Estatísticas da Wikcionário azeri

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wiktionary azeri

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: maio 2018
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mai 20180%   0%   +567%      +1%
abr 20180%   0%   -78%      +1%
mar 20180%   0%   +9%      0%
fev 2018+3%   0%   +810%      0%
jan 20180%   0%   -90%      +1%
dez 20170%   +1%   -33%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mai 201870 2156 k25,6 1,2 k      118
abr 201870 2156 k35,6 178      117
mar 201870 2256 k75,6 804      116
fev 20187022256 k75,6 737      116
jan 201868 1 55 k15,6 81      116
dez 201768 1155 k125,6 840      115
nov 20176822155 k175,6 1,2 k      115
out 20176623154 k125,7 799      115
set 201764 1154 k215,7 1,3 k      115
ago 201764 1153 k265,7 1,8 k      115
jul 20176412253 k295,8 1,9 k      115
jun 20176314152 k215,9 1,6 k      115
mai 20176224151 k215,9 1,6 k      115
abr 20176022150 k155,9 45 k      115
mar 20175812150 k215,1 4,6 k      115
fev 201757 2149 k235,1 6,9 k      115
jan 20175712149 k155 3,9 k      115
dez 201656 3 48 k 5 1,1 k      115
nov 201656   48 k 4,9 873      115
out 201656 2 48 k 4,9 1,6 k      115
set 201656 2 48 k14,9 2,0 k      115
ago 20165615248 k174,8 18 k      115
jul 201655 2148 k274,5 4,4 k      114
jun 20165515147 k254,5 3,0 k      114
mai 201654 2246 k144,5 4,0 k      114
abr 20165416346 k294,5 3,8 k      112
mar 20165325245 k254,5 3,6 k      106
fev 201651 6144 k294,5 1,9 k      97
jan 201651 4443 k364,5 3,8 k      97
dez 201551 8342 k304,6 11 k      96
nov 20155113241 k404,4 6,2 k      95
out 201550 2240 k354,4 6,1 k      94
set 20155015139 k304,3 7,0 k      92
ago 20154924238 k284,2 5,2 k      92
jul 201547 4137 k314,2 6,9 k      92
jun 20154713236 k264,1 7,5 k      90
mai 20154613135 k294 4,6 k      89
abr 201545 2234 k394 5,4 k      89
mar 20154512233 k4246203,6 k36 Mb3,2 M9,3 k322 k9,3 k53089
fev 201544 3132 k3546192,5 k35 Mb3,1 M9,3 k317 k9,0 k52987
jan 201544 3131 k244,16212,2 k34 Mb3,1 M9,3 k313 k9,0 k52987
dez 201444 2130 k294,16282,2 k34 Mb3,1 M9,3 k304 k8,9 k52987
nov 201444 1129 k434,16312,5 k34 Mb3,1 M9,3 k300 k8,9 k52986
out 20144414128 k364,26304,0 k33 Mb3,1 M9,3 k300 k8,9 k52985
set 201443 2127 k424,36545,5 k33 Mb3,0 M9,3 k285 k8,9 k52982
ago 20144313126 k354,37024,4 k32 Mb3,0 M9,3 k253 k8,9 k52981
jul 201442 3225 k384,37463,4 k31 Mb3,0 M9,3 k219 k8,9 k52980
jun 201442 4223 k464,37644,7 k31 Mb2,9 M9,2 k208 k8,7 k53079
mai 201442 4222 k584,47317,0 k29 Mb2,8 M8,6 k205 k8,0 k51775
abr 201442 2220 k534,47084,5 k27 Mb2,6 M7,5 k198 k7,1 k50966
mar 201442 3219 k454,66762,7 k24 Mb2,2 M6,8 k196 k5,7 k50763
fev 20144215217 k464,86782,8 k23 Mb2,2 M6,8 k194 k5,6 k50762
jan 201441 4216 k4956764,2 k22 Mb2,1 M6,7 k191 k5,4 k50761
dez 20134112214 k385,26904,3 k20 Mb1,9 M6,4 k176 k4,8 k50460
nov 20134023213 k445,47363,4 k19 Mb1,8 M6,2 k148 k4,3 k50060
out 20133814212 k535,77565,0 k18 Mb1,7 M6,1 k133 k4,1 k47956
set 20133724310 k576,17814,7 k16 Mb1,6 M5,9 k121 k3,7 k45554
