Wikiordboka-statistikk

Søyler       Zoom          
Oversyn Data for siste månader

 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  
Snitt = snitt-tal over viste månader  |  Vekst = snittvekst per månad i viste månader (formel)   
Artiklar - Database - Peikarar - Snitt pr. dag    »
Wikipedantar - Bidragsytarar Wikipedantar - Bidragsytarar Wikipedantar - Bidragsytarar Wikipedantar - Bidragsytarar
   1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74  
  alle språk russisk polsk koreansk italiensk tsjekkisk portugisisk simple english thai litauisk estisk ukrainsk kurdisk ido afrikaans usbekisk hindi myanmarsk latvisk skotsk-gælisk georgisk telugu sicilian maori kambodsjansk  frisisk
  engelsk tysk nederlandsk spansk finsk tyrkisk katalansk hebraisk bulgarsk arabisk tamil rumensk armensk dansk tagalog bretonsk esperanto serbokroatisk malayalam mongolsk galisisk latin kymrisk malayisk kirgisisk  
    fransk gresk japansk svensk kinesisk vietnamesisk ungarsk norsk indonesisk farsi serbisk gassisk baskisk kroatisk albansk islandsk cherokee aserbajdsjansk kannada provençalsk limburgisk slovakisk swahili valonsk slovensk
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017   25352    8205    2369      893    1559      440      721      344      376      194      637      430      687      378      392      252      502      128      571      138      237      250      307      126       74       95       63       91      190      139       57      214      152      126       91       91      119      633       38       88      122       92       28       40       30       29       36      150       40      109       17       51       20       68       44       95       67       11      115       57       31       94       44       71       74       61       24       26       34       13       31       38       26       41       40       27
Okt 2017251388136234988615574367153393751896354276843743882504991285671352342503041257393619118913855213152126909011862337871219227403028351484010817512066439566111155630934471736024253313303826413926
Sep 2017249788079233887815524337103373731896314276823743832454981275651352332483021237393619118913755213150124909011859837861219226403028341484010717512064439566111155630934471736024253313303826413925
Aug 2017248368030232787115444327083353731896284236793743812404961255621352312483001227292619018913655212149122909011858537851219124393028341464010617512064439565111155630934371736024253313303826413925
Jul 2017246177959230686815344297053333701896254196793713762364941245581332312473001227090619018813455211149120909011853637851218924392928331454010417512064419565111155630934371736023243313303826413925
Vekst1%1%1%1% 1%1%1% 1% 1%  1%2% 1%1%1%1% 1%1%1%1%1%  1%1% 1%1%   4%1%1% 1%4%1%1%1%2%1% 1%   2%2% 1%   1% 1%   1%2%1% 1%   1%2%
 Javascript not available or not active. Charts can not be shown. 
 
Artiklar - Database - Peikarar - Snitt pr. dag   «    »
Wikipedantar - Nye wikipedantar Wikipedantar - Nye wikipedantar Wikipedantar - Nye wikipedantar Wikipedantar - Nye wikipedantar
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017      214       69       20         7         2         4         6         5         1         5         2         3         3         4         4         2         3                   4         3         3                   3         1         1         2         2                   1         1         2         1                             1         1         1       10         1         1         1                   1                             1         1         2                   1                                       2         1                   1                             1         1         1                             1         1                   1         1                   1                                       1         1
Okt 20171605711853522 4 2 55112 1222     1  22   25 1  1   1  1   2                     1
Sep 2017142491178122  343 25223 2 2111 1 1 112   13 1 121   2 1      1     1             
Aug 201721971213103323 34 3542142 1  22  12 1 2   49   2  1 11 2    2           11        
Jul 201715356125736 2144115 11212 431  12  111   122         1  1 1    3         1       
Snitt178601566342213322432131212111  11 111   2211 11   11 1   11   1                 
 Javascript not available or not active. Charts can not be shown. 
