme , 15 4 University of Florida/Egm4313/s12.team11.R5 , 16 4 Controversies in Science/Was there a mitochondrial Eve?/A critique of Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. , 17 4 Controversies in Science/Was there a mitochondrial Eve?/A critique of The Myth of Eve , 18 4 Controversies in Science/Was there a mitochondrial Eve?/A Critique of A complete Neanderthal Mitochondrial genome sequence determined by high-throughput sequencing: A Review , 19 4 Controversies in Science/Was there a mitochondrial Eve?/A critique of Absence of Regional Affinities of Neandertal DNA With Living Humans Does Not Reject Multiregional Evolution , 20 4 Controversies in Science/Was there a mitochondrial Eve?/A critique of Genomics refutes an exclusively African origin of humans , 21 4 Blood cooler , 22 4 University of Florida/Egm4313/s12.team11.R4 , 23 4 Nuclear power greener/A Critique of Recent Advances in Nuclear Power: A Review , 24 4 Nuclear power greener/A Critique of CANDU reactors and greenhouse gas emissions , 25 4 Nuclear power greener/A critique of Risks of nuclear power

abr 2012: 1 15 Controversies in Science/What killed the dinosaurs , 2 9 Controversies in Science/What killed the dinosaurs/A critique of More evidence that the Chicxulub impact predates the K/T mass extinction. Meteoritics & Planetary Science , 3 7 Controversies in Science/What killed the dinosaurs/Experimental evidence that an asteroid impact led to the extinction of many species , 4 7 University of Florida/Egm4313/s12.teamboss/R7 , 5 7 University of Florida/Egm4313/s12.teamboss/R6 , 6 6 University of Florida/Egm4313/s12.team5.R6 , 7 6 Controversies in Science/What killed the dinosaurs/A critique of From The Cover: Chicxulub impact predates the K-T boundary mass extinction , 8 5 University of Florida/Egm4313/s12.team11.R7 , 9 5 University of Florida/Egm4313/s12.team5.R7 , 10 5 Controversies in Science/What killed the dinosaurs/A Critique of The Extinction of the Dinosaurs in North America , 11 4 Instructional Design , 12 4 Drinking water/Scarcity , 13 4 University of Florida/Egm4313/s12.team11.R6 , 14 4 Controversies in Science/What killed the dinosaurs/A critique of Volcanoes and extinctions: Round Two , 15 4 Blood cooler , 16 4 CIVICS , 17 4 C , 18 3 WikiJournal Preprints/Hepatitis E , 19 3 Electric Mobility/Engineering/Aerodynamics , 20 3 Drinking water/Distillation , 21 3 Numeral systems , 22 3 Controversies in Science/What killed the dinosaurs/A critique of The Cretaceous-Tertiary mass extinction is due to the post-impact ozone conditions from the asteroid collision in the Yucatan Peninsula in northestern Mexico (The Chicxulub crater) , 23 3 Controversies in Science/What killed the dinosaurs/A Critique of Extraterrestrial Cause for the Cretaceous-Tertiary Extinction , 24 3 What killed the dinosaurs? , 25 3 Controversies in Science/Was there a mitochondrial Eve?/A critique of Whole-mtDNA Genome Sequence Analysis of Ancient African Lineages

mai 2012: 1 7 The History of the Paralympic Movement in Australia/Meetings/Brisbane 26 May 2012 , 2 7 Russian literature , 3 5 Photogrammetry , 4 4 Drinking water/Distillation , 5 4 Envy , 6 4 University of Canberra/Critical Care Nursing , 7 3 Survival kit , 8 3 Plant propagation/Cloning , 9 3 Digital Signature , 10 3 A Hero of Our Time , 11 3 Fathers and Children , 12 3 Dead Souls , 13 3 Dominant group/Business , 14 3 Bridges/Howard Community College/spring2012/p3501jds , 15 3 University of Canberra/Critical Care Nursing/Resources , 16 3 Wikipedia , 17 2 One Health , 18 2 Guide for New Librarians , 19 2 Mental health and the internet , 20 2 Recommending places , 21 2 Poetry/Contemporary Poetry , 22 2 Poetry/Psychedelic Poetry , 23 2 Observatories/Astronomy , 24 2 Wikidata , 25 2 Countersinking

jun 2012: 1 4 Survival kit , 2 3 WikiJournal Preprints/Hepatitis E , 3 3 Photogrammetry , 4 3 Drinking water/Scarcity , 5 3 Mathematical biophysics , 6 3 Guide for New Librarians , 7 3 Facilitating meaningful activity for people with dementia within residential facilities , 8 3 Comparative law and justice/San Marino , 9 3 Biophysics/Introduction , 10 3 Biophysics , 11 2 WikiJournal Preprints/Template:Notelist , 12 2 Swarm intelligence , 13 2 Geographic coordinate conversion , 14 2 Experiment/In vitro , 15 2 Digital Signature , 16 2 Nitrogen Compounds 1 , 17 2 Encorporating STEM in Va. Education , 18 2 Three States of Korea and Gaya Confederacy , 19 2 KinderCalculus/forever numbers , 20 2 Common phrasal verbs in English , 21 2 United Kingdom Law/Unnecessary Enactments , 22 2 Understanding Digital Communications , 23 2 Understanding Information Theory , 24 2 Paths of Glory (Game) , 25 2 Aerodynamics course

jul 2012: 1 8 Digital Signature , 2 6 Escuela de Lenguas UNLP/Academic Writing , 3 4 Wikiworld , 4 3 Photogrammetry , 5 3 Electric Mobility/Engineering/Aerodynamics , 6 3 Drinking water/Distillation , 7 2 Induced stem cells , 8 2 Learning Habits , 9 2 Walsh permutation; bit permutation , 10 2 Walsh permutation; bit permutation; calc , 11 2 Filling Scuba Cylinders , 12 2 The Environment , 13 2 Introduction to Composite Materials , 14 2 Atypical parkinsonism , 15 2 Stars/Sciences , 16 2 Three States of Korea and Gaya Confederacy , 17 2 Gojoseon Emperors Timeline , 18 2 History of the Goguryeo Empire , 19 2 Goguryeo Project , 20 2 History of Korea , 21 2 Deficiencies as PD cause/Glutathione , 22 2 History of Korea/Gojoseon Empire , 23 2 Geometry/Chapter 1/Lesson 1 , 24 2 Infection as PD cause/Melanoma , 25 2 Auto manicure

ago 2012: 1 13 Cultural Encounters , 2 5 Caregiving and dementia/Participants , 3 4 Swarm intelligence , 4 4 Survival kit , 5 4 Cultural Encounters/Bon appetit , 6 3 Induced stem cells , 7 3 Classic energy problem in open-channel flow , 8 3 Angos , 9 3 Plant propagation/Cloning , 10 3 Cultural Encounters/\"Nice to meet you!\" , 11 3 Cultural Encounters/Leisure time , 12 3 Introduction to Python for FEniCS , 13 3 Human Legacy Course , 14 3 Wikiworld , 15 3 Violin 101 , 16 2 WikiJournal Preprints/Template:Reflist , 17 2 Electric Mobility/Engineering/Aerodynamics , 18 2 Aquaria/Metynnis argenteus , 19 2 Progressive education , 20 2 Symptomatic Relief for PD/Dyskinesia , 21 2 Cultural Encounters/Relationships , 22 2 Caregiving and dementia/Wiki training/Emails , 23 2 Computer architecture/Introduction , 24 2 Balti/Foods , 25 2 Cultural Encounters/Holidays and celebrations

set 2012: 1 21 Collaborative computing , 2 20 Controversies in Science/Was there a mitochondrial Eve? , 3 18 Controversies in Science/What killed the dinosaurs , 4 16 Controversies in Science/Water fluoridation , 5 8 Emerging Web Technologies , 6 7 Caregiving and dementia/Participants , 7 7 Controversies in Science/Was there a mitochondrial Eve?/A critique of Whole-mtDNA Genome Sequence Analysis of Ancient African Lineages , 8 6 TAO/Handbook/Examples of users and communities , 9 6 Controversies in Science/Water fluoridation/A Critique of Arsenic and Fluoride Exposure in Drinking Water: Children's IQ and Growth in Shanyin County, Shanxi Province, China , 10 6 TAO/Handbook , 11 6 Controversies in Science/Was there a mitochondrial Eve?/A critique of Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. , 12 5 Swarm intelligence , 13 5 Igloo/Howard Community College/Fall2012/p1-502-lmra , 14 5 Door access/Howard Community College/Fall2012/p1-502-hwht , 15 5 Controversies in Science/Water fluoridation/A critique of Hip Fracture Incidence before and after the Fluoridation of the Public Water Supply, Rochester, Minnesota , 16 5 Digital Signature , 17 5 Controversies in Science/Water fluoridation/A Critique of Water Fluoridation , 18 5 Controversies in Science/What killed the dinosaurs/Experimental evidence that an asteroid impact led to the extinction of many species , 19 5 Controversies in Science/What killed the dinosaurs/A Critique of The Extinction of the Dinosaurs in North America , 20 5 Controversies in Science/Was there a mitochondrial Eve?/A Critique of A complete Neanderthal Mitochondrial genome sequence determined by high-throughput sequencing: A Review , 21 4 WikiJournal Preprints/Hepatitis E , 22 4 Electric Mobility/Engineering/Aerodynamics , 23 4 Survival kit , 24 4 Controversies in Science/Was there a mitochondrial Eve?/A critique of The Origins of Modern Humans: Multiregional or Out of Africa? , 25 4 HoverCraft/Howard Community College/Fall2012/p1501east

out 2012: 1 14 Controversies in Science/What killed the dinosaurs , 2 14 Controversies in Science/Are humans causing global warming , 3 14 Nuclear power/Greener , 4 6 Survival kit , 5 6 Emerging Web Technologies , 6 6 Digital Signature , 7 6 A critique of Is a Signature of Socio-economic Impact written on the Climate? , 8 5 WikiJournal Preprints/Hepatitis E , 9 5 University of Florida/Egm6321/f12.Rep5hid , 10 5 Robot car/Howard Community College/Fall2012/p1-503-mcf , 11 5 Nuclear power greener/A critique of Leukaemia in young children living in the vicinity of German nuclear power plants , 12 5 Controversies in Science/Are humans causing global warming/A critique of Contributions of past and present human generations to committed warming caused by carbon dioxide , 13 5 Controversies in Science/Are humans causing global warming/A Critique of Global warming and long term climatic changes: a progress report. , 14 5 Controversies in Science/Water fluoridation , 15 5 Controversies in Science/Was there a mitochondrial Eve? , 16 4 Electric Mobility/Engineering/Aerodynamics , 17 4 Controversies in Science/Are humans causing global warming/A Critique of Global-scale temperature patterns and climate forcing over the past six centuries , 18 4 Controversies in Science/Are humans causing global warming/A Critique of Global warming and human activity: A model for studying the potential instability of the carbon dioxide/temperature feedback mechanism,Ecological Modeling. , 19 4 Igloo/Howard Community College/Fall2012/p1-502-lmra , 20 4 ComboLockPick/Howard Community College/Fall2012/p1-502-cmsb , 21 4 SnakeHat/Howard Community College/fall2012/p1-502-aks , 22 4 Corn Starch/Howard Community College/fall2012/p1-550-soc , 23 4 Controversies in Science/What killed the dinosaurs/Experimental evidence that an asteroid impact led to the extinction of many species , 24 4 Controversies in Science/What killed the dinosaurs/A Critique of Extraterrestrial Cause for the Cretaceous-Tertiary Extinction , 25 4 Nuclear power greener/A Critique of A Comparison between Fossil and Nuclear Power Plants Pollutions and Their Environmental Effects.

nov 2012: 1 13 Electric Mobility/Engineering/Aerodynamics , 2 13 Panspermia , 3 8 Numerical Analysis/Topics , 4 6 Web Technologies Master List , 5 6 Nuclear power/Greener , 6 6 LHC black hole risk , 7 5 Swarm intelligence , 8 5 LangCamp 2012 , 9 5 ComboLockPick , 10 4 Photogrammetry , 11 4 Arboriculture/Pruning , 12 4 International Digital Rights , 13 4 Helicopter/Howard Community College/Fall2012/p3-550-mww , 14 4 HoverCraft/Howard Community College/Fall2012/p3501 NEKK , 15 4 Robot car/Howard Community College/Fall2012/p3-501 CMLA , 16 4 Static electricity/Howard Community College/Fall2012/p3-502-hkm , 17 4 Igloo/Howard Community College/Fall2012/p1-502-lash , 18 4 SnakeHat/Howard Community College/fall2012/p-3-502-hwrm , 19 4 StrandBeest/Howard Community College/fall2012/p3-550-ocm , 20 4 Arduino Motor Control/Howard Community College/Fall2012/P2-501-CDMN , 21 4 Rube Goldberg/Howard Community College/Fall2012/p2-504-fcrd , 22 4 Digital Signature , 23 3 Numerical Analysis/Loss of Significance , 24 3 Web technologies master list , 25 3 Corn Starch/Howard Community College/Fall 2012/SOC 2

dez 2012: 1 7 LangCamp 2012/Minangkabau language , 2 7 LHC black hole risk , 3 6 Electric Mobility/Engineering/Aerodynamics , 4 5 Houseplant care/Houseplant , 5 5 LangCamp 2012 , 6 5 Numerical Analysis/Topics , 7 4 LHC black hole risk/a critique of Correction to the Higher Dimensional Black Hole Entropy , 8 4 Numerical Analysis/Matrix norm , 9 4 Web Technologies Master List , 10 4 Hydraulic ram/Howard Community College/Fall2012/p3501ATandT , 11 4 Static electricity/Howard Community College/Fall2012/p3-502-hkm , 12 3 Living Self-sufficiency in London , 13 3 Indigenous and Intercultural Health , 14 3 SAE Car/Howard Community College/Fall2012 , 15 3 LHC black hole risk/A critique of \"Critical Revision of LHC risks and communication\" , 16 3 Error of Analysis of Newton-Cotes formulas , 17 3 LHC black hole risk/A Critque of: Review of the Safety of LHC Collisions , 18 3 Numerical Analysis/ODE in vector form Exercises , 19 3 LangCamp 2012/Balinese language , 20 3 HoverCraft/Howard Community College/Fall2012/p3501 NEKK , 21 3 Robot car/Howard Community College/Fall2012/p3-501 CMLA , 22 3 Attendance/Howard Community College/fall2012/p3-503-ff , 23 3 StrandBeest/Howard Community College/fall2012/p3-550-ocm , 24 3 Digital Signature , 25 3 TAO/Silver Knowledge