ago 2013352428,5 k416,87513,2 k13 Mb1,3 M5,8 k116 k2,8 k11752
jul 201333 327,3 k257,57762,8 k12 Mb1,2 M5,8 k105 k2,7 k3550
jun 20133323 6,5 k1882135312 Mb1,1 M5,8 k96 k2,6 k347
mai 20133112 6,4 k 882471512 Mb1,1 M5,8 k96 k2,6 k347
abr 20133011 6,4 k 7,982431912 Mb1,1 M5,8 k95 k2,6 k347
mar 201329 5 6,4 k27,882447512 Mb1,1 M5,8 k95 k2,6 k347
fev 20132912 6,4 k 7,882747111 Mb1,1 M5,6 k94 k2,6 k346
jan 201328 2 6,4 k 7,882778211 Mb1,1 M5,6 k94 k2,6 k346
dez 201228 2 6,4 k 7,682899311 Mb1,1 M5,6 k93 k2,6 k346
nov 20122812 6,4 k 7,582852711 Mb1,1 M5,6 k91 k2,6 k346
out 201227   6,3 k 7,482782211 Mb1,1 M5,6 k91 k2,6 k345
set 201227 3 6,3 k 7,382772511 Mb1,1 M5,6 k90 k2,6 k345
ago 201227 216,3 k17,28281,2 k11 Mb1,1 M5,6 k89 k2,6 k345
jul 201227 416,3 k5783090611 Mb1,1 M5,6 k87 k2,6 k345
jun 20122713 6,2 k17,184956011 Mb1,1 M5,6 k82 k2,6 k343
mai 20122614 6,1 k 785076311 Mb1,1 M5,6 k81 k2,6 k343
abr 201225 2 6,1 k 6,984960811 Mb1,1 M5,6 k80 k2,6 k343
mar 201225 1 6,1 k 6,884959711 Mb1,1 M5,5 k79 k2,6 k343
fev 201225 216,1 k66,78501,5 k11 Mb1,1 M5,5 k79 k2,6 k343
jan 201225 745,9 k96,78192,0 k10 Mb1,0 M5,5 k75 k2,4 k343
dez 2011251315,6 k56,67912,6 k9,8 Mb953 k5,4 k72 k2,3 k342
nov 201124 415,5 k26,47822,6 k9,3 Mb920 k5,2 k68 k2,3 k342
out 201124 2 5,4 k 67812,7 k9,2 Mb907 k5,2 k67 k2,3 k342
set 201124 3 5,4 k15,57893769,1 Mb898 k5,2 k60 k2,3 k342
ago 20112411 5,4 k 5,47923579,1 Mb896 k5,2 k59 k2,2 k341
jul 201123 3 5,4 k15,47932819,0 Mb895 k5,2 k58 k2,2 k341
jun 201123 2 5,3 k 5,37958449,0 Mb888 k5,1 k58 k2,2 k341
mai 20112313 5,3 k 5,27985998,9 Mb886 k5,1 k54 k2,2 k341
abr 201122 915,3 k85,18041,6 k8,9 Mb884 k5,1 k50 k2,2 k341
mar 201122 535,1 k1357872,0 k8,2 Mb807 k4,9 k47 k2,1 k340
fev 2011221534,7 k235,17452,3 k6,9 Mb661 k4,3 k41 k1,7 k340
jan 201121 424,0 k195,36651,5 k5,5 Mb517 k2,9 k39 k961539
dez 2010211623,5 k185,77032,0 k5,1 Mb483 k2,6 k36 k754739
nov 2010201532,9 k196,17191,9 k4,3 Mb410 k1,8 k30 k502735
out 2010191532,3 k96,87251,4 k3,5 Mb342 k1,5 k26 k349735
set 201018 222,1 k46,97106763,0 Mb280 k1,3 k22 k208734
ago 2010181531,9 k476711,1 k2,6 Mb235 k1,2 k22 k208734
jul 2010172311,8 k 6,95923811,8 Mb163 k1,1 k21 k208733
jun 201015 211,8 k 6,85882551,8 Mb161 k1,1 k21 k209733
mai 201015 111,8 k 6,65893291,8 Mb160 k1,1 k20 k209733
abr 201015 111,8 k 6,55863481,8 Mb159 k1,1 k20 k209733
mar 2010151211,8 k 6,35842531,8 Mb159 k1,1 k20 k209733
fev 201014 111,8 k 6,15811921,7 Mb158 k1,1 k19 k209233
jan 201014 211,8 k 65811791,7 Mb158 k1,1 k19 k209233
dez 2009141111,8 k 5,95802331,7 Mb158 k1,1 k19 k210233
nov 200913 111,8 k 5,85802491,7 Mb158 k1,1 k19 k210233
out 200913 211,8 k 5,75812451,7 Mb158 k1,1 k19 k210233
set 2009132211,8 k 5,65793691,7 Mb157 k1,1 k18 k210233
ago 200911 111,8 k 5,45813611,7 Mb156 k1,0 k18 k210233
jul 200911 111,8 k 5,25812781,7 Mb156 k1,0 k17 k210233
jun 200911 111,8 k 55811901,7 Mb156 k1,0 k17 k210231
mai 200911 111,8 k 4,95792841,7 Mb155 k1,0 k17 k210231
abr 200911 111,8 k 4,85793931,7 Mb155 k1,0 k17 k211231
mar 200911 111,8 k 4,55806521,7 Mb155 k1,0 k16 k211231