 
Artiklar - Database - Peikarar - Snitt pr. dag   «    »
Wikipedantar - Aktive wikipedantar Wikipedantar - Aktive wikipedantar Wikipedantar - Aktive wikipedantar Wikipedantar - Aktive wikipedantar
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017                464      139       59       47       22       44       23       15       12       23       24       16       14       20       25       13         4       15         9         2         4       11         8         7         3         6         3         4         2         6         6         2         2         2         1       13       86         3         7         6         1         4                             2         3         4         1         7                   1         1         2         3                   3                   1         4         2         3                             2         6         2         1         1                   3         2         1         2         1         2
Okt 2017 43213951521746211782424151419281161754513943131246561 14121152131  4417 2 3 21 13 2 1151   221  1
Sep 2017 4171405159104415178192814121526971246312571343634272 1168 34211  13 6 1 12 2 13111 231   2411  
Aug 2017 444125455610411316921256141828941773395531246461421121012633 21 231611 1311 13131 1721  141   
Jul 2017 429122465812441417923228111922551164414561 33535252 9533461    32351  2 12 321112141 1 14111 
Snitt 4371335054144417169222512131826951464412662233445252 1286254221  3316 1 2212 131211151   2311 1
Vekst 2%3%7%-5%  14%-3% 1%3% 8%3%4%  14%                  28%                                      
 Javascript not available or not active. Charts can not be shown. 
 
Artiklar - Database - Peikarar - Snitt pr. dag   «    »
Wikipedantar - Særs aktive wikipedantar Wikipedantar - Særs aktive wikipedantar Wikipedantar - Særs aktive wikipedantar Wikipedantar - Særs aktive wikipedantar
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017                109       41       16       19         4       15         6         5         4         3         9         3         4         3         6         3                   6         2                             2         1         3                   3                                       2         1                             1                   3       33                   2                             3                                       2                             2                                       1         1                                                 1                   1                             1         1                                                           2                                       1
Okt 2017 1053816224148633645375162 1232 1   31    837 21 3   1  1 2 1     1 1  12     2   1
Sep 2017 963914173146524826343 7211433 11  3  21 76 21 1   1  1   1     2 1  11     2    
Aug 2017 1153914182144546733443 63  422   2131111 829 21     11111  1 11 11    11     2    
Jul 2017 1213214184153636733243 62  223   113 111 49 22     1 12   2 11 22 1  11     3 11 
Snitt 1093815193145534734353 62  323 1 1 31 11 623 21 1   1  1   1    11 1  11     2    
Vekst -2%7%4%3%                                                                       
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Database - Peikarar - Snitt pr. dag   «    »
Artiklar - Offisielt artikkeltal Artiklar - Offisielt artikkeltal Artiklar - Offisielt artikkeltal Artiklar - Offisielt artikkeltal