jan 2013: 1 8 Selected topics in finite mathematics/Linear programming , 2 8 Selected topics in finite mathematics/Eulerian cycles , 3 7 Selected topics in finite mathematics , 4 6 Electric Mobility/Engineering/Aerodynamics , 5 5 Geochronology/Ice cores , 6 5 Selected topics in finite mathematics/Minimum spanning trees , 7 5 Selected topics in finite mathematics/Hamiltonian cycles , 8 5 Selected topics in finite mathematics/What is a graph , 9 4 University of Florida/Egm3520/s13.team1.r1 , 10 4 Selected topics in finite mathematics/Transportation problems , 11 4 Selected topics in finite mathematics/Bin Packing , 12 4 SPIR608 Political Simulations and Gaming/2013 , 13 4 Rodger's Method , 14 3 Photogrammetry , 15 3 Swarm intelligence , 16 3 Survival kit , 17 3 Phytochemicals/Apigenin , 18 3 Ethical medical research/Alternatives to animal testing , 19 3 Caregiving and dementia/Topics/Diagnosing dementia , 20 2 Representation theory of the Lorentz group , 21 2 Arboriculture/Pruning , 22 2 Geographic coordinate conversion , 23 2 Angos , 24 2 Houseplant care/Houseplant , 25 2 Experiment/In vitro

fev 2013: 1 11 Selected topics in finite mathematics , 2 10 Open Conference on Open Education , 3 9 Selected topics in finite mathematics/Sets, logic, and arguments , 4 8 Selected topics in finite mathematics/Monotonic , 5 7 Representation theory of the Lorentz group , 6 7 Mechanics of materials/Problem set 2 , 7 7 Plant propagation/Cloning , 8 7 University of Florida/Egm3520/s13.team1.r2 , 9 6 University of Florida/Eml4507/Team7 Report3 , 10 6 Selected topics in finite mathematics/Pareto condition , 11 6 Selected topics in finite mathematics/Independent of irrelevant alternatives , 12 6 Selected topics in finite mathematics/Majority criterion , 13 6 University of Florida/Eml4507/Team7 Report2 , 14 6 Engineering Experience 4: Design a Small Solar Vehicle , 15 5 University of Florida/Egm3520/s13.team1.r3 , 16 5 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team PM5 , 17 5 Selected topics in finite mathematics/Voting/Plurality , 18 4 Electric Mobility/Engineering/Aerodynamics , 19 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team PM6 , 20 4 Selected topics in finite mathematics/Voting/Borda count , 21 4 Selected topics in finite mathematics/Voting/Condorcet method , 22 4 University of Florida/Egm3520/s13.team4.r2 , 23 3 Swarm intelligence , 24 3 Survival kit , 25 3 Ageing and intellectual disability

mar 2013: 1 9 Electric Mobility/Engineering/Aerodynamics , 2 9 Web 2.0 , 3 8 Open Conference on Open Education , 4 7 University of Florida/Egm3520/s13.team5.r5 , 5 7 University of Florida/Egm3520/s13.team5.r4 , 6 5 Swarm intelligence , 7 5 University of Florida/Eml4507/s13 Report 4 Team 7 , 8 5 Selected topics in finite mathematics/Voting coalitions , 9 4 Aquaria/Rummy-nose tetra , 10 4 Selected topics in finite mathematics/Managing your money , 11 4 University of Florida/Egm3520/s13.team1.r5 , 12 4 University of Florida/Eml4507/Team 7 Report 5 , 13 4 Selected topics in finite mathematics/Weighted voting , 14 4 Open Conference on Open Education/Critical ideas , 15 4 Computer Architecture Lab/SS2013 , 16 3 WikiJournal of Science/Spaces in mathematics , 17 3 Angos , 18 3 Survival kit , 19 3 University of Florida/Egm3520/Mom-s13-team4-R5 , 20 3 Catalogue 22 , 21 3 Open Conference on Open Education/Introductions and agenda , 22 3 Catalogue 22/C.N.S.C. Field Station , 23 3 Open Conference on Open Education/Practical steps, getting started , 24 3 Open Conference on Open Education/Producing OERs , 25 3 Open Conference on Open Education/Who's doing what

abr 2013: 1 6 Selected topics in finite mathematics/Taxes , 2 6 Wikimedia in higher education/2013/University of Sydney , 3 5 Swarm intelligence , 4 5 Selected topics in finite mathematics/Managing your money , 5 5 Digital Signature , 6 4 University of Florida/Egm4507/s13 Team 7 Report 7 , 7 4 University of Florida/Eml4507/Team 7 Report 6 , 8 4 University of Florida/Egm3520/s13.team1.r6 , 9 4 Computer Architecture Lab/SS2013 , 10 3 Electric Mobility/Engineering/Aerodynamics , 11 3 Classic energy problem in open-channel flow , 12 3 Progressive education , 13 3 University of Wollongong , 14 2 WikiJournal Preprints/Hepatitis E , 15 2 WikiJournal Preprints/Yolmo people , 16 2 Photogrammetry , 17 2 One Health , 18 2 Induced stem cells , 19 2 Living With a Narcissist , 20 2 Angos , 21 2 Comparative law and justice/United States , 22 2 Bible/King James/Two-source Hypothesis , 23 2 Federal Writers' Project - Life Histories/2013/Spring/Mary Mote , 24 2 PD Gene Therapy/RNA interference , 25 2 University of Florida/Eml4507/s13.team3.andersondavyr7

mai 2013: 1 6 Digital Signature , 2 3 Low-Cost Precision Farming , 3 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM8 , 4 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team PM5 , 5 2 Electric Mobility/Engineering/Aerodynamics , 6 2 Classic energy problem in open-channel flow , 7 2 Houseplant care/Houseplant , 8 2 Houseplant care , 9 2 Progressive education , 10 2 CIVICS/Field Trip to Javakheti, 2012-03 , 11 2 Parkinson's Symptoms/Sinemet , 12 2 Parkinson's Symptoms/Drug side effects , 13 2 Polar Coordinates , 14 2 Computer Architecture Lab/SS2013/GROUP4 ASSIGNMENT3 , 15 2 Parkinson's Symptoms , 16 2 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team PM12 , 17 2 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM12 , 18 2 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM13 , 19 2 Engineering Experience 4: Design a Small Solar Vehicle/2013: Team PM18 , 20 2 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM3 , 21 2 Computer Architecture Lab/SS2013 , 22 2 Esperanto/Lesson 4 , 23 2 A-Level Mechanics - Vectors , 24 2 PD Neuroprotection/Neuroprotective agents , 25 2 Radiation astronomy/Greens

jun 2013: 1 6 Electric Mobility/Engineering/Aerodynamics , 2 5 History of Sri Lanka/Ponnambalam Arunachalam , 3 5 Digital Signature , 4 4 Progressive education , 5 2 KnitR , 6 2 Representation theory of the Lorentz group , 7 2 Induced stem cells , 8 2 Classic energy problem in open-channel flow , 9 2 Geochronology/Ice cores , 10 2 Atlantis/Location Hypotheses , 11 2 Parkinson's Symptoms/Drug side effects , 12 2 Open Conference on Open Education/Recommendations , 13 2 Radiation astronomy/Radios , 14 2 Volcanoes/Mount Tambora , 15 2 Spanish/Spanish Three/Exact pronunciation , 16 2 Learning resource , 17 2 United States , 18 1 WikiJournal Preprints/Hepatitis E

jul 2013: 1 10 Activities, assignments and assessment , 2 7 Electric Mobility/Engineering/Aerodynamics , 3 5 Swarm intelligence , 4 3 WikiJournal Preprints/Template:Cite AV media notes , 5 3 KnitR , 6 3 History of Sri Lanka/Vijaya Kumaranatunga , 7 3 History of Sri Lanka/Alfred Duraiappah , 8 3 History of Sri Lanka/John Kotelawala , 9 3 History of Sri Lanka/Herwald Ramsbotham , 10 3 History of Sri Lanka/Oliver Goonetilleke , 11 3 Survival kit , 12 3 Indigenous and Intercultural Health , 13 3 Digital Signature , 14 3 PD Neuroprotection/Exendin-4 (EX-4) , 15 2 WikiJournal Preprints/Hepatitis E , 16 2 Sustainable Development Goals , 17 2 Representation theory of the Lorentz group , 18 2 History of Sri Lanka/Mahinda V , 19 2 History of Sri Lanka/Rajendra Chola I , 20 2 History of Sri Lanka/Vimaladharmasuriya I , 21 2 History of Sri Lanka/Joris van Spilbergen , 22 2 History of Sri Lanka/Nicholas Attygalle , 23 2 History of Sri Lanka/S. J. V. Chelvanayakam , 24 2 History of Sri Lanka/Appapillai Amirthalingam , 25 2 Arboriculture/Pruning

ago 2013: 1 104 Motivation and emotion/Book/2013 , 2 6 Swarm intelligence , 3 4 Photogrammetry , 4 4 Gray code permutation powers , 5 3 Electric Mobility/Engineering/Aerodynamics , 6 3 Motivation and emotion/Book/2013/Acceptance and Commitment Therapy and emotion , 7 3 Motivation and emotion/Book/2013/Dreams and emotion , 8 3 Motivation and emotion/Book/2013/Mindfulness , 9 3 Motivation and emotion/Book/2013/Crying , 10 3 Activities, assignments and assessment , 11 3 Cultural Encounters/Leisure time , 12 3 TAO/Handbook , 13 3 Keynote lectures/Jupiter , 14 2 Logistics Software Will Help Businesses Get the Optimum Freight Quote , 15 2 Motivation and emotion/Book/2013/Dreams and motivation , 16 2 Motivation and emotion/Book/2013/Hofstede's dimensions of cultural value and motivation , 17 2 Compare and contrast , 18 2 Motivation and emotion/Book/2013/Behavioural economics and habits , 19 2 Motivation and emotion/Book/2013/Dementia and emotion , 20 2 TAO/Open TAO Workshop , 21 2 Motivation and emotion/Book/2013/Alcohol and university student motivation , 22 2 Esperanto/Root chart , 23 2 Esperanto/Lesson 7 , 24 2 Motivation and emotion/Book/2013/Caregiving and grief in dementia , 25 2 Motivation and emotion/Book/2013/Extrinsic motivation

set 2013: 1 14 Motivation and emotion/Book/2013 , 2 5 WikiJournal Preprints/Hepatitis E , 3 5 Podcasting , 4 4 Representation theory of the Lorentz group , 5 4 University of Florida/Egm4313/IEA-f13-team10/R1 , 6 3 University of Florida/Egm4313/IEA-f13-team10/R2 , 7 3 Survival kit , 8 3 Motivation and emotion/Book/2013/Daily hassles and uplifts , 9 3 Motivation and emotion/Book/2013/Nudge motivation , 10 3 HINARI medical library , 11 3 General Engineering Projects/Overview/Student/Portfolio , 12 3 Robot car/Howard Community College/Fall2012/p3-501 CMLA , 13 3 TAO/Handbook , 14 3 Comparative law and justice/Singapore , 15 2 Photogrammetry , 16 2 Swarm intelligence , 17 2 Low-Cost Precision Farming , 18 2 Bhartrihari quote , 19 2 Geochronology/Ice cores , 20 2 TAO/Analytical framework for the evaluation of online communities , 21 2 Appraisal of online tutorial materials/Evaluation Report for Creating an Effective Resume , 22 2 University of Florida/Egm4313/IEA-f13-team10/R3 , 23 2 Appraisal of online tutorial materials/Evaluation report for MS Word 2013 Essential Training , 24 2 Motivation and emotion/Book/2013/Exercise and emotion , 25 2 Motivation and emotion/Book/2013/Religiousity and emotion

out 2013: 1 22 Web Science/Enroll , 2 8 Motivation and emotion/Book/2013 , 3 6 Electric Mobility/Engineering/Aerodynamics , 4 5 University of Florida/Egm4313/IEA-f13-team10/R3 , 5 5 Motivation and emotion/Book/2013/Behavioural economics and habits , 6 5 Motivation and emotion/Book/2013/Memory and emotion , 7 4 Swarm intelligence , 8 4 Motivation and emotion/Book/2013/Workplace motivation , 9 4 Web Science/Part1: Foundations of the web/Ethernet/Ethernet header/quiz , 10 4 University of Florida/Egm4313/IEA-f13-team10/R4 , 11 4 Motivation and emotion/Book/2013/Delay of gratification , 12 4 Motivation and emotion/Book/2013/Attributions and emotion , 13 4 Motivation and emotion/Book/2013/Weather and emotion , 14 4 Motivation and emotion/Book/2013/Aggression , 15 4 Motivation and emotion/Book/2013/Alzheimer's and motivation , 16 4 Motivation and emotion/Book/2013/Daily hassles and uplifts , 17 4 Motivation and emotion/Book/2013/Dementia and emotion , 18 4 Motivation and emotion/Book/2013/Alcohol and university student motivation , 19 4 Motivation and emotion/Book/2013/Mindfulness , 20 4 Digital Signature , 21 3 Sustainable Development Goals , 22 3 Web Science/Flipped Classroom , 23 3 Corporate social responsibility/Free laptop/the story , 24 3 Web Science/Part1: Foundations of the web/Internet Protocol/Classful IPv4 networks/quiz , 25 3 Web Science/Part1: Foundations of the web/Internet Protocol/Classful IPv4 networks