fev 2009111211,8 k 4,25891,1 k1,7 Mb160 k1,0 k16 k211231
jan 200910 211,8 k33,66114011,6 Mb166 k1,0 k12 k212231
dez 200810 111,7 k43,65958071,5 Mb153 k96811 k225231
nov 2008101211,5 k53,35346001,3 Mb129 k8069,0 k279226
out 20089 111,4 k123,24108261014 kb94 k6997,6 k269126
set 20089 111,0 k123,6363743670 kb62 k5126,1 k126125
ago 20089   683 4,338280492 kb44 k4145,6 k109 20
jul 20089   680 4,2383117488 kb44 k4145,4 k109 20
jun 2008911 678 4,138285484 kb44 k4045,3 k109 19
mai 20088   670 4385126479 kb44 k3955,1 k108 19
abr 20088   669 3,838653475 kb44 k3954,8 k108 19
mar 20088   668 3,738665467 kb44 k3954,4 k108 19
fev 20088   668 3,638697464 kb44 k3954,2 k108 19
jan 2008811 668 3,5386100451 kb44 k3953,3 k108 19
dez 2007711 667 3,338653438 kb44 k3952,3 k108 19
nov 20076 1 66713,338579435 kb44 k3952,1 k110 19
out 2007612162353,4399403406 kb40 k3932,0 k110 17
set 20075 1148293,5364839283 kb28 k3161,1 k79 5
ago 20075 1121633,924855787 kb7,7 k33448030 4
jul 2007511 111 2,62394141 kb3,4 k1343261  
jun 20074   103 2,4236238 kb3,1 k982901  
mai 20074   103 2,4236538 kb3,1 k982891  
abr 2007422 10212,42355238 kb3,1 k982861  
mar 20072   64 32301423 kb1,9 k162801  
fev 20072 1 62 2,82232422 kb1,9 k62761  
jan 2007211 5822,62249921 kb1,7 k62532  
dez 20061   11 4,833965,5 kb33461281  
nov 20061   10 4,731935,2 kb30661281  
out 20061   10 4,431825,2 kb30561281  
set 20061 1 10 4,231365,2 kb29961281  
ago 20061   7 5,1365 4,6 kb26461281  
jul 20061   7 5,136514,6 kb26461281  
jun 20061   6 5,8406164,5 kb25061281  
mai 20061   2 9,51474 5,9 kb357 127 29 
abr 20061   2 9,5147415,9 kb357 127 29 
mar 20061   1 181442 4,0 kb228 127 29 
fev 20061   1 18144234,0 kb228 127 29 
jan 20061   1 15143294,0 kb227 127 29 
dez 20051   1 632751,7 kb41 127   
nov 20051   1 1  14       
out 20051   1 1  14       
set 20051   1 1  14       
ago 20051   1 1  14       
jul 20051   1 1  14       
jun 20051   1 1  14       
mai 20051   1 1  14       
abr 20051   1 1  14       
mar 20051   1 1  14       
fev 20051   1 1  14       
jan 20051   1 1  14       
dez 200411  1 1 114       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201846 4434503674 47      147
jan 201846 60 505276 57      147
out 201747193735492872 36      147
jul 201747304628501769 24      147
abr 201748194533502566 20      147
jan 201749315136512580 35      147
out 201648 42 49 80 56      147
jul 201648 4637492383 36      147
abr 201648242421492080 30      147
jan 201650 3715481982 26      147
out 201550 4728472082 29      147
jul 201550 3234471882 38      147
abr 201550 5431491684 32      147
jan 20155037423651247894238319147734147
out 20144827293750177483036308845734147
jul 20145034382752216972937308851733147
abr 20145031442661176872340319151734147
jan 20145042332663126172542349250734147
out 20135026332569134572143369155734147
jul 20135039422674202473552449157883147
abr 201351256351776519569544592618113147
jan 201352455254766723364524392618111147
out 201252368249736424360504189628109147
jul 201250523738714227359494087608111147