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017 28,5 M   5,4 M   3,2 M   869 K   656 K   458 K   600 K   635 K   191 K   396 K   852 K   611 K   429 K   349 K   1,2 M    96 K   331 K   233 K   238 K   290 K   355 K    25 K    19 K   142 K   152 K    20 K   129 K   616 K    66 K   111 K   126 K   356 K   213 K    37 K   145 K   4,0 M   609 K   233 K    54 K   277 K    38 K    33 K    18 K    23 K    40 K   131 K    38 K    22 K   195 K    97 K   195 K   123 K   915 K    55 K    11 K   130 K   265 K   1,5 K    44 K    39 K   8,1 K    50 K   115 K   108 K    20 K    23 K    19 K    24 K    14 K      915   3,5 K    23 K    38 K    54 K   7,9 K    13 K
Okt 201728,4 M5,4 M3,2 M865 K650 K458 K595 K630 K188 K396 K852 K609 K428 K347 K1,2 M95 K330 K233 K237 K282 K345 K25 K19 K142 K143 K20 K129 K616 K66 K111 K125 K356 K213 K37 K145 K4,0 M601 K229 K54 K276 K38 K33 K17 K23 K40 K131 K37 K22 K195 K97 K195 K123 K915 K54 K11 K130 K265 K1,5 K44 K38 K8,1 K50 K115 K108 K20 K22 K19 K24 K14 K9113,5 K23 K37 K53 K7,9 K13 K
Sep 201728,3 M5,4 M3,2 M862 K642 K457 K591 K627 K185 K395 K851 K604 K428 K346 K1,2 M94 K329 K233 K236 K275 K342 K25 K19 K142 K142 K20 K128 K616 K66 K111 K125 K356 K213 K37 K145 K4,0 M599 K221 K54 K275 K38 K33 K16 K23 K39 K131 K37 K22 K195 K97 K195 K123 K915 K54 K11 K130 K265 K1,5 K44 K38 K8,1 K50 K115 K108 K20 K21 K19 K24 K14 K9113,5 K23 K37 K53 K7,9 K13 K
Aug 201728,2 M5,3 M3,2 M858 K638 K457 K588 K622 K182 K395 K851 K597 K427 K344 K1,2 M93 K329 K232 K235 K272 K341 K25 K19 K142 K141 K20 K128 K616 K66 K111 K124 K356 K213 K37 K144 K4,0 M591 K219 K54 K274 K38 K33 K16 K23 K39 K131 K37 K22 K195 K97 K195 K123 K915 K53 K11 K130 K265 K1,5 K44 K36 K8,1 K50 K115 K108 K19 K20 K19 K24 K14 K8783,5 K23 K37 K52 K7,9 K13 K
Jul 201728,1 M5,3 M3,2 M851 K634 K457 K585 K620 K179 K395 K850 K591 K426 K343 K1,2 M92 K328 K232 K234 K271 K341 K25 K19 K141 K140 K20 K128 K616 K66 K111 K123 K356 K213 K36 K144 K4,0 M521 K212 K54 K273 K38 K33 K16 K23 K39 K130 K37 K22 K195 K96 K195 K123 K915 K53 K11 K130 K265 K1,5 K44 K35 K8,1 K50 K115 K108 K19 K20 K19 K24 K14 K8783,5 K23 K37 K52 K7,9 K13 K
Vekst 1%  1% 1%1%2%  1%   1%   2%1%   2%           4%2%    3%          1%1%    3%    2%3%   1% 1% 1%  
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Database - Peikarar - Snitt pr. dag   «    »
Artiklar - Nye artiklar pr. dag Artiklar - Nye artiklar pr. dag Artiklar - Nye artiklar pr. dag Artiklar - Nye artiklar pr. dag
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017    3985      933      386      131      210       14      162      141       84       13       11       74       19       66         4       22       28         1       30      257      308         1         3         6      302                 20         1         1         1       14         2                             2       60      279      141         3       28         1                 27                                       6                             4                                     17       14                                               26         1         1                           14       34                                                           3         1       40                   1
Okt 201731087963029522919124125122141015327316253342721411824425111111141 225454258 331 26   5  4 1 12    120 10  1036     314  
Sep 20173265828475122160121111591029232552949730232321003313427 3422221 145726265 332 22  11 2   21     57 4  1615   114 3  
Aug 2017504510631972121229826987620180142823519132379 26401 22627112163522502241312    21  7   26 56  27 13 910 2   617  
Jul 2017350613353072581371611910085335206131341819 31789 3320  218161134111491091171236     1 147   29 411  20131 265     7124  