nov 2013: 1 15 Web Science/Part1: Foundations of the web/Internet Architecture/Domain Name System/Summary, Further readings, Homework/table , 2 7 Representation theory of the Lorentz group , 3 7 Web Science/Enroll , 4 6 Motivation and emotion/Book/2013 , 5 5 Quantum mechanics/Timeline , 6 5 Motivation and emotion/Book/2013/Affiliation motivation , 7 5 Motivation and emotion/Book/2013/Motivational contagion , 8 5 Motivation and emotion/Book/2013/Smell and emotion , 9 4 Swarm intelligence , 10 4 Physics equations , 11 4 Motivation and emotion/Book/2013/Animals and anxiety , 12 4 Web Science/Part1: Foundations of the web/Internet vs World Wide Web/Uniform Resource Identifier , 13 4 Motivation and emotion/Book/2013/Protection motivation and health , 14 4 Web Science/Part1: Foundations of the web/Web content , 15 4 Motivation and emotion/Book/2013/Workplace motivation , 16 4 Motivation and emotion/Book/2013/Porn addiction , 17 4 Motivation and emotion/Book/2013/Failure and happiness , 18 4 Motivation and emotion/Book/2013/Weather and emotion , 19 4 Motivation and emotion/Book/2013/How to get more sex , 20 4 Motivation and emotion/Book/2013/Fear , 21 3 Electric Mobility/Engineering/Aerodynamics , 22 3 Formulas in predicate logic/3 places , 23 3 Houseplant care , 24 3 Physics equations/Magnetic forces , 25 3 Physics equations/Magnetic field calculations

dez 2013: 1 27 Evidence Based Oral Health Practice , 2 5 Web Science/Part2: Emerging Web Properties , 3 4 Swarm intelligence , 4 4 Representation theory of the Lorentz group , 5 3 WikiJournal Preprints/Hepatitis E , 6 3 Electric Mobility/Engineering/Aerodynamics , 7 3 Low-Cost Precision Farming , 8 3 War journalism/Kosovo , 9 3 Computer Security/Ethical Hacking/White Hat Alliance , 10 3 Web Science/Part2: Emerging Web Properties/Search Engine Ecosystem , 11 3 List of 10 famous dictators , 12 3 Lua , 13 3 Web Science/Enroll , 14 3 History/History as creative writing , 15 3 Learning the abc's/B , 16 3 Laws of Zero , 17 3 Enydmion Society , 18 3 KinderCalculus , 19 3 Biblical Studies (NT)/III. THE SEVEN SEALS , 20 2 Photogrammetry , 21 2 Idea of Quantum Science , 22 2 Learning the abc's/S , 23 2 Learning the abc's/O , 24 2 Learning the abc's/N , 25 2 Planets/Classicals/Seven Classical Planets

jan 2014: 1 7 Digital Signature , 2 6 History of Sri Lanka/Mahinda Rajapaksa , 3 4 Photogrammetry , 4 4 History of Sri Lanka/Chandrika Kumaratunga , 5 4 Noam Chomsky/Reading group , 6 3 Swarm intelligence , 7 3 Aquaria/Costello tetra , 8 3 War journalism/Kosovo , 9 3 School collaboration/Sierra Leone-Cambridge/Sierra Schools of Technology , 10 3 Astronomy college course/Mercury , 11 3 RuralWeb/how we do projects , 12 3 US States/Virginia , 13 3 US States/Texas , 14 3 Formulas in predicate logic; different predicates , 15 3 WordPress , 16 3 RuralWeb/improving websites , 17 3 RuralWeb , 18 3 Web Science/Enroll , 19 3 US States/Virginia/Products and industries , 20 3 Chromatography , 21 3 Electric Circuit Analysis , 22 3 Principles of Management , 23 2 WikiJournal Preprints/Hepatitis E , 24 2 WikiJournal Preprints/Yolmo people , 25 2 History of Sri Lanka/Dingiri Banda Wijetunga

fev 2014: 1 9 Invariant Tasks: Skill Builder Practice , 2 8 Neuroscience/Criticism , 3 6 Instructional design/Psychomotor behaviors/Psychomotor Behaviors in Practice , 4 5 Electric Mobility/Engineering/Aerodynamics , 5 5 Computer Architecture Lab/SS2014 , 6 5 Autonomous Power Wheel , 7 5 Wind Turbine , 8 5 Instructional design/Affective behaviors/Designing for the Affective Domain: The Design Document , 9 4 Photogrammetry , 10 4 Representation theory of the Lorentz group , 11 4 Pesticide research , 12 4 Aquaria/Leopard bush fish , 13 4 Algorithm models/Grey Wolf Optimizer , 14 3 Swarm intelligence , 15 3 Fuel oil management system , 16 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2014: Team PM2 , 17 3 Aquaria/Glowlight tetras , 18 3 Aquaria/Ember tetra , 19 3 Aquaria/Diamond tetra , 20 3 Aquaria/Costello tetra , 21 3 Cyberbullying , 22 3 Principles of Public Health Practice , 23 3 Multicultural Perspectives on Health and Wellbeing , 24 3 BioVest , 25 3 Robot Hallway Navigation

mar 2014: 1 35 Upper Limb Orthotics/Case study , 2 6 Forensics/Repressed memory , 3 5 Electric Mobility/Engineering/Aerodynamics , 4 5 Australian Law/Bill of Rights , 5 5 Using video , 6 5 Digital Signature , 7 4 Indian Law/Victims rights , 8 3 WikiJournal Preprints/Hepatitis E , 9 3 Classic energy problem in open-channel flow , 10 3 Astronomy college course/Star (Wikipedia) , 11 3 Creating Dynamic Lessons/Summary , 12 3 Creating Dynamic Lessons/Assessment , 13 3 Creating Dynamic Lessons/Assessment Overview , 14 3 Creating Dynamic Lessons/Creating Lesson , 15 3 Creating Dynamic Lessons/Practice Phase , 16 3 Creating Dynamic Lessons/Practice , 17 3 Creating Dynamic Lessons/Lesson , 18 3 Creating Dynamic Lessons/Intro Practice , 19 3 Creating Dynamic Lessons/Introduction , 20 3 Creating Dynamic Lessons , 21 3 Instructional Design/Design , 22 3 Health Education Development/Cooperative Learning Theory , 23 3 IT Service Management/Service Management , 24 3 Tri-BotHack , 25 2 WikiJournal Preprints/Template:Reflist

abr 2014: 1 5 IT Service Management/Service Strategy , 2 5 IT Service Management/Service Design , 3 4 WikiJournal Preprints/Hepatitis E , 4 4 Electric Mobility/Engineering/Aerodynamics , 5 4 Instructional Technology , 6 4 IT Service Management/Service Transition , 7 4 IT Service Management/Service Operation , 8 4 IT Service Management/Continual Service Improvement , 9 3 Representation theory of the Lorentz group , 10 3 Mobile Education/Bring Your Own Device (BYOD) , 11 3 Data Networking/Spring 2014/Group3 , 12 3 Luon , 13 3 Instructional design/Online Presentations/Conclusion and Next Steps , 14 3 Instructional design/Online Presentations/Assessing an Online Presentation , 15 3 Instructional design/Online Presentations/Choosing Engaging Elements , 16 3 Instructional design/Online Presentations/Organizing Content , 17 3 Instructional design/Online Presentations/Selecting Content , 18 3 Instructional design/Online Presentations/Examples of Online Presentations and a Design Rubric , 19 3 Instructional design/Online Presentations/Benefits and Drawbacks of Using Online Presentations , 20 3 Educational Law & Ethics , 21 3 Instructional design/Online Presentations , 22 3 IT Service Management/Service Management , 23 3 IT Service Management , 24 3 Wikipedia , 25 3 Web design

mai 2014: 1 9 ICT in Education/Policy , 2 5 ICT in Education/Teacher Training/Higher Education , 3 5 ICT in Education/Digital Content , 4 4 ICT in Education/Teacher Training/Secondary Education , 5 4 Film and Television Studies/The Wubbulous World of Dr. Seuss , 6 4 IT Service Management/Continual Service Improvement , 7 3 Papilio multiply , 8 3 Astronomy college course/Astronomy (wikipedia)/questions , 9 3 Astronomy college course , 10 3 IT Service Management/Additional Topics , 11 2 WikiJournal Preprints/Hepatitis E , 12 2 Swarm intelligence , 13 2 US Public Economics , 14 2 Biographies/Stubs/Terry Bruce Cole , 15 2 Nanoengineering , 16 2 Multicultural Perspectives on Health and Wellbeing/Group multimedia presentation , 17 2 Open Quantum Systems/The Quantum Optical Master Equation , 18 2 Biographies/Stubs/Dorman Eaton , 19 2 Biographies/Stubs/Pendelton Dudley , 20 2 Heresy and the Church in the Mediterranean world , 21 2 In the Lands of the Romanovs: An Annotated Bibliography of First-hand English-language Accounts of the Russian Empire (1613-1917)/Reigns of the First Romanovs (1613-1682) , 22 2 Snapshot journal/HEPPP research , 23 2 Internal Combustion Engine , 24 2 Soliton , 25 2 Induced stem cells

jun 2014: 1 9 Crisis bonding , 2 3 Representation theory of the Lorentz group , 3 3 Biographies/Reviews/Autobiography of Mark Twain, Volume I , 4 2 WikiJournal Preprints/Hepatitis E , 5 2 Electric Mobility/Engineering/Aerodynamics , 6 2 Swarm intelligence , 7 2 WikiJournal of Science/Spaces in mathematics , 8 2 Indian Law/Art of Writing Judgment , 9 2 System development/Modelling/Types/Semantic model/What is a semantic model? , 10 2 Dermatology , 11 2 Low Vision Rehabilitation/What is low vision and low vision rehabilitation? , 12 2 Solar System , 13 2 Incomitant Strabismus/Module 1: Clinical Investigations of Incomitant Strabismus , 14 2 Tensors/Transformation rule under a change of basis , 15 2 Tensors/Calculations with index notation , 16 2 Tensors/Bases, components, and dual spaces , 17 2 Tensors/Definitions , 18 2 Physics equations/19-Electric Potential and Electric Field/Q:SurfaceIntegralsCalculus , 19 2 Physics equations/18-Electric charge and field , 20 2 Open Quantum Systems/The Quantum Optical Master Equation , 21 2 Radiation astronomy/Courses/Principles/Final quiz , 22 2 Upper Limb Orthotics/Trigger Finger , 23 2 Incomitant Strabismus , 24 2 System development/Modelling/Types/Semantic model , 25 2 Digital Signature

jul 2014: 1 11 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group4/Group Member , 2 10 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group2/Group Member , 3 8 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group3/Group Member , 4 8 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group4 , 5 8 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group2/Group Member , 6 8 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group3/Group Member , 7 8 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group4/Group Members , 8 7 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group1/Group Members , 9 7 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group1 , 10 6 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group3/Group Member , 11 5 ICT in Education/Student Activities/Mr. Tak Kean/Class M3 , 12 5 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group2/Group Member , 13 5 Professional Development for Teachers of Health Professionals/Write a subject outline , 14 4 WikiJournal Preprints/Hepatitis E , 15 4 Photogrammetry , 16 4 Representation theory of the Lorentz group , 17 4 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group1/Group Member , 18 3 Swarm intelligence , 19 3 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group1/Group Activities , 20 3 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group1 , 21 3 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group2 , 22 3 Multicultural Perspectives on Health and Wellbeing/Multicultural Australia , 23 3 International Health Policy , 24 3 Open Quantum Systems/Dissipative preparation of many-body states , 25 3 Multicultural Perspectives on Health and Wellbeing/Project proposal

ago 2014: 1 81 Motivation and emotion/Book/2014 , 2 10 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group3/Group Member , 3 8 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group4/Group Members , 4 7 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group1/Group Members , 5 7 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group2/Group Member , 6 7 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group1/Group Member , 7 7 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group3/Group Member , 8 6 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group1/Member of Group , 9 6 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group2/Group Member , 10 6 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group2/Group Member , 11 5 WikiJournal Preprints/Hepatitis E , 12 5 Representation theory of the Lorentz group , 13 5 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group4/Group Activities/Discuss , 14 5 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group1/Group Member/M5Y4 Group1-MIS , 15 5 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group3/Group Member , 16 5 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group4/Group Member , 17 4 Australian Law/Bill of Rights , 18 4 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group1/Group Activities/Responded with assignment 2 , 19 4 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group3/Group Activity , 20 4 ICT in Education/Student Activities/Mr. Tak Kean/Class M5/Group4/Group Members , 21 4 WordPress , 22 4 Cultural Encounters/Holidays and celebrations , 23 4 Landmark Education/Abd/Glossary , 24 4 Business , 25 3 Electric Mobility/Engineering/Aerodynamics

set 2014: 1 22 University of North Carolina/Chapel Hill/Tour Heels , 2 18 ICT in Education/Completed Change Projects/2014B , 3 9 Motivation and emotion/Book/2014 , 4 7 General Engineering Projects/Overview/Student/ENES-100 , 5 7 General Engineering Projects/Overview/Student/Portfolio , 6 5 General Engineering Projects/Overview/Student/ENES-100/project 0 , 7 4 ICT in Education/Student Activities/Mr. Tak Kean/Class M1/Group1/Group Activities/Responded with assignment 3 , 8 4 General Engineering Projects/Overview/Student/Portfolio/enes-100 , 9 4 Geochronology/Ice cores , 10 3 Sport/Volleyball/2015 U20 FIVB World Championships , 11 3 Web Science/Part1: Foundations of the web/MoocIndex , 12 3 Motivation and emotion/Book/2014/Depression and motivation , 13 3 ICT in Education/Student Activities/Mr. Tak Kean/Class M3/Group4/Group Activities/Discuss , 14 3 Learning communities/The New Enterprise , 15 3 System development/Model driven development , 16 3 Web Science/Part1: Foundations of the web/Internet Protocol/IP header , 17 3 Web Science/Part1: Foundations of the web/Internet Protocol/IP forwarding algorithm , 18 3 Web Science/Part1: Foundations of the web/Domain Name System , 19 3 Literature/1901 , 20 3 Literature/1900 , 21 3 Wisdom/Curriculum , 22 3 Trigonometry , 23 3 Russian , 24 2 Electric Mobility/Engineering/Aerodynamics , 25 2 Sustainable Development Goals