abr 201252395052716629366494086617111147
jan 2012513524197034323415343836110110147
out 2011514255496868374465345816112108147
jul 2011524445496758454645243806211109147
abr 2011533320356634473484841806210106147
jan 2011533537276922426435751846418102147
out 201058283332753531748615592682997147
jul 2010601951598067261074706498703793147
abr 2010644879557858281072676296673694147
jan 20106533575074613110726660946335105147
out 20096341625273563110696560936333104147
jul 2009664081527359379676355946232104147
abr 2009645282536953399616354886127104147
jan 2009646152326941499506153876428105147
out 20086536573473255415336959936923110146
jul 200865327346795975757278711017234121146
abr 200865427949786471717776701017033116146
jan 20086337575174596868727265967229115146
out 20077130463672356464527260927126116146
jul 20077535574494596464771029510310087112145
abr 2007822145479155616185101921019881111145
jan 20071083158469443555574101941149465103145
out 20061194067431095250501111131151119764100145
jul 2006118416938110534646116114114108915599145
abr 200611439553511349424285105103115815540145
jan 2006974861341054137377510098103744541137
out 200588   99    121     121
jul 200582   94    116     116
abr 200576   86    103     103
jan 200567   72    90     90
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  5  10  1  3  5  10  25  100  250  1000  5  10  100  1000 
mai 201853222111             522211      
abr 2018522111        1      3           
mar 20186222222       1      3221        
fev 20187322221       2221   163211       
jan 201871111        1      1           
dez 20174111111       1      11          
nov 201784222111             42      11  
out 20173333111       1      21          
set 201781111111      1      31          
ago 201781111111             3       11  
jul 201772222211             3       2221
jun 201794433111 11   2      7332        
mai 201795442111 11          42      21  
abr 20176322111  333111      411     22  
mar 201742221111 4432        3       21  
fev 201773222111 4431        72221   22  
jan 20177422211  4431        31111   22  
dez 20169531    332  1      221     21  
nov 20165      442         1       322 
out 201652211   4431 221    533211  22  
set 201653211   4421 322    822221  33  
ago 201696543211 3321154221  10433311 221 
jul 201682221111 3331        21      221 
jun 201666542111 222  1      62      221 
mai 20168322222  3322 2      4111    11  
abr 201696653311 2221 2111   75421   111 
mar 2016106553211 2221 411    833321  22  
fev 2016127642111 11   1      84432   11  
jan 201684444431 222  421    44432   221 
abr 2018522111        1      3           
jan 201871111        1      1           
out 20173333111       1      21          
jul 201772222211             3       2221
abr 20176322111  333111      411     22  
jan 20177422211  4431        31111   22  
out 201652211   4431 221    533211  22  
jul 201682221111 3331        21      221 
abr 201696653311 2221 2111   75421   111 
jan 201684444431 222  421    44432   221 