Snitt378499233216417114119118969201742037526242301379413582 72141913015515951621302 11   3 35   21323  30 41 1520     5116  
Vekst8%-7%23%-11%14% 11%22%2%  -16%19%66% 13%12%  62%    288%     4%    10%560%70% 7%             -8%     27%                
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Database - Peikarar - Snitt pr. dag   «    »
Artiklar - Redigeringar pr. artikkel Artiklar - Redigeringar pr. artikkel Artiklar - Redigeringar pr. artikkel Artiklar - Redigeringar pr. artikkel
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017      6,3      8,1      7,2      9,9      8,5      8,4      9,2      5,3      4,8      8,5      5,2      4,7      6,9      8,7      4,1      8,3      7,2      8,3      8,4      3,8      5,9    14,8      9,2      7,1      5,8         8      6,5      2,5      8,4      6,5      8,1      4,5      2,1      5,4      5,9      5,6      4,7      5,1      6,7      9,1      6,3      6,1      7,7      5,7      3,1      4,1      5,7      9,5      1,8      4,5         4      6,2      1,6      5,6      6,4         4      2,3      8,5      5,3      6,5      8,2    11,2      4,9      8,7      7,6      4,4         7      5,9      8,4      6,5    12,6      7,1      2,2      2,7    15,8      8,7
Okt 20176,38,17,29,98,68,49,25,34,88,45,24,76,98,74,18,36,78,38,43,9614,89,17,16,186,52,58,46,58,24,52,15,45,95,74,75,16,79,16,36,17,35,73,14,15,69,51,84,546,21,65,76,642,38,55,36,68,211,14,98,77,74,675,98,46,512,67,12,22,715,88,7
Sep 20176,38,17,29,98,68,49,35,44,98,35,24,76,98,84,18,46,48,38,43,9614,89,17,16,186,52,58,46,58,24,52,15,45,95,74,65,36,79,16,36,17,45,73,14,15,59,51,84,5461,65,76,642,38,55,36,78,211,24,98,77,94,875,98,46,512,67,12,22,715,88,5
Aug 20176,38,17,29,78,78,49,35,44,98,35,24,76,98,84,18,46,48,38,446,114,89,17,16,186,52,58,46,58,24,52,15,45,95,745,16,79,16,36,17,45,73,14,15,59,51,84,5461,65,76,642,38,55,36,98,211,24,98,784,875,98,46,712,77,12,22,715,98,5
Jul 20176,38,17,29,38,78,49,35,358,35,24,76,98,84,18,56,28,38,446,114,89,17,16,186,52,58,46,58,24,52,15,45,95,73,95,26,79,26,36,17,45,73,14,15,59,51,84,5461,65,86,642,38,55,378,211,24,98,78,14,975,98,46,712,77,12,22,715,98,5
Vekst   2%-1%   -1%1%     -1%4%  -1%-1%   -1%           5%     1%   1%    1% -1%-1%    -2%    -2%-3%   -1%     1%
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Database - Peikarar - Snitt pr. dag   «    »
Artiklar - Byte pr. artikkel Artiklar - Byte pr. artikkel Artiklar - Byte pr. artikkel Artiklar - Byte pr. artikkel
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
Vekst                                                                            
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Peikarar - Snitt pr. dag   «    »
Database - Redigeringar pr. månad Database - Redigeringar pr. månad Database - Redigeringar pr. månad Database - Redigeringar pr. månad
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017   680 K   223 K    39 K    25 K    20 K   3,6 K    17 K    18 K   4,6 K    27 K   1,8 K   8,7 K   5,2 K   6,0 K   2,1 K   3,7 K   171 K      232   5,4 K    13 K    11 K      200   1,0 K      713    12 K      101   1,9 K       76      108      148      898      450       66       71      125   2,8 K    13 K   9,1 K      137   3,2 K      178       64    13 K       25       94       37   4,7 K       92       30      507         5       22       20   1,3 K      540       26       52                 41   1,4 K       31   2,1 K         4         8      488   1,3 K       24       21       15         4       40      709       29   1,3 K       14      331