out 2014: 1 21 Motivation and emotion/Book/2014 , 2 10 University of North Carolina/Chapel Hill/Tour Heels , 3 9 Motivation and emotion/Book/2014/Perceived control and emotion , 4 8 Motivation and emotion/Book/2014/Depression and motivation , 5 8 Motivation and emotion/Book/2014/Unemployment and motivation , 6 7 Motivation and emotion/Book/2014/Amygdala and emotion , 7 7 Motivation and emotion/Book/2014/Self esteem and depression , 8 7 Motivation and emotion/Book/2014/Trust and emotion , 9 6 Motivation and emotion/Book/2014/Testosterone and emotion , 10 6 Motivation and emotion/Book/2014/Adoption and emotion , 11 6 Motivation and emotion/Book/2014/Love and culture , 12 6 E-Learning in Mozambique , 13 6 Motivation and emotion/Book/2014/Dementia care motivation , 14 6 Motivation and emotion/Book/2014/Self-esteem and emotion , 15 5 Motivation and emotion/Book/2014/Fear as a motivator , 16 5 Motivation and emotion/Book/2014/Child emotional abuse , 17 5 Motivation and emotion/Book/2014/Academic cheating motivation , 18 5 Motivation and emotion/Book/2014/Terrorism motivation , 19 5 Motivation and emotion/Book/2014/University student motivation , 20 5 Motivation and emotion/Book/2014/Gambling addiction and emotion , 21 5 Motivation and emotion/Book/2014/Religiosity and mental health , 22 5 Motivation and emotion/Book/2014/Role models and motivation , 23 5 Motivation and emotion/Book/2014/Altruism and empathy , 24 5 Motivation and emotion/Book/2014/Veganism motivation , 25 5 Motivation and emotion/Book/2014/Exercise and mood

nov 2014: 1 8 Electric Mobility/Engineering/Aerodynamics , 2 7 Web Science/Part1: Foundations of the web/MoocIndex , 3 6 ICT in Education/Completed Change Projects/2013C , 4 4 Swarm intelligence , 5 4 Sport/Volleyball/2015 U20 FIVB World Championships , 6 4 Data Networking/Fall 2014/YunweiJiang , 7 4 Teaching in the Age of Wikipedia , 8 4 Motivation and emotion/Book/2014 , 9 4 Blood cooler , 10 4 Templates , 11 3 Volleyball/Template:Silver2 , 12 3 Volleyball/Template:Gold1 , 13 3 Volleyball/Template:Bronze3 , 14 3 Data Networking/Fall 2014/Dearnetworks , 15 3 Truss Bridge Project , 16 3 Motivation and emotion/Book/2014/Serotonin and emotion , 17 3 Motivation and emotion/Book/2014/Giving and emotion , 18 3 Motivation and emotion/Book/2014/Love and culture , 19 3 General Engineering Projects/The Money Team , 20 3 Motivation and emotion/Book/2014/Serial killing motivation , 21 3 Motivation and emotion/Book/2014/Emotion and sex , 22 3 Motivation and emotion/Book/2014/Biopsychological theory of personality and motivation , 23 3 US States , 24 3 Indigenous and Intercultural Health , 25 3 Computer Hardware Types

dez 2014: 1 4 Photogrammetry , 2 4 Representation theory of the Lorentz group , 3 4 Web design , 4 3 Electric Mobility/Engineering/Aerodynamics , 5 3 Low-Cost Precision Farming , 6 3 WikiJournal of Science/Spaces in mathematics , 7 3 WikiJournal of Medicine/Table of pediatric medical conditions and findings named after foods , 8 3 Python Concepts , 9 2 WikiJournal Preprints/Hepatitis E , 10 2 WikiJournal Preprints/Template:Flagicon , 11 2 Swarm intelligence , 12 2 Power Systems/Sources , 13 2 Auroville/Social Research , 14 2 VHDL , 15 2 Gastronomy/Food in antiquity/House of the Deer, Herculaneum , 16 2 Gastronomy/Food Images in Antiquity , 17 2 General Engineering Projects/RADIO FMXMIT , 18 2 Motivation and emotion/Book/2014/Sexual harassment and emotion , 19 2 Brazilian Portuguese/Verb conjugation table , 20 2 ICT in Education/Software for Research , 21 2 Corporate Auditing, Responsibility and Management policy , 22 2 Truss Hydraulic Bridge Project , 23 2 Disk Operating System/Introduction , 24 2 Motivation and emotion/Book/2014/Sex and stress , 25 2 Happiness/Have a Happy Relationship/John Gottman/Glossary

jan 2015: 1 12 Teaching in the Age of Wikipedia , 2 4 WikiJournal of Medicine/Editorial board , 3 3 Swarm intelligence , 4 3 Physics/Simple , 5 3 Computer Hardware Types , 6 2 Electric Mobility/Engineering/Aerodynamics , 7 2 Sustainable Development Goals , 8 2 Representation theory of the Lorentz group , 9 2 Sport/Volleyball/2015 U20 FIVB World Championships , 10 2 Sun Safety for Parents , 11 2 Saraikistan , 12 2 Computer graphics/2014-2015/Laborator 1 , 13 2 Computer graphics/2014-2015/Agenda Laboratoare , 14 2 Computer graphics/2014-2015 , 15 2 What do you know about viruses? , 16 2 ArXiv , 17 2 Astronomy college course/Journal Sp15 , 18 2 WikiJournal of Medicine/The Year of the Elephant , 19 2 Cloud fundamentals/Using and configuring Microsoft cloud services , 20 2 Cloud fundamentals/Administering Microsoft Office 365 and Intune , 21 2 Cloud fundamentals/Supporting cloud users/Configuring Lync online , 22 2 Cloud fundamentals/Supporting cloud users , 23 2 Cloud fundamentals/Enabling Microsoft cloud services , 24 2 Cloud fundamentals/Understanding the cloud , 25 2 Cloud fundamentals

fev 2015: 1 13 Web 2.0 , 2 8 Electric Mobility/Engineering/Aerodynamics , 3 5 IT vendor management , 4 4 WikiJournal Preprints/Yolmo people , 5 4 Digital Signature , 6 3 Referencing Error Factor , 7 3 World War I -- Life Histories/Section 001 , 8 3 Computer Architecture Lab/SS2015 , 9 3 Jesus , 10 2 Sustainable Development Goals , 11 2 World War I -- Life Histories/Section 001/William Victor Tomb , 12 2 Bestseller , 13 2 World War I -- Life Histories/Section 001/Edwin Björkman , 14 2 History of Architecture/Maps , 15 2 World War I -- Life Histories/Section 001/Robert March Hanes , 16 2 World War I -- Life Histories/Section 001/Milton J. Rosenau , 17 2 Physics and Astronomy Labs/group 4 , 18 2 World War I -- Life Histories/Section 001/Joseph Lucius Reed , 19 2 UTPA STEM/CBI Courses/Business Math/Business Algebra/Future Value of an Annuity - Sinking Funds , 20 2 Astronomy education at the University of Nebraska-Lincoln , 21 2 Open educational resources in developing countries , 22 2 ICT in Education/Change Projects/2014C Uganda Computer Literacy Rural Community/Open education resources in Uganda , 23 2 How Linux Began and Origins of Linux , 24 2 World War I -- Life Histories/Section 001/Jessica Smith , 25 2 World War I -- Life Histories/Section 001/Hiram Gaston Carney

mar 2015: 1 10 World War I -- Life Histories/Section 001 , 2 8 WikiJournal Preprints/Yolmo people , 3 5 Electric Mobility/Engineering/Aerodynamics , 4 5 Swarm intelligence , 5 5 Digital Signature , 6 4 Emily Dickinson's poems in translation/Polish , 7 4 World War I -- Life Histories/Section 001/William Victor Tomb , 8 4 Arabic/Alphabets , 9 3 Sustainable Development Goals , 10 3 Visual C++ name mangling , 11 3 World War I -- Life Histories/Section 019/John Oliver Ranson , 12 3 World War I -- Life Histories/Section 019/Elmer Roberts , 13 3 World War I -- Life Histories/Section 001/James Alexander Moseley , 14 3 WikiJournal of Medicine/The Year of the Elephant , 15 3 ICT in Education/Software , 16 3 Radiation astronomy/Reds , 17 3 Web 2.0 , 18 3 Arabic/Numbers , 19 3 Learn Arabic (Language Of Quran) , 20 3 Web Design/HTML Challenges , 21 2 WikiJournal Preprints/Hepatitis E , 22 2 Volleyball/Template:Silver2 , 23 2 Volleyball/Template:Gold1 , 24 2 Volleyball/Template:Bronze3 , 25 2 Instructional design/Divergent Thinking/Summary

abr 2015: 1 20 Tarheel Health Portal , 2 5 Digital Signature , 3 5 Web 2.0 , 4 4 Sport/Volleyball/Philippines-Turkey rivalry , 5 3 WikiJournal Preprints/Yolmo people , 6 3 Electric Mobility/Engineering/Aerodynamics , 7 3 Swarm intelligence , 8 3 Geochronology/Dye 3 , 9 3 Data Networking/Spring 2015/Group1 , 10 3 Tarheel Health Portal/Alzheimer's Disease , 11 3 Tarheel Health Portal/Oral Contraceptives and Infertility , 12 3 CIVICS/Field Trip to Lake Arpi, 2012 , 13 3 Tarheel Health Portal/Lactose Intolerance , 14 3 Computational Contact Mechanics , 15 3 Data Networking/Spring 2015/Group 7 , 16 3 Multiple-use name , 17 3 Free education/My visit to Occupy UAL , 18 3 Free education , 19 3 Robert Frost in Translation , 20 3 IC3/Common Program Functions , 21 3 Principles of Management , 22 2 Photogrammetry , 23 2 Sport/Volleyball/2015 U20 FIVB World Championships , 24 2 ICT in Education/Change Projects/2015A Integrating ICT in teaching science and language subjects , 25 2 ICT in Education/Change Projects/Enhancing teaching and learning through the use of ICT Namilyango Junior Boys school Uganda

mai 2015: 1 11 Information Systems/Hardware , 2 9 Information Systems/Applications , 3 8 Wikiversity Law Reports/Civic Chandran v Ammini Amma , 4 7 Information Systems/Peripherals , 5 6 Electric Mobility/Engineering/Aerodynamics , 6 6 Wikiversity Law Reports/Gramophone Co v Shanti Films , 7 6 Information Systems/Operating Systems , 8 5 Sustainable Development Goals , 9 4 Sport/Volleyball/FIVB World Women's Volleyball Championship , 10 4 Sport/Volleyball/Asian Women's Volleyball Championship , 11 4 Sport/Volleyball/Round9-with third , 12 4 Sport/Volleyball/2016 Asian U23 Women's Volleyball , 13 4 Sport/Volleyball/23 Asian Women's Volleyball , 14 4 Sport/Volleyball/Philippines-Turkey rivalry , 15 3 Low-Cost Precision Farming , 16 3 Representation theory of the Lorentz group , 17 3 Sport/Volleyball/TPE , 18 3 Sport/Volleyball/GER , 19 3 Sport/Volleyball/RUS , 20 3 Sport/Volleyball/DOM , 21 3 Sport/Volleyball/CUB , 22 3 Sport/Volleyball/VEN , 23 3 Sport/Volleyball/ARG , 24 3 Sport/Volleyball/COL , 25 3 Sport/Volleyball/ALG

jun 2015: 1 9 Information Systems/Social Issues , 2 8 Information Systems/Security , 3 8 Information Systems/Operating Systems , 4 7 Information Systems/Systems Development , 5 7 Information Systems/Internet , 6 6 Information Systems/Information Systems , 7 5 Sport/Volleyball/2015 U20 FIVB World Championships , 8 5 Information Systems/Databases , 9 5 Information Systems/Applications , 10 4 Nonstandard physics/Vortex Science , 11 4 Cosmology , 12 4 Information Systems/Programming , 13 4 Nonstandard physics , 14 3 WikiJournal Preprints/Yolmo people , 15 3 Electric Mobility/Engineering/Aerodynamics , 16 3 Low-Cost Precision Farming , 17 3 Information Systems/Networking , 18 3 Digital Signature , 19 3 Boubaker Polynomials , 20 3 UTPA STEM/CBI Courses/Thermodynamics , 21 3 UTPA STEM/CBI Courses/Materials , 22 3 UTPA STEM/CBI Courses/Numerical Methods and Statistics , 23 3 UTPA STEM/CBI Courses/Mechatronics , 24 3 UTPA STEM/CBI Courses/Statics , 25 3 UTPA STEM/CBI Courses/Measurements

jul 2015: 1 3 Photogrammetry , 2 3 Sport/Volleyball/2015 U20 FIVB World Championships , 3 3 Introduction To Economics , 4 3 Sport/Volleyball/18th Asian Women's Volleyball Championship , 5 3 Sport/Volleyball/19th Asian Women's Volleyball Championship , 6 3 Sport/Volleyball/20th Asian Women's Volleyball Championship , 7 3 Sport/Volleyball/21rst Asian Women's Volleyball Championship , 8 3 Sport/Volleyball/THA , 9 3 Sport/Volleyball/Asian Women's Volleyball Championship , 10 3 High School Chemistry , 11 3 Reed–Solomon codes for coders , 12 2 WikiJournal Preprints/Yolmo people , 13 2 Swarm intelligence , 14 2 The English Quran , 15 2 Functional Electronic Stimulation , 16 2 Astronomy college course/Chasing Pluto , 17 2 The Highschool Help Forum - Science Stream/Chemistry Help Forum , 18 2 Chemicals/Materials , 19 2 Introduction To Economics/Week 1/Vocabulary , 20 2 Introduction To Economics/Week 1/Quiz , 21 2 Introduction To Economics/Week 1 , 22 2 Astronomy college course/Sandbox , 23 2 Sport/Volleyball/Infobox FIVB tournament , 24 2 Neurology/Arteriovenous Malformation , 25 2 Gears/Pressure angle

ago 2015: 1 49 Motivation and emotion/Book/2015 , 2 7 Sport/Volleyball/2015 U20 FIVB World Championships , 3 6 Digital Signature , 4 5 Swarm intelligence , 5 3 Sustainable Development Goals , 6 3 Art movements/Neoism , 7 3 Service Dog/German Shepherd , 8 3 Sustainability/Handbook , 9 3 Multiple-use name , 10 3 Art practices , 11 3 Mathematics/Astronomy , 12 3 Victor Hugo quote , 13 2 WikiJournal Preprints/Yolmo people , 14 2 Robot , 15 2 Metagraphy , 16 2 Motivation and emotion/Book/2015/Emotion as motivation , 17 2 Art practices/Metagraphy , 18 2 Landmark Education/Abd/Blaming the victim/Never going back , 19 2 Motivation and emotion/Book/2015/Caffeine and anxiety , 20 2 Motivation and emotion/Book/2015/Exercise motivation in people living with dementia , 21 2 Motivation and emotion/Book/2015/Personality and achievement motivation , 22 2 Motivation and emotion/Book/2015/Cystic fibrosis treatment motivation , 23 2 Art Strike , 24 2 Motivation and emotion/Book/2015/Suicidal terrorism motivation , 25 2 Minerals/Metals/Body-centered cubics