out 2015103222222 3331 2      96321   321 
jul 201565411111 3331 1      422211  222 
abr 201583222221 4432 2    2263221   321 
jan 201586322111 442  41     93211   221 
out 201484431111 1111        411     2   
jul 201474322221 222         311111  111 
abr 201484222222 221  311    13311111 111 
jan 201484444221 443  42     125322   22  
out 201364443222 222  3      9431111 1   
jul 20136333222  221  111    911111  21  
abr 201331111   541         3       221 
jan 201352211   761  21     211     21  
out 201291     332  31     631     22  
jul 2012764311   542  7222   154311   22  
abr 20128421    653  22     311     22  
jan 201212875441  761  6431   954211  32  
out 201152221   5431 211    6       11  
jul 20117432    431  311    71      11  
abr 201114995511  431  522    85432   11  
jan 20119442222  541  4321   821111  11  
out 20105555532       7431   127752   11  
jul 20105533211       2221   42222       
abr 20104311111              5411    22  
jan 2010622111   1    3      5111    1   
out 2009322111        11     3           
jul 20092211111  1           41      11  
abr 20093211111  11          211         
jan 20094321111  22          72211   11  
out 20083211111  22   42     953111      
jul 20081      11   1      3           
abr 20082      11          1           
jan 20081111    11   2      2           
out 2007222221   11   2      42222       
jul 200731111                           
abr 200732221               22111       
jan 200711111   11          11          
out 2006                   1           
jul 2006                   1           
abr 20061                  1           
jan 200611          3      521         
out 2005                               
jul 2005                               
abr 2005                               
jan 2005                               

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1284100.0%141,569100.0%
39934.9%141,28599.8%
106924.3%141,11199.7%
324014.1%140,54099.3%
1003110.9%140,03398.9%
316238.1%138,71598.0%
1000186.3%136,39796.3%
316262.1%115,02281.2%
1000031.1%98,81669.8%
3162320.7%78,37555.4%

 

5 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Drabdullayev17UC13+61,7081,106213115nov 01, 20172103493126545
Lo XimiendoUC16-11,4266210110nov 22, 2010274613-465
BikarhênerUC29 0120362ago 16, 20151018--11
Aynurtimur05UC172...22--mai 26, 20184----
Farid MirzaUC283...11--mai 17, 201813----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Faiq ƏsgərUC139,518dez 01, 20131641ago 23, 20151011
SinanUC238,857jul 13, 20073974jun 02, 2017362
Əsgər FUC320,441ago 23, 20151011set 01, 2016636
InterwicketUC46,993jan 29, 20093408nov 08, 20102760
YeralashUC54,636jan 10, 2017505mai 02, 2017393
İstismarUC64,577jul 04, 2017330out 05, 2017237
QadyrUC73,084mai 02, 2017393jul 04, 2017330
Sinek~azwiktionaryUC82,190set 07, 20093187abr 22, 20131864
Музик ДельтманUC92,068nov 01, 2017210jan 02, 2018148
Hacı FaiqUC102,062out 01, 20131702out 31, 20131672
Hacı ƏsgərUC111,944nov 01, 20131671nov 30, 20131642