Okt 2017724 K297 K37 K19 K20 K3,1 K17 K14 K5,8 K38 K2,0 K11 K6,1 K4,0 K1,8 K2,5 K106 K2914,9 K11 K8,4 K2631,1 K1,5 K2,4 K1411,3 K941011061,0 K25792194863,2 K49 K12 K293,6 K267124,1 K1471172,3 K5022349320 K10799113724 541,1 K41,8 K273451,4 K3353 1894842137233,0 K
Sep 20171,2 M205 K161 K203 K16 K2,7 K13 K13 K4,4 K2,9 K3,2 K19 K6,6 K6,6 K2,6 K2,7 K22 K3145,1 K4,6 K2,6 K2731,4 K1,3 K2,6 K712721861371911,8 K157523972192,6 K430 K47 K93,7 K320391351246072331011828521781,3 K741069 492,7 K3095717673660524 968471,2 K181168 
Aug 20171,2 M200 K60 K399 K18 K2,0 K8,7 K33 K4,1 K2,3 K3,0 K33 K4,2 K4,0 K1,7 K2,8 K44 K2224,6 K2,5 K57112585176811 K19184863743423,2 K2741,6 K1442901,8 K293 K10 K313,7 K280776411769198148378701108921,8 K10025424112701,6 K201078816323456358215 381,9 K59209 1
Jul 2017821 K176 K31 K386 K68 K2,7 K11 K18 K4,5 K1,9 K3,5 K12 K4,7 K9,2 K3,1 K1,8 K5,2 K1494,8 K5,2 K65010397262914 K5566962225901,3 K1778,5 K1894602,2 K8,5 K4,5 K842,4 K7503232513414444112727698512101,9 K12159478 1,7 K1,4 K3019945501,0 K23778281361,9 K497431451
Snitt919 K220 K65 K208 K28 K2,8 K13 K19 K4,7 K14 K2,7 K17 K5,3 K6,0 K2,3 K2,7 K69 K2415,0 K7,3 K4,6 K1921,1 K9798,4 K1127191071892771,7 K2622,1 K1992372,5 K158 K17 K583,3 K360453,4 K4575291,6 K101238509254,0 K101,4 K14598174 4201,6 K231,0 K311857879625231414361,3 K4049138676
Vekst 9%46%-27%-15%10%15%17%2%306%-14%17%6%4%-3%24%290%16%3%49%148%28%6%14%69%65%168%9%-3%-23%12%38%-32%9%-20%8%816%96% 11%-25%113% 63%53% 245%8%-21%2%   -4%1341% -18% -45%11% 210%  11%63%    22%-21%14%177%  
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Peikarar - Snitt pr. dag   «    »
Database - Databasestorleik Database - Databasestorleik Database - Databasestorleik Database - Databasestorleik
K=Kb, M=Mb Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
Vekst                                                                            
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Peikarar - Snitt pr. dag   «    »
Database - Ord Database - Ord Database - Ord Database - Ord
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
Vekst                                                                            
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Database - Snitt pr. dag   «    »
Peikarar - Kryssreferansar internt i nynorsk-wikipediaen Peikarar - Kryssreferansar internt i nynorsk-wikipediaen Peikarar - Kryssreferansar internt i nynorsk-wikipediaen Peikarar - Kryssreferansar internt i nynorsk-wikipediaen
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
Vekst                                                                            
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Database - Snitt pr. dag   «    »
Peikarar - Kryssreferansar til andre språk Peikarar - Kryssreferansar til andre språk Peikarar - Kryssreferansar til andre språk Peikarar - Kryssreferansar til andre språk
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
Vekst                                                                            
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Database - Snitt pr. dag   «    »
Peikarar - Bilete Peikarar - Bilete Peikarar - Bilete Peikarar - Bilete
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
Vekst                                                                            
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Database - Snitt pr. dag   «    »
Peikarar - Peikarar til verdsveven Peikarar - Peikarar til verdsveven Peikarar - Peikarar til verdsveven Peikarar - Peikarar til verdsveven
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
Vekst                                                                            
 Javascript not available or not active. Charts can not be shown. 