set 2015: 1 16 Information Systems/Introduction , 2 14 Sport/Volleyball/2015 U20 FIVB World Championships , 3 12 Sustainable Development Goals , 4 11 Information Systems/Hardware , 5 11 Motivation and emotion/Book/2015 , 6 10 Information Systems/Peripherals , 7 9 Ceremonial pole , 8 8 ICT in Education/Change Projects , 9 6 Information Systems/Operating Systems , 10 5 Motivation and emotion/Book/2015/Grief and health , 11 4 Digital Signature , 12 3 Low-Cost Precision Farming , 13 3 Volleyball/FIVB World U21 Women's Championships , 14 3 MATLAB essential , 15 3 ICT in Education/Change Projects/2015B Zimbabwe Mobile ICT Satellite Unit , 16 3 Motivation and emotion/Book/2015/High-risk business motivation , 17 3 Bell's theorem/Introduction , 18 3 Motivation and emotion/Book/2015/Family influences on academic motivation , 19 3 Motivation and emotion/Book/2015/Internet addiction motivation , 20 3 Bell's theorem/Proofs , 21 3 Motivation and emotion/Book/2015/Cystic fibrosis treatment motivation , 22 3 Art movements/Neoism , 23 3 Business/Companies/Facebook , 24 3 Orthoptic clinical practice/Edit Wikipedia , 25 3 Plutarch quote

out 2015: 1 17 Motivation and emotion/Book/2015 , 2 11 Information Systems/Internet , 3 11 Information Systems/Applications , 4 11 Motivation and emotion/Book/2015/Menstrual cycle and emotion , 5 9 Ceremonial pole , 6 9 Motivation and emotion/Book/2015/Empathy and emotional well-being , 7 9 Motivation and emotion/Book/2015/High-risk business motivation , 8 9 Information Systems/Security , 9 9 Information Systems/Networking , 10 8 Motivation and emotion/Book/2015/Video games and emotion , 11 8 Motivation and emotion/Book/2015/Personality and achievement motivation , 12 7 Sustainable Development Goals , 13 7 Motivation and emotion/Book/2015/Consumer motivation , 14 7 Motivation and emotion/Book/2015/Extreme emotions as motivation , 15 7 Motivation and emotion/Book/2015/Reading motivation in young learners , 16 7 Information Systems/Operating Systems , 17 7 Motivation and emotion/Book/2015/Hot memory and emotion , 18 6 Motivation and emotion/Book/2015/Flashbulb memories and emotion , 19 6 Motivation and emotion/Book/2015/Running and depression , 20 6 Motivation and emotion/Book/2015/Leaving violent relationship motivation for women , 21 6 Motivation and emotion/Book/2015/Alcohol and aggression , 22 6 Motivation and emotion/Book/2015/Stress and infertility , 23 6 Motivation and emotion/Book/2015/Dance motivation , 24 6 Motivation and emotion/Book/2015/Psychopathy and emotion , 25 6 Motivation and emotion/Book/2015/Laughter and emotion

nov 2015: 1 33 Menomonie, Wisconsin History , 2 11 Menomonie, Wisconsin History/Mabel Tainter Theater , 3 11 Information Systems/Information Systems , 4 10 Sustainable Development Goals , 5 10 Information Systems/Programming , 6 9 Information Systems/Databases , 7 9 Information Systems/Systems Development , 8 7 Menomonie, Wisconsin History/uw stout history , 9 6 Menomonie, Wisconsin History/Ojibwe , 10 6 Open Global Health , 11 5 Menomonie, Wisconsin History/breweries , 12 4 Representation theory of the Lorentz group , 13 4 Menomonie, Wisconsin History/Supernatural and Folklore , 14 4 Menomonie, Wisconsin History/Andrew Tainter/SarahBeth19 , 15 4 Menomonie, Wisconsin History/Murders , 16 4 Motivation and emotion/Book/2015/Sport team fandom motivation , 17 4 Motivation and emotion/Book/2015/Binge drinking motivation in young people , 18 4 Motivation and emotion/Book/2015/Eustress , 19 3 Menomonie, Wisconsin History/Logging , 20 3 Menomonie, Wisconsin History/Dakota , 21 3 Open Global Health/1st meeting , 22 3 TV One/Love That Girl! , 23 3 Motivation and emotion/Book/2015/Love and lust , 24 3 Motivation and emotion/Book/2015/Bullying and pack behavior motivation in adolescents , 25 3 Project Management/Risk

dez 2015: 1 26 Menomonie, Wisconsin History , 2 10 Information Systems/Social Issues , 3 7 Sustainable Development Goals , 4 7 Menomonie, Wisconsin History/hauntings , 5 7 Data Networking/Spring 2014/Group0 , 6 6 Menomonie, Wisconsin History/Mabel Tainter Theater , 7 6 Menomonie, Wisconsin History/uw stout history , 8 5 Menomonie, Wisconsin History/Ojibwe , 9 4 Data Networking/Fall 2015/DKNR , 10 4 Menomonie, Wisconsin History/breweries , 11 4 Project Management/Cost , 12 4 Data Networking , 13 3 Swarm intelligence , 14 3 Pre-Late Egyptian Reconstruction/Templatic Class I , 15 3 Pre-Late Egyptian Reconstruction/Intro to Verb Classifications , 16 3 Menomonie, Wisconsin History/James Huff Stout , 17 3 Data Networking/Fall 2015/56 Clearway , 18 3 Data Networking/Fall 2015/Zopgang , 19 3 Data Networking/Fall 2015/Smarvind , 20 3 Wright State University Lake Campus/Mock Course 1010 , 21 3 Pre-Late Egyptian Reconstruction/Structure of Egyptian Verb , 22 3 Pre-Late Egyptian Reconstruction , 23 3 Menomonie, Wisconsin History/Murders , 24 3 Menomonie, Wisconsin History/Andrew Tainter , 25 3 Project Management/Risk

jan 2016: 1 27 Wright State University Lake Campus/2016-1/Phy2400 , 2 16 Wright State University Lake Campus/2016-1/Phy1060 , 3 10 Wright State University Lake Campus/2016-1/Phy1060/log/Guy vandegriftSock1 , 4 8 Digital Signature , 5 5 Wright State University Lake Campus/2016-1/Phy1060/log/Guy vandegriftSock3 , 6 5 Wright State University Lake Campus/2016-1/Phy1060/log/Guy vandegriftSock2 , 7 4 Wright State University Lake Campus/2016-1/Phy1120 , 8 4 WikiJournal of Science/Editorial board , 9 4 Wright State University Lake Campus/2016-1/Phy1060/log , 10 3 Photogrammetry , 11 3 Astronomy college course/Wikipedia Sidereus Nuncius/Quiz01/9 , 12 3 WikiJournal of Science/About/Why this journal was created , 13 3 Second Journal of Science/Editorial board/log , 14 3 Hydroculture Research , 15 3 Visual C++ name mangling , 16 3 IMHA Research Archives/Research Projects/Research Protocol , 17 3 WikiJournal of Medicine/Editorial board , 18 3 Radiation astronomy/Intergalactic medium , 19 3 Computer Hardware Types , 20 3 Main Page/News , 21 2 Sustainable Development Goals , 22 2 KnitR , 23 2 WikiJournal of Science/About , 24 2 Astronomy college course/Astronomy (wikipedia)/Quiz02/3 , 25 2 WikiJournal of Science/Submissions/Abridged timeline of quantum mechanics

fev 2016: 1 9 Physics and Astronomy Labs/Vernier force probe , 2 5 Physics and Astronomy Labs/Static forces , 3 5 ICT in Education/Change Projects , 4 4 WikiJournal Preprints/Hepatitis E , 5 4 Swarm intelligence , 6 4 Representation theory of the Lorentz group , 7 4 Physics and Astronomy Labs/Force table , 8 4 Poker , 9 3 Karachi Art Anti University , 10 3 Graphic Design/Glossary , 11 3 Evidence based assessment/Substance use disorder (disorder portfolio) , 12 3 Evidence based assessment/Social anxiety disorder (disorder portfolio) , 13 3 Evidence based assessment/Posttraumatic stress disorder (disorder portfolio) , 14 3 Evidence based assessment/Depression in youth (assessment portfolio) , 15 3 Evidence based assessment/Anorexia nervosa (assessment portfolio) , 16 3 Second Journal of Science/Editorial board/log , 17 3 Wright State University Lake Campus/2016-1/Phy2400 , 18 3 MATLAB essential , 19 3 Speak Math Now! , 20 3 Educational Media Awareness Campaign/Music , 21 3 Principles of Management , 22 3 Graphic Design , 23 3 Introduction to music , 24 2 WikiJournal Preprints/Yolmo people , 25 2 Photogrammetry

mar 2016: 1 5 Low-Cost Precision Farming , 2 4 Digital Signature , 3 4 Instructional design/Component Display Theory , 4 3 Instructional design/Procedural analysis/Page 3: What is task analysis? , 5 3 Management for Planners , 6 3 Happiness/Happiness research/Happiness, The Universal Law of , 7 3 Atlantis , 8 3 Evidence based assessment/Bipolar disorder in youth (assessment portfolio) , 9 3 Evidence based assessment/Conduct disorder (assessment portfolio) , 10 3 Evidence based assessment/Autism spectrum disorder (assessment portfolio) , 11 3 Evidence based assessment/Attention deficit hyperactivity disorder (assessment portfolio) , 12 3 Evidence based assessment/Anorexia nervosa (assessment portfolio) , 13 3 History of Sri Lanka , 14 3 Instructional Design/Navbox , 15 3 Computer Hardware Types , 16 3 Input Devices , 17 3 Statistical thermodynamics , 18 3 Music theory , 19 3 Aerospace engineering , 20 2 WikiJournal Preprints/Yolmo people , 21 2 Instructional design/Learner analysis/what when why/demographics/cognitive/physiological/affective , 22 2 Instructional design/Learner analysis/what when why/demographics/cognitive/physiological , 23 2 Instructional design/Learner analysis/what when why/demographics/cognitive , 24 2 Wright State University Lake Campus/2016-1/Phy2400/log/Guy vandegrift , 25 2 Maritime Clinical Colloquial Network/International classification of diseases for the guidelines

abr 2016: 1 5 Sustainable Development Goals , 2 3 Swarm intelligence , 3 3 Automated Feedback and Interactions: Summary , 4 3 Automated Feedback and Interactions: Test Your Knowledge , 5 3 Automated Feedback and Interactions: What Makes a Good Interactive , 6 3 Automated Feedback and Interactions: Interactions with Automated Feedback , 7 3 Automated Feedback and Interactions: What Kind of Interactives Are There , 8 3 Analyzing art , 9 3 Automated Feedback and Interactions: What are Automated Feedback and Automated Interactions , 10 3 Automated Feedback and Interactions , 11 3 Instructional design/SAMR Model/Transforming Learning Using the SAMR Model , 12 3 Instructional design/SAMR Model/Identifying SAMR Application , 13 3 Instructional design/SAMR Model/SAMR Vocabulary , 14 3 Instructional design/SAMR Model/What is the SAMR Model? , 15 3 Instructional design/SAMR Model , 16 3 Instructional design/Learner analysis/what when why/demographics/cognitive , 17 3 Project Management/Communication , 18 3 Digital Signature , 19 2 Photogrammetry , 20 2 Charges/Capacitors , 21 2 WikiJournal of Science/Spaces in mathematics , 22 2 The Common Plastic Fish (Plasticus capensis) , 23 2 Astronomy college course/Solar system/Quiz 2/9 , 24 2 Astronomy college course/Star cluster quiz/14 , 25 2 Literature/1923/Ogden/Leon

mai 2016: 1 6 Sustainable Development Goals , 2 3 Satellite Transmissions , 3 3 WikiJournal of Medicine/The Cerebellum , 4 3 Is anonymity for Wikipedia contributors desirable? , 5 3 Information Systems/Introduction , 6 3 Project Management/Quality Management , 7 3 Project Management/Communication , 8 3 Information Systems/Peripherals , 9 3 Information Systems/Hardware , 10 3 IC3/Computer Hardware , 11 2 What is the sixth sense? , 12 2 WikiJournal Preprints/Yolmo people , 13 2 Photogrammetry , 14 2 One Health , 15 2 Hepatology/Hepatocellular Carcinoma , 16 2 Hepatology/Non-Alcoholic Fatty Liver Disease (NAFLD) , 17 2 Hepatology/Hepatitis B and Hepatitis D , 18 2 Hepatology , 19 2 The Speedway League School/Balance in Songwriting , 20 2 German Home Immersion School/Immersion Exercises , 21 2 German Home Immersion School/Teachers , 22 2 German Home Immersion School , 23 2 Instructional design/Backward Design/Summary , 24 2 Instructional design/Backward Design/Selecting the Learning Activities , 25 2 Instructional design/Backward Design/Selecting the Evidence

jun 2016: 1 5 Photogrammetry , 2 5 Information Systems/Social Issues , 3 5 IC3/Database Software , 4 4 WikiJournal Preprints/Yolmo people , 5 3 Representation theory of the Lorentz group , 6 3 Information Systems/Programming , 7 3 Information Systems/Information Systems , 8 3 Information Systems/Security , 9 3 Information Systems/Networking , 10 3 Information Systems/Applications , 11 3 IC3/Document Collaboration , 12 3 IC3/Presentation Software , 13 3 IC3/Spreadsheets , 14 3 IC3/Word Processing , 15 3 IC3/Internet Fundamentals , 16 3 IC3/Using an Operating System , 17 3 IC3/Computer Software , 18 3 Digital Signature , 19 2 Low-Cost Precision Farming , 20 2 Geochronology/Dye 3 , 21 2 Fundamental units , 22 2 Pre-Late Egyptian Reconstruction/Templatic Class I: The i-Type Vocalizations , 23 2 Web development , 24 2 Situationism/Détournement , 25 2 Sajem Tan/Morphological cases

jul 2016: 1 6 Motivation and emotion/Book/2016 , 2 6 Tourism/Introduction , 3 5 Swarm intelligence , 4 5 WikiJournal of Medicine/Editors , 5 4 WikiJournal of Medicine/Editorial board , 6 4 Digital Signature , 7 3 WikiJournal of Medicine/Updates , 8 3 WikiJournal of Medicine/To do , 9 3 WikiJournal User Group/Future as separate Wikimedia project , 10 3 Spanish 2/Chapter 1 (Classroom Events) , 11 3 Main Page/News , 12 2 WikiJournal Preprints/Yolmo people , 13 2 Low-Cost Precision Farming , 14 2 German Home Immersion School/Warm-Ups for Beginners (Übungen für Anfänger) , 15 2 MacOS , 16 2 Risk Management/Agricultural Water Pollution Management , 17 2 WikiJournal of Medicine/Volume 3 Issue 1 , 18 2 WikiJournal of Medicine/Volume 2 Issue 1 , 19 2 Balance of Payments/Overview , 20 2 Balance of Payments , 21 2 German Home Immersion School , 22 2 WikiJournal of Medicine/The Cerebellum , 23 2 Keynote lectures/Dates , 24 2 The History of Dancing/Ancient dances , 25 2 WikiJournal of Medicine/Past issues

ago 2016: 1 41 Motivation and emotion/Book/2016 , 2 22 Wright State University Lake Campus/2016-9/Phy2410 , 3 20 Wright State University Lake Campus/2016-9/Phy1050 , 4 7 Wright State University Lake Campus/2016-9/Phy1110 , 5 5 WikiJournal of Medicine/Editorial board , 6 4 Miraheze , 7 3 WikiJournal Preprints/Yolmo people , 8 3 Swarm intelligence , 9 3 Bengali Language/Foreign words , 10 3 Bengali Language/Nouns , 11 3 Bengali Language/Greetings and basic polite expressions , 12 3 Bengali Language , 13 3 Motivation and emotion/Book/2016/Betrayal motivation , 14 3 Motivation and emotion/Book/2016/Bystander intervention motivation , 15 3 Motivation and emotion/Book/2016/Anorexia nervosa and extrinsic motivation , 16 3 Motivation and emotion/Book/2016/Motivational interviewing , 17 3 Motivation and emotion/Book/2016/Mental health help-seeking motivation , 18 3 Motivation and emotion/Book/2016/Extreme altruism , 19 3 Homeschooling/California/Fresno County , 20 3 Homeschooling/California , 21 3 Motivation and emotion/Book/2016/Sex and happiness , 22 3 Motivation and emotion/Book/2016/Recycling motivation , 23 3 Motivation and emotion/Book/2016/Stress recovery theory , 24 3 WikiJournal of Medicine/Editors , 25 3 Digital Signature

set 2016: 1 16 Digital Media Concepts , 2 13 Sustainable Development Goals , 3 9 Motivation and emotion/Book/2016 , 4 4 Motivation and emotion/Book/2016/Performance enhancing drug usage motivation in elite athletes , 5 4 Introduction to Spiritual Psychology , 6 4 Motivation and emotion/Book/2016/Anorexia nervosa and extrinsic motivation , 7 4 Wright State University Lake Campus/2016-9/Phy2410 , 8 4 WikiJournal of Medicine/Peer reviewers , 9 3 Evidence based assessment/Instruments/Yale-Brown Obsessive Compulsive Scale , 10 3 R in Health Decision Sciences , 11 3 Evidence based assessment/Templates and Instructions/Creating A New Instrument Page , 12 3 Motivation and emotion/Book/2016/Villain motivations , 13 3 Digital Media Concepts/Braille Skateboarding , 14 3 Digital Media Concepts/Stuart Blackton , 15 3 ICT in Education/Change Projects/2016B Zimbabwe eLearning Policy for Africa University , 16 3 ICT in Education/Change Projects/2016B Tanzania Supporting Virtual Learning , 17 3 ICT in Education/Change Projects/2016B Rwanda Using E-Learning tools in teaching learning , 18 3 Analogies for Sustainable Development , 19 3 Motivation and emotion/Book/2016/Artistic creation motivation , 20 3 Motivation and emotion/Book/2016/Restricted interests and anxiety in children with autistic spectrum disorders , 21 3 Motivation and emotion/Book/2016/Betrayal motivation , 22 3 Motivation and emotion/Book/2016/Attention restoration theory , 23 3 Motivation and emotion/Book/2016/Emotional hijacking , 24 3 Motivation and emotion/Book/2016/Recycling motivation , 25 3 Motivation and emotion/Book/2016/Vocational motivation and personality

out 2016: 1 16 Motivation and emotion/Book/2016 , 2 11 Motivation and emotion/Book/2016/Competition fighting motivation , 3 9 Motivation and emotion/Book/2016/Immunisation motivation in childhood , 4 9 Motivation and emotion/Book/2016/Death anxiety , 5 9 Motivation and emotion/Book/2016/Long-term goal achievement , 6 9 Motivation and emotion/Book/2016/Illicit drug taking at music festivals , 7 9 Motivation and emotion/Book/2016/Anorexia nervosa and extrinsic motivation , 8 8 Sustainable Development Goals , 9 8 Motivation and emotion/Book/2016/Religious radicalisation motivation , 10 8 Motivation and emotion/Book/2016/Self-management and chronic illness , 11 8 Motivation and emotion/Book/2016/Regrets , 12 8 Motivation and emotion/Book/2016/Stress recovery theory , 13 7 Motivation and emotion/Book/2016/Water and emotion , 14 7 Motivation and emotion/Book/2016/Leisure motivation , 15 7 Motivation and emotion/Book/2016/Amygdala in sport , 16 7 Motivation and emotion/Book/2016/Betrayal motivation , 17 7 Motivation and emotion/Book/2016/Emotional hijacking , 18 6 Motivation and emotion/Book/2016/Prenatal depression , 19 6 Motivation and emotion/Book/2016/Physical versus emotional infidelity , 20 6 Motivation and emotion/Book/2016/Attachment type and emotion , 21 6 Motivation and emotion/Book/2016/Mental illness and treatment motivation , 22 6 Motivation and emotion/Book/2016/Sexual assault non-reporting motivation , 23 6 Motivation and emotion/Book/2016/Reward dependence and motivation , 24 6 Motivation and emotion/Book/2016/Broaden-and-build theory of positive emotions , 25 5 Motivation and emotion/Book/2016/Youth suicide motivation

nov 2016: 1 5 Permutation notation , 2 4 One Health , 3 4 Slovio , 4 4 Speak Math Now!/Week 1: Introduction To Algebra , 5 4 Motivation and emotion/Book/2016/Mental illness and treatment motivation , 6 4 Motivation and emotion/Book/2016/Grit , 7 4 Project Management/Process , 8 4 Project Management/Project Charter , 9 4 Digital Signature , 10 3 Representation theory of the Lorentz group , 11 3 History of Greece , 12 3 Wright State University Lake Campus/Showcase/2016-9/Eng 1100 , 13 3 Evidence based assessment/Instruments/Screen for child anxiety related disorders , 14 3 Motivation and emotion/Book/2016/Sexting motivation , 15 3 Should we go vegan? , 16 3 Should we colonize Mars? , 17 3 Do humans have free will? , 18 3 Wright State University Lake Campus/2016-9/Phy1050/log/j0031723 , 19 3 Motivation and emotion/Book/2016/Immunisation motivation in childhood , 20 3 Motivation and emotion/Book/2016/Attachment type and emotion , 21 3 Wright State University Lake Campus/2016-9/Phy1050/log , 22 3 Motivation and emotion/Book/2016/Time perspective and happiness , 23 3 Motivation and emotion/Book/2016/Plants in the office and emotion , 24 3 Does God exist? , 25 3 WikiJournal of Medicine/Publishing

dez 2016: 1 15 Representation theory of the Lorentz group , 2 5 Data Networking/Fall 2016/PAKP , 3 5 Project Management/Process , 4 4 Swarm intelligence , 5 4 General mathematics , 6 4 Permutation notation , 7 4 Project Management/Project Charter , 8 4 WikiJournal User Group , 9 3 Sustainable Development Goals , 10 3 Low-Cost Precision Farming , 11 3 DAMTP/Commons , 12 3 DAMTP , 13 3 E-Proof , 14 3 Data Networking/Fall 2016/SAPS , 15 3 WikiJournal of Medicine/Plasmodium falciparum erythrocyte membrane protein 1 , 16 3 Should suicide be legal? , 17 3 WikiJournal of Medicine/WikiJournal of Medicine, the first Wikipedia-integrated academic journal , 18 3 Data Networking/Fall 2015/Shrutik Patel , 19 3 Three Sided Football , 20 3 WikiJournal of Medicine/Editors , 21 3 WikiJournal of Medicine/About , 22 3 Web Science/Part2: Emerging Web Properties/MoocIndex , 23 3 Inversion (discrete mathematics) , 24 3 President of the United States/Barack Obama , 25 3 Free and open domain names

jan 2017: 1 33 Wright State University Lake Campus/2017-1/Phy2400 , 2 23 Wright State University Lake Campus/2017-1/Phy1060 , 3 8 Drupal/Installation , 4 6 Representation theory of the Lorentz group , 5 6 Drupal , 6 6 Wright State University Lake Campus/2017-1/MTH2310 , 7 6 WikiJournal of Medicine/WikiJournal of Medicine, the first Wikipedia-integrated academic journal , 8 5 WikiJournal of Medicine/Eukaryotic and prokaryotic gene structure , 9 4 Wright State University Lake Campus/2017-1/Phy1120 , 10 4 Digital Signature , 11 4 Main Page/News , 12 3 Swarm intelligence , 13 3 WikiJournal of Medicine/Potential upcoming articles , 14 3 Mathematical Properties , 15 3 Localization , 16 3 WikiJournal of Medicine/About , 17 3 WikiJournal of Medicine/Publishing , 18 3 Business/Companies , 19 3 1000 Songs/Shepherd of Eager Youth (Clement of Alexandria) , 20 3 Harmony , 21 3 Introduction to music , 22 2 Low-Cost Precision Farming , 23 2 AP World History Study Guide , 24 2 WikiJournal of Medicine/Citation metrics , 25 2 Wright State University Lake Campus/2017-1/Phy1060/log/16schmg teresa.h

fev 2017: 1 17 Digital Media Concepts , 2 9 Localization , 3 8 Seminar in Biological Mechanisms of Aging and Cancer/Journal Club , 4 8 Computer Architecture Lab/SS2017 , 5 8 Seminar in Biological Mechanisms of Aging and Cancer , 6 5 Evidence based assessment/ROC Party/Summer 2017 , 7 4 Representation theory of the Lorentz group , 8 4 Seminar in Biological Mechanisms of Aging and Cancer/Genomic Instability (nuclear architecture) , 9 4 ICT in Education/Change Projects/2016C Kosovo Human Resource Development in Using ICT for Education , 10 4 Evidence based assessment/Step 1: Plan for most common issues in clinic setting , 11 4 WikiJournal User Group , 12 4 Digital Signature , 13 3 ContentMine , 14 3 Programming MOOC/MoocIndex , 15 3 ICT in Education/Change Projects/2016C Ethiopia Teaching Application Project , 16 3 Evidence based assessment/Vignettes/Tamika , 17 3 Evidence based assessment/Vignettes/Jay , 18 3 Evidence based assessment/Vignettes/Deshawn , 19 3 Evidence based assessment/Vignettes/Christopher , 20 3 Digital Media Concepts/Archaeology Robots , 21 3 Evidence based assessment/Vignettes , 22 3 Evidence based assessment/Measures , 23 3 Digital Media Concepts/John Lasseter , 24 3 Evidence based assessment/ROC Party/Ready to ROC , 25 3 WikiJournal of Medicine/Citation metrics

mar 2017: 1 22 Social Media/Marketing , 2 16 Localization , 3 6 Sustainable Development Goals , 4 6 Digital Signature , 5 5 Seminar in Biological Mechanisms of Aging and Cancer , 6 5 Should suicide be legal? , 7 4 WikiJournal of Medicine/The Hippocampus , 8 4 Does God exist? , 9 4 Facebook improvements , 10 3 PanDocElectron/How to create a html presentation , 11 3 Wikidirectory , 12 3 The Speedway League School/Man/Machine - A Guide to Gear and Music Technology , 13 3 Evidence based assessment/Vignettes/Deshawn , 14 3 Computer Architecture Lab/SS2017 , 15 3 WikiJournal of Medicine/Potential upcoming articles , 16 3 WikiJournal of Medicine/Plasmodium falciparum erythrocyte membrane protein 1 , 17 3 PanDocElectron , 18 3 Should we go vegan? , 19 3 Computer Hardware Types , 20 3 Wiki Journal (magazine) , 21 2 WikiJournal of Medicine/Rotavirus , 22 2 Wikidirectory/Guidelines , 23 2 WikiJournal User Group/Bylaws , 24 2 Covalently bonded , 25 2 WikiJournal of Medicine/Endometrial cancer

abr 2017: 1 10 Sustainable Development Goals , 2 7 Research in programming Wikidata , 3 4 Number bases , 4 4 Project Management/Change Management , 5 4 Intellectual Property/Proposed policy and procedures for Australian research and education , 6 3 LearnIt , 7 3 Should firearms be available to civilians? , 8 3 Editing Internet Texts/Interactive whiteboards for teaching , 9 3 Editing Internet Texts/Translation of children's literature , 10 3 Should we go vegan? , 11 3 Should abortion be legal? , 12 3 Does God exist? , 13 3 Wikidebate , 14 3 Evidence based assessment/Substance use disorder (disorder portfolio) , 15 3 Evidence based assessment/Generalized anxiety disorder (assessment portfolio) , 16 3 Evidence based assessment/Depression in youth (assessment portfolio) , 17 3 Risk Management/Content Matrix , 18 3 Web Design/Accessibility , 19 2 Low-Cost Precision Farming , 20 2 WikiJournal of Science/Spaces in mathematics , 21 2 Brexit , 22 2 English Law/Tort , 23 2 Ancient Codes of Law , 24 2 Hilbert Book Model Project/Perceptibility and Recognition at Low Dose Rate , 25 2 Hilbert Book Model Project/Multi-mix Path Algorithm