 
Wikipedantar - Artiklar - Database - Snitt pr. dag   «
Peikarar - Omdirigeringar Peikarar - Omdirigeringar Peikarar - Omdirigeringar Peikarar - Omdirigeringar
 Σenfrrudeelplnljakoessvitfizhcstrviptcahusimplehenothbgidltarfaettasrukromgkuhyeuiodahraftlsquzbrishieochrmyshazlvmlkngdmnockagllitelaskscncyswmimswakmkyslfy
 Nov 2017   483 K    25 K    23 K   118 K      961   8,0 K   3,0 K       44   4,7 K   1,3 K      836   4,8 K      269    10 K   7,8 K      116   2,5 K   2,3 K      408      174   2,8 K      254   3,4 K      317   2,1 K    31 K    49 K    14 K   2,5 K    29 K   9,1 K   1,0 K   2,4 K   2,0 K   4,7 K    15 K   1,8 K      714      280    13 K   1,8 K      225       65       74      384    19 K   1,2 K       46      763      406       59       80      309      129      260      357      312         8      147      179       49   1,2 K       18   6,8 K   3,3 K         1   3,1 K       70      114       20      207    16 K      195       36   6,2 K      177
Okt 2017482 K25 K23 K118 K9618,0 K3,0 K414,7 K1,3 K8364,7 K26410 K7,8 K1162,5 K2,3 K4061742,6 K2533,4 K3172,0 K31 K49 K14 K2,5 K29 K9,1 K9982,4 K2,0 K4,7 K15 K1,8 K64828013 K1,8 K225587438419 K1,2 K4676240558803091292593573128147179491,2 K186,8 K3,3 K13,1 K701142020716 K195366,2 K176
Sep 2017481 K25 K23 K118 K9528,0 K3,0 K414,6 K1,3 K8364,7 K26310 K7,8 K1142,5 K2,3 K4011742,4 K2533,4 K3172,0 K31 K48 K14 K2,5 K29 K9,1 K9982,4 K2,0 K4,7 K15 K1,7 K56428013 K1,8 K225497438419 K1,2 K4676140558783091292593573128147176491,2 K186,8 K3,3 K13,1 K701142020716 K195366,2 K176
Aug 2017480 K24 K23 K118 K9458,0 K3,0 K404,6 K1,3 K8354,7 K25110 K7,8 K1142,5 K2,3 K3971742,3 K2533,4 K3171,9 K31 K48 K14 K2,5 K29 K9,1 K9972,4 K1,9 K4,7 K14 K1,6 K54228013 K1,8 K225487438419 K1,2 K4676140458783091292573573108147175471,2 K186,8 K3,3 K13,1 K701142020716 K195366,2 K176
Jul 2017479 K24 K23 K118 K9438,0 K2,9 K394,6 K1,2 K8354,7 K24410 K7,8 K1142,5 K2,3 K3911732,3 K2533,4 K3171,9 K31 K48 K14 K2,5 K29 K9,1 K9962,3 K1,9 K4,7 K14 K1,6 K40028013 K1,8 K225487238419 K1,2 K4649040358783091292503573108147168471,2 K186,8 K3,3 K13,1 K701142020716 K194366,2 K176
Vekst 1%    1%3%1%  1%2%     1% 5%   2%           3%16%    8%1%    14%  1%  1%    2%1%               
 Javascript not available or not active. Charts can not be shown. 

Snitt = snitt-tal over viste månader = (31 x verdi[Jul] + 31 x verdi[Aug] + 30 x verdi[Sep] + 31 x verdi[Okt] + 30 x verdi[Nov]) / 123

Vekst = snittvekst per månad i viste månader = 100 * (31 x (verdi[Aug] - verdi[Jul]) / verdi[Jul] + 30 x ...etc) / 153  (Wikiordbøker med mindre enn 10 er uteletne)


Generert den onsdag 13. desember 2017 16:31 frå SQL-dump frå torsdag 30. november 2017

Author:Erik Zachte (Webside)
Mail:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.