mai 2017: 1 9 Sustainable Development Goals , 2 7 Research in programming Wikidata , 3 5 Photogrammetry , 4 5 Low-Cost Precision Farming , 5 5 Information Systems/Introduction , 6 5 Information Systems/Hardware , 7 5 IC3/Computer Hardware , 8 4 Project Management/Change Management , 9 3 Research in programming Wikidata/Banks , 10 3 Research in programming Wikidata/Natural disaster , 11 3 Wikidirectory , 12 3 Project Management/Procurement , 13 3 Information Systems/Peripherals , 14 2 Hilbert Book Model Project/Hilbert Book Model/nl , 15 2 Fundamental Physics/Electricity/Electricity Source , 16 2 Organising in the Social Factory/RUDI/Rebel Arts , 17 2 Organising in the Social Factory/RUDI/Carl Rowe , 18 2 Organising in the Social Factory/RUDI/Ramona And Elmira Zadissa , 19 2 Organising in the Social Factory , 20 2 Research in programming Wikidata/Aircraft , 21 2 Eclipse ERP , 22 2 Organising in the Social Factory/RUDI , 23 2 Organising in the Social Factory/Student movement , 24 2 Organising in the Social Factory/Workers movement , 25 2 The Federalist Papers

jun 2017: 1 11 Information Systems/Social Issues , 2 8 Sustainable Development Goals , 3 6 Information Systems/Databases , 4 5 WikiJournal of Medicine/Vitamin D as an adjunct for acute community-acquired pneumonia among infants and children: systematic review and meta-analysis , 5 5 JCCAP FDF/2017/Bipolar disorder , 6 5 IC3/Word Processing , 7 4 Information Systems/Information Systems , 8 4 Information Systems/Applications , 9 4 Information Systems/Operating Systems , 10 4 IC3/Common Program Functions , 11 4 IC3/Using an Operating System , 12 3 One Health , 13 3 Internet Fundamentals/Security , 14 3 WikiJournal of Science/Spaces in mathematics , 15 3 Representation theory of the Lorentz group (for undergraduate students of physics) , 16 3 JCCAP FDF/2017/Conduct disorder , 17 3 JCCAP FDF/2017/Evidence based assessment , 18 3 JCCAP FDF/2017/Suicide , 19 3 Flowgorithm , 20 3 WikiJournal of Medicine/Potential upcoming articles , 21 3 Computer Programming/Introduction , 22 3 Escuela de Lenguas UNLP/Academic Writing/Music , 23 3 Project Management/Introduction , 24 3 Information Systems/Programming , 25 3 Information Systems/Systems Development

jul 2017: 1 7 Sustainable Development Goals , 2 5 Information Systems/Introduction , 3 5 Information Systems/Operating Systems , 4 5 IC3/Common Program Functions , 5 5 Digital Signature , 6 4 Does God exist? , 7 4 Information Systems/Security , 8 4 Information Systems/Internet , 9 4 Information Systems/Applications , 10 4 Information Systems/Peripherals , 11 4 Information Systems/Hardware , 12 4 Atlantis/Location Hypotheses , 13 4 IC3/Spreadsheets , 14 4 IC3/Word Processing , 15 4 IC3/Computer Hardware , 16 3 One Health , 17 3 Create a training and development plan , 18 3 SCCAP/APA Convention/2017/Beyond Empirically Supported Treatments–Advances in the Evidence-Based Practice of Psychology , 19 3 SCCAP/APA Convention/2017/Advancements in Research and Practice with Childhood Externalizing Problems , 20 3 SCCAP/APA Convention/2017/Children's Mental Health in the Aftermath of Disaster , 21 3 Does objective reality exist? , 22 3 WikiJournal of Medicine/Endometrial cancer , 23 3 Motivation and emotion/Book/2017 , 24 3 Should abortion be legal? , 25 3 Do humans have free will?

ago 2017: 1 87 Motivation and emotion/Book/2017 , 2 18 Materials Science and Engineering/Timeline of Material Advances , 3 11 Sustainable Development Goals , 4 5 Information Systems/Social Issues , 5 5 Information Systems/Systems Development , 6 4 Information Systems/Information Systems , 7 4 IC3/Computer Use and Safety , 8 4 Digital Signature , 9 3 Motivation and emotion/Book/2017/Misophonia , 10 3 Motivation and emotion/Book/2017/Homesickness , 11 3 Motivation and emotion/Book/2017/Hormones and motivation , 12 3 Motivation and emotion/Book/2018/Self-perception theory and motivation for positive change , 13 3 Motivation and emotion/Book/2017/Testosterone and sexual motivation , 14 3 Segment display/Seven-segment display , 15 3 WikiJournal of Medicine/Volume 4 Issue 1 , 16 3 WikiJournal of Medicine/Acute gastrointestinal bleeding from a chronic cause: a teaching case report , 17 3 Information Systems/Databases , 18 3 Information Systems/Programming , 19 3 Radiation astronomy/Courses/Principles/Final quiz , 20 3 IC3/Presentation Software , 21 3 Fundamental Physics/Electromagnetism , 22 2 WikiJournal Preprints/Template:Reflist , 23 2 Newton's laws of motion , 24 2 Motivation and emotion/Book/2018/Hope and motivation , 25 2 Motivation and emotion/Book/2017/Reactance

set 2017: 1 20 Digital Media Concepts , 2 18 Motivation and emotion/Book/2017 , 3 5 OToPS/Measures/Hypomanic Personality Scale , 4 4 Motivation and emotion/Book/2017/Delayed reinforcement and motivation , 5 3 Federal Writers' Project - Life Histories/2017/Fall/Section 26 , 6 3 Federal Writers' Project - Life Histories/2017/Fall , 7 3 Digital Media Concepts/Graphics processing unit , 8 3 Motivation and emotion/Book/2017/Emotional chills , 9 3 Motivation and emotion/Book/2017/Cannabis and positive emotions , 10 3 Motivation and emotion/Book/2017/Serotonin and motivation , 11 3 Motivation and emotion/Book/2017/Mental toughness , 12 3 Motivation and emotion/Book/2017/Counterfactual thinking motivation , 13 3 Motivation and emotion/Book/2017/Rational emotive behavior therapy , 14 3 Motivation and emotion/Book/2017/Neurotransmitters and motivation , 15 3 Motivation and emotion/Book/2017/Parenting in youth sport , 16 3 Motivation and emotion/Book/2017/Awe and well-being , 17 3 Motivation and emotion/Book/2017/Hormones and emotion , 18 3 Motivation and emotion/Book/2017/Hypothalamus and motivation , 19 3 Motivation and emotion/Book/2017/Disgust and prejudice , 20 3 Motivation and emotion/Book/2017/End of life regrets , 21 3 Basic income , 22 3 Study of Mark , 23 3 Lunarpedia , 24 3 Technical writing , 25 2 ♠/Slide whistles and harmony

out 2017: 1 9 Motivation and emotion/Book/2017/Hypothalamus and motivation , 2 8 Geographic Information System , 3 7 Motivation and emotion/Book/2017/Paraphilia motivations , 4 5 ArcGIS , 5 5 What We Wish They Knew: 13 Reasons Why , 6 5 Motivation and emotion/Book/2017/Online dating motivation and gender , 7 5 Motivation and emotion/Book/2018/Hope and motivation , 8 5 Motivation and emotion/Book/2017/Biological factors in emotional reactivity , 9 5 Motivation and emotion/Book/2017/Loneliness , 10 5 Motivation and emotion/Book/2017/Neurotransmitters and motivation , 11 5 Motivation and emotion/Book/2017/Social movement motivation , 12 5 Motivation and emotion/Book/2017/Stillbirth and emotion , 13 5 Motivation and emotion/Book/2017/Awe and well-being , 14 4 Motivation and emotion/Book/2017/Procrastination benefits , 15 4 Representation of Eating Disorders in To the Bone , 16 4 Microbiome and Mental Health , 17 4 Motivation and emotion/Book/2017/Drive reduction theory of motivation , 18 4 Motivation and emotion/Book/2017/Multi-tasking motivation , 19 4 Motivation and emotion/Book/2017/Time perspective and happiness , 20 4 Motivation and emotion/Book/2017/Gamification and motivation , 21 4 Motivation and emotion/Book/2017/Pleasure motivation , 22 4 Motivation and emotion/Book/2017/Compatibilism , 23 4 Motivation and emotion/Book/2017/Exercise and negative emotions , 24 4 Motivation and emotion/Book/2017/Oxytocin and trust , 25 4 Motivation and emotion/Book/2017/Ghrelin, leptin, hunger, and eating

nov 2017: 1 15 Schizophrenia, Criminality, and its Portrayal in the Media , 2 14 Representation of Eating Disorders in To the Bone , 3 11 OToPS/Measures/Hypomanic Personality Scale , 4 10 Microbiome and Mental Health , 5 8 Helping Give Away Psychological Science/Outreach/Edit-a-thons/Fall 2017/Chapel Hill , 6 8 OToPS/Measures/Attribution Questionnaire , 7 6 OToPS/Measures/Morning-Eveningness Questionnaire , 8 6 WikiJournal of Science/Editorial board , 9 5 Vygotsky and Online Learning , 10 5 WikiJournal of Science/Editorial guidelines , 11 4 WikiJournal of Science/Bylaws/Proposed changes , 12 4 Motivation and emotion/Book/2017/Depression and study motivation , 13 4 WikiJournal of Medicine/Rotavirus , 14 4 WikiJournal of Medicine/Potential upcoming articles , 15 4 Helping Give Away Psychological Science , 16 4 Main Page/News , 17 3 WikiJournal of Science/Editorial guidelines/Message templates , 18 3 Markdown , 19 3 ABCT Bipolar SIG , 20 3 English as a global language , 21 3 Helping Give Away Psychological Science/Resources/Substance Abuse , 22 3 OToPS/Measures/Hypomania Checklist , 23 3 Motivation and emotion/Book/2017/James-Lange theory of emotion , 24 3 OToPS/Measures/7 Up 7 Down Inventory , 25 3 Motivation and emotion/Book/2017/Hormones and motivation

dez 2017: 1 9 Research in programming Wikidata , 2 6 WikiJournal of Medicine/Editorial board , 3 4 WikiJournal of Humanities/Editorial board , 4 4 WikiJournal of Medicine/Cell disassembly during apoptosis , 5 4 President of the United States/Donald Trump , 6 4 WikiJournal of Medicine/Associate editors , 7 4 WikiJournal of Science/Editorial board , 8 4 Main Page/News , 9 3 Photographic Tourism , 10 3 OToPS/Measures/FAQ , 11 3 WikiJournal of Medicine/Volume 4 Issue 1 , 12 3 Is capitalism sustainable? , 13 3 Wright State University Lake Campus/2016-9/Phy1050/log , 14 3 WikiJournal of Science/About , 15 3 Mathematical Properties , 16 3 WikiJournal of Medicine/Editors , 17 3 Meteor radiation astronomy/Quiz , 18 3 Philosophy/Sciences , 19 2 Home Shop Machining/Material , 20 2 Magnetic Gravity , 21 2 Home Shop Machining/Machining Operations , 22 2 Home Shop Machining , 23 2 Global warming/Temperature reduction , 24 2 3D Modelling/Create 3D Models/AR.js/main attributes , 25 2 Research in programming Wikidata/Spacecraft and stations

jan 2018: 1 8 Applied Programming/Variables , 2 6 Applied Programming/Functions , 3 5 Microlissencephaly: a narrative review , 4 4 3D Modelling/Examples/Red-Green Anaglyph , 5 4 WikiJournal of Science/ShK toxin: history, structure and therapeutic applications for autoimmune diseases , 6 4 Applied Programming/Conditions , 7 4 Wikimedia Deutschland/Open Science Fellows Program/fellows , 8 4 WikiJournal User Group/Ethics statement , 9 4 Wikipedia/Quizzes , 10 4 Main Page/News , 11 4 College Algebra/Grammar quiz , 12 3 Thrust-to-weight ratio , 13 3 Biodiversity/Introduction , 14 3 , 15 3 WikiJournal of Humanities/Editorial board , 16 3 What We Wish They Knew: 13 Reasons Why , 17 3 Research in programming Wikidata/University , 18 3 WikiJournal of Medicine/Endometrial cancer , 19 3 WikiJournal of Medicine/Potential upcoming articles , 20 3 President of the United States/Donald Trump , 21 3 WikiJournal of Science/Contribute , 22 3 WikiJournal of Medicine/Editorial board , 23 3 Computer Hardware Types , 24 3 Lunar effect , 25 3 Biodiversity

fev 2018: 1 19 Digital Media Concepts , 2 8 Supernova X-rays/Quiz , 3 8 Moon/Quiz , 4 8 Subtraction practice/Answers , 5 7 Evidence based assessment/Posttraumatic stress disorder (disorder portfolio) , 6 7 Mathematical Properties/Distributive Property/Part I Pretest , 7 7 Localization , 8 7 Subtraction practice , 9 6 SCCAP/Resources for Dealing with a School Shooting , 10 5 Applied Programming/Files , 11 5 Applied Programming/Strings , 12 5 Applied Programming/Loops , 13 5 WikiJournal User Group/Ethics statement , 14 4 Helping Give Away Psychological Science/Resources/Annotated List of Where and How to Find a Therapist , 15 4 Helping Give Away Psychological Science/Outreach/1 in 5 Project , 16 4 Evidence based assessment/Bipolar disorder in adults (assessment portfolio) , 17 4 Evidence based assessment/Obsessive-compulsive disorder (assessment portfolio) , 18 4 Types of computers , 19 4 Icns141/Section 1, Term 3, 2011 , 20 4 Introduction to Computers , 21 4 Introduction to Algorithms , 22 3 WikiJournal Preprints/Rabeprazole , 23 3 SCCAP/Resources for Dealing with a School Shooting/Psychological First Aid , 24 3 WikiJournal of Science/A card game for Bell's theorem and its loopholes , 25 3 ABCT Bipolar SIG/Listserv Topics/Inter-rater reliability

mar 2018: 1 16 Localization , 2 9 Evidence based assessment/Substance use disorder (disorder portfolio) , 3 7 Evidence based assessment/Bipolar disorder in adults (assessment portfolio) , 4 6 Evidence based assessment/Templates and Instructions/Instructions For Editing Psychological Portfolios , 5 6 Evidence based assessment/Obsessive-compulsive disorder (assessment portfolio) , 6 6 Evidence based assessment/Anorexia nervosa (assessment portfolio) , 7 5 Helping Give Away Psychological Science/Evidence Based Assessment/Assessment pages on wikiveristy , 8 5 Applied Programming/Internet Data , 9 5 Applied Programming/RegEx , 10 5 Applied Programming/Dictionaries and Sets , 11 5 Applied Programming/Lists and Tuples , 12 4 WikiJournal User Group/Comparison to other journals , 13 4 WikiJournal of Science/The aims and scope of WikiJournal of Science , 14 4 Evidence based assessment/Depression in youth (assessment portfolio) , 15 4 Mandarin , 16 4 Ologies , 17 3 WikiJournal of Medicine/Citation metrics , 18 3 Evidence based assessment/Non suicidal self injury (assessment portfolio) , 19 3 Evidence based assessment/Generalized anxiety disorder (assessment portfolio) , 20 3 Formulas in predicate logic , 21 3 School , 22 2 MacLaurin series , 23 2 Ciencia Preventiva de la Salud/Abstracts and PPTs from conferences , 24 2 Ciencia Preventiva de la Salud/Editorial meetings 8 Aug 2017 to Dec 31 2018 , 25 2 Ciencia Preventiva de la Salud

abr 2018: 1 9 Basic adding practice , 2 6 WikiJournal of Science/Spaces in mathematics , 3 6 Geometry , 4 5 Evidence based assessment/Instruments/Dimensional Obsessive Compulsive Scale , 5 5 SCCAP/Resources for Dealing with a School Shooting/Psychological First Aid , 6 5 Applied Programming/Databases , 7 5 Evidence based assessment/Instruments/Child PTSD symptom scale , 8 5 Ln , 9 5 Subtraction practice/Answers , 10 5 Elementary Math Facts/Multiplication , 11 5 Subtraction practice , 12 5 Fundamental Mathematics/Arithmetic/Division , 13 5 Basic adding practice/Answers , 14 5 Elementary Math Facts/Addition , 15 5 Filmmaking Basics/Thumbnail Pop Quiz , 16 5 Fundamental Mathematics/Arithmetic , 17 4 WikiJournal of Science/The aims and scope of WikiJournal of Science , 18 4 Applied Programming/Modules and Classes , 19 4 Applied Programming/Internet Data , 20 4 Evidence based assessment/Instruments/Eating Attitudes Test , 21 4 WikiJournal of Science/Editorial board , 22 4 Project Management/Process , 23 4 Project Management/Communication , 24 4 WikiJournal of Medicine/Editorial board , 25 4 Linux

mai 2018: 1 11 Information Systems/Hardware , 2 7 WikiJournal of Science/Spaces in mathematics , 3 7 Information Systems/Peripherals , 4 6 WikiJournal of Science/Editorial board , 5 6 School , 6 5 Applied Programming/GUI , 7 5 Project Management/Organization , 8 5 Project Management/Project Charter , 9 4 WikiJournal of Science/The aims and scope of WikiJournal of Science , 10 4 WikiJournal of Science/ShK toxin: history, structure and therapeutic applications for autoimmune diseases , 11 4 WikiJournal of Science/Potential upcoming articles , 12 4 Project Management/Process , 13 4 Project Management/Communication , 14 3 WikiJournal User Group/Editorial guidelines , 15 3 WikiJournal of Science/A card game for Bell's theorem and its loopholes , 16 3 WikiJournal User Group/Peer reviewers , 17 3 OToPS , 18 3 Evidence based assessment/Bipolar disorder in youth (assessment portfolio) , 19 3 Project Management/Quality Management , 20 3 Project Management/Scope Statement , 21 3 IT Fundamentals/Hardware , 22 3 WikiJournal User Group , 23 3 Computer Support , 24 3 A-Level Mechanics - Vectors , 25 3 Featured content/5

jun 2018: 1 13 Information Systems/Operating Systems , 2 11 Information Systems/Networking , 3 10 Information Systems/Databases , 4 10 Information Systems/Internet , 5 9 Information Systems/Social Issues , 6 9 Information Systems/Systems Development , 7 9 Information Systems/Information Systems , 8 9 Information Systems/Applications , 9 8 WikiJournal of Science/Editorial board , 10 8 Information Systems/Security , 11 6 Information Systems/Programming , 12 5 JCCAP FDF/2018/Day 1 , 13 5 WikiJournal of Science/Spaces in mathematics , 14 4 Evidence based assessment/Portfolio template , 15 4 JCCAP FDF/2018/Day 2 , 16 4 WikiJournal of Science/Volume 1 Issue 1 , 17 4 WikiJournal User Group/Peer reviewers , 18 4 WikiJournal of Humanities/Editorial board , 19 4 Evidence based assessment/Bipolar disorder in youth (assessment portfolio) , 20 4 Evidence based assessment , 21 4 IC3 , 22 3 Interpolation of sparse pointwise and integral geographical Data over Time , 23 3 WikiJournal User Group/Comparison to other journals , 24 3 WikiJournal of Science/A card game for Bell's theorem and its loopholes , 25 3 WikiJournal of Science/ShK toxin: history, structure and therapeutic applications for autoimmune diseases

jul 2018: 1 7 Motivation and emotion/Book/2018 , 2 4 Theoretical Physics/Menu12 , 3 4 Theoretical Physics/Menu11 , 4 4 Theoretical Physics/Quantum Field Theory , 5 4 Theoretical Physics/Nuclear Physics , 6 4 Evidence based assessment/Bipolar disorder in youth (assessment portfolio) , 7 4 Wikipedia , 8 4 Parkinson disease (OSCE) , 9 4 How to go about implementing a problem solution as a program , 10 3 Terrorism , 11 3 Evidence based assessment/Preparation phase , 12 3 WikiJournal of Medicine/Editorial board , 13 3 Mathematics/Astronomy , 14 3 Tape purge , 15 3 Motivation and emotion/Tutorials/Personality, motivation and emotion , 16 3 List of Major Topics and Concepts in Biology , 17 3 GIMP/Review , 18 3 British Empire , 19 3 Complex Numbers , 20 2 Lightning Network , 21 2 Motivation and emotion/Book/2019/Postpartum return to work motivation , 22 2 CloudFormation , 23 2 Cloud computing/Amazon Web Services/CloudFormation , 24 2 Cloud computing/Amazon Web Services/Relational Database Service (RDS) , 25 2 Raspberry Pi/Headless Configuration

ago 2018: 1 70 Motivation and emotion/Book/2018 , 2 4 Motivation and emotion/Book/2018/Suicidality in the elderly , 3 4 Motivation and emotion/Book/2018/Evolutionary theory of emotion , 4 4 Object-Oriented Programming/Methods , 5 4 Motivation and emotion/Book/2016 , 6 4 WikiJournal of Medicine/Editorial board , 7 3 Motivation and emotion/Book/2018/Abortion and emotion , 8 3 Motivation and emotion/Book/2018/Guilt and empathy , 9 3 Motivation and emotion/Book/2019/Alcohol, dopamine, and emotion , 10 3 Motivation and emotion/Book/2018/Anger evolution , 11 3 Motivation and emotion/Book/2018/Conformity and emotion , 12 3 OHS International Networking/Participants Wikitable , 13 3 OHS International Networking/Executive Committee , 14 3 Motivation and emotion/Book/2018/Ego depletion and motivation , 15 3 Motivation and emotion/Book/2018/Confirmation bias motivation , 16 3 English-Chinese/Internet , 17 3 Motivation and emotion/Book/2018/Sexting motivation , 18 3 Motivation and emotion/Book/2018/Curiosity , 19 3 Motivation and emotion/Book/2018/Passion and motivation , 20 3 Motivation and emotion/Book/2018/Educational motivation in Indigenous Australians , 21 3 Lightning Network , 22 3 WikiJournal of Science/Peripatric speciation , 23 3 Motivation and emotion/Assessment/Topic , 24 3 WikiJournal of Science/Editorial board , 25 3 Media and corruption

set 2018: 1 28 Digital Media Concepts , 2 16 Motivation and emotion/Book/2018 , 3 5 Object-Oriented Programming/Validation , 4 5 Object-Oriented Programming/Properties , 5 4 Helping Give Away Psychological Science/Hurricane and flooding preparation and tips , 6 4 Motivation and emotion/Book/2018/Anorexia nervosa and intrinsic motivation , 7 4 Motivation and emotion/Book/2018/Guilt and empathy , 8 4 Motivation and emotion/Book/2018/Yoga and mood disorders , 9 4 Motivation and emotion/Book/2018/Veteran transition to civilian life , 10 4 Object-Oriented Programming/Inheritance , 11 4 Object-Oriented Programming/Unit Testing , 12 4 Was 9/11 an inside job? , 13 3 Digital Media Concepts/Motion Capture , 14 3 Inductor , 15 3 Grumman llv , 16 3 Motivation and emotion/Book/2018/Flourishing , 17 3 Motivation and emotion/Book/2018/Job satisfaction , 18 3 Motivation and emotion/Book/2018/Betrayal and emotion , 19 3 WikiJournal of Medicine/Intestinal epithelium , 20 3 Motivation and emotion/Book/2018/Mental illness identity motivation , 21 3 Motivation and emotion/Book/2018/Autonomic nervous system and emotion , 22 3 Motivation and emotion/Book/2018/Counterproductive work behaviour , 23 3 Motivation and emotion/Book/2018/Abortion and emotion , 24 3 Motivation and emotion/Book/2018/Gambling addiction motivation , 25 3 Motivation and emotion/Book/2018/Assisted dying motivation

out 2018: 1 9 Motivation and emotion/Book/2018/Chronic pain and maladaptive behaviour , 2 8 Motivation and emotion/Book/2018/Assisted dying motivation , 3 8 Motivation and emotion/Book/2018/Broken-heart syndrome , 4 8 Motivation and emotion/Book/2018/Loss aversion , 5 7 Motivation and emotion/Book/2018/Abortion and emotion , 6 7 Motivation and emotion/Book/2018/Compliments, emotion, and motivation , 7 7 Motivation and emotion/Book/2018/Restorative justice and emotion , 8 7 Motivation and emotion/Book/2018/Guilt and empathy , 9 7 Motivation and emotion/Book/2018/Yoga and mood disorders , 10 7 Motivation and emotion/Book/2018/Cognitive dissonance and emotion , 11 7 Motivation and emotion/Book/2018/Surfing and well-being , 12 7 Motivation and emotion/Book/2018/Emotional intelligence and leadership effectiveness , 13 6 Motivation and emotion/Book/2018/Vicarious post-traumatic growth , 14 6 Motivation and emotion/Book/2018/Goal sharing and goal pursuit , 15 6 Motivation and emotion/Book/2018/Mental illness identity motivation , 16 6 Motivation and emotion/Book/2018/Counterproductive work behaviour , 17 6 Motivation and emotion/Book/2018/Gambling addiction motivation , 18 6 Motivation and emotion/Book/2018/Childhood neglect and emotion , 19 6 Motivation and emotion/Book/2018/Social anxiety , 20 6 Motivation and emotion/Book/2018/Gym and positive emotion , 21 6 Motivation and emotion/Book/2018/Surrogate motherhood motivation , 22 5 Motivation and emotion/Book/2018/Anxiety neurobiology , 23 5 Motivation and emotion/Book/2018/Methamphetamine and emotion , 24 5 Motivation and emotion/Book/2018/Gender fluidity motivation , 25 5 Motivation and emotion/Book/2018/Mystical experiences and emotion

nov 2018: 1 7 Wikimedia Deutschland/Open Science Fellows Program/fellows , 2 6 Helping Give Away Psychological Science/Coping with shooting , 3 4 WikiJournal of Medicine/Anthracyclines , 4 4 WikiJournal User Group/Editorial guidelines/Message templates , 5 4 WikiJournal of Science/Potential upcoming articles , 6 4 WikiJournal of Medicine/Editorial board , 7 3 WikiJournal Preprints/Mount Mazama , 8 3 Sir Thomas Malory, Le Morte d'Arthur , 9 3 WikiJournal Preprints/Comparison between the Lund-Browder Chart and the BurnCase 3D® for Consistency in Estimating TBSA Burned , 10 3 WikiJournal Preprints/West African Ebola virus epidemic , 11 3 WikiJournal User Group/Code of conduct draft , 12 3 WikiJournal Preprints/Themes in Maya Angelou's autobiographies , 13 3 Motivation and emotion/Book/2018/Gambling addiction motivation , 14 3 Motivation and emotion/Book/2018/Cognitive dissonance and emotion , 15 3 WikiJournal User Group/Peer reviewers , 16 3 WikiJournal of Humanities/Potential upcoming articles , 17 3 Motivation and emotion/Book/2018/Dopamine and love , 18 3 Motivation and emotion/Book/2018/Self-focused attention and emotion , 19 3 LearnIt/Programming Languages , 20 3 Radiation astronomy/X-rays , 21 3 Computer Hardware Types , 22 3 Introduction to Italian/Lesson 2 , 23 2 Macromolecules , 24 2 Moscow State University of Food Production , 25 2 Karelian language

dez 2018: 1 4 WikiJournal of Science/Potential upcoming articles , 2 3 Convergence acceleration by the Ford-Sidi W(m) algorithm , 3 3 Biographies/Stubs/Ryszard Linkiewicz , 4 3 WikiJournal of Medicine/Volume 5 Issue 1 , 5 3 Wisdom Research , 6 3 WikiJournal of Medicine/Anthracyclines , 7 3 Types of friction , 8 3 Moving Average , 9 3 WikiJournal of Medicine/Potential upcoming articles , 10 3 Should cannabis be legal? , 11 3 DNA , 12 3 Tape purge , 13 3 Group (psychology) , 14 2 Bengali Language/Education , 15 2 Rocket , 16 2 Tupolev/Tupolev aircraft , 17 2 Ilyushin/Ilyushin aircraft , 18 2 Yakovlev/Yakovlev aircraft , 19 2 Time to extinction of civilization , 20 2 Algebra II/Quadratic Functions , 21 2 WikiJournal Preprints/Can each number be specified by a finite text? , 22 2 Types of timber , 23 2 High School Chemistry/Intra & Intermolecular Forces , 24 2 Helping Give Away Psychological Science/Coping with shooting , 25 2 High School Chemistry/Electrons and Light

Note: Before the official launch of Wikiversity as a project, in August 2006,
some course materials were already produced on Wikibooks.
Wikistats pages that show monthly trends include that early history.

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 04:54 (final run)

Dump file enwikiversity-20190101-stub-meta-history.xml.gz (edits only), size 105 Mb as gz -> 797 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-13:45 after 7 min, 24 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.