Hacı FətullaUC121,786set 01, 20131732set 30, 20131703
Mirzə MəmmədquluUC141,545ago 01, 20131763ago 31, 20131733
Aabdullayev851UC151,442nov 17, 2015925fev 18, 2017466
QalmaqalUC171,063fev 18, 2018101abr 23, 201837
Mirza HasanquluUC181,057jun 19, 20131806jul 31, 20131764
DesteliUC19737out 09, 2017233out 31, 2017211
SalicynaUC20507fev 07, 20112669ago 25, 20112470
123snake45UC21405mai 11, 20131845nov 26, 2016550
Cekli829UC22352set 15, 20093179jan 22, 2018128

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 3.267 edições foram feitas por usuários anônimos, de um total de 313.514 edições ( 1e %)
  


23 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC180,751abr 23, 20122228abr 26, 2017399125-
JAnDbotUC224,306mai 18, 20112569mar 31, 2017425--
OctraBotUC321,401ago 12, 2016656jun 03, 2017361--
UT-interwiki-BotUC411,399jul 13, 2016686abr 17, 2017408--
MalafayaBotUC510,412nov 18, 20112385jul 23, 2016676--
Luckas-botUC66,050mar 03, 20093375jan 27, 20141584--
YS-BotUC75,502set 08, 20122090out 19, 2015954--
KamikazeBotUC84,179out 18, 20112416mar 06, 20131911--
VolkovBotUC9972out 01, 20073894abr 05, 20131881--
AvocatoBotUC10631out 31, 20112403ago 25, 20131739--
WikitanvirBotUC11630abr 14, 20112603jan 19, 20122323--
ArthurBotUC12620nov 14, 20102754nov 12, 20112391--
RoggBotUC13443fev 07, 20093399jun 12, 20112544--
SpaceBirdyBotUC14378jul 07, 20083614dez 30, 20093073--
MjbmrbotUC15356jan 18, 20112689mar 28, 20112620--
WarddrBOTUC16300jul 25, 20122135ago 18, 20131746--
RobotGMwiktUC17212jan 09, 20074159jun 06, 20083645--
CarsracBotUC18107out 16, 20093148mai 30, 20131826--
Makecat-botUC1923nov 10, 20122027abr 05, 20131881--
AlexbotUC202fev 24, 20083748fev 24, 20083748--
GhalyBotUC212jan 06, 20131970jan 06, 20131970--
MelancholieBotUC221out 07, 20093157out 07, 20093157--
タチコマ robotUC231jul 28, 20151037jul 28, 20151037--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggSvg
mai 201856 k49541391,8 k13,7 k1      111
abr 201856 k49440391,7 k13,7 k1      111
mar 201856 k49340391,7 k13,7 k1      111
fev 201855 k48940391,7 k13,7 k1      111
jan 201855 k48439391,7 k13,7 k1      111
dez 201755 k48439391,7 k13,7 k1      111
nov 201755 k48238391,7 k13,7 k1      111
out 201754 k48137391,7 k13,7 k1      111
set 201754 k48137391,7 k13,7 k1      111
ago 201753 k47937391,7 k13,7 k1      111
jul 201753 k47937391,7 k13,7 k1      111
jun 201752 k47837391,7 k13,7 k1      111
mai 201751 k47737391,7 k13,7 k1      111
abr 201751 k47637391,7 k13,7 k1      111
mar 201750 k47536391,7 k13,7 k1      111
fev 201749 k47536391,7 k13,7 k1      111
jan 201749 k47336391,7 k13,7 k1      111
dez 201648 k47336391,7 k13,7 k1      111
nov 201648 k47336391,7 k13,7 k1      111
out 201648 k47336391,7 k13,7 k1      111
set 201648 k47235391,7 k13,7 k1      111
ago 201648 k47035391,7 k13,7 k1      111
jul 201648 k46729371,7 k13,6 k       111
jun 201647 k46729371,7 k13,6 k       111
mai 201646 k46629371,7 k13,6 k       111
abr 201646 k46529371,6 k13,6 k       111
mar 201645 k46329371,6 k13,6 k       111
fev 201644 k46127371,6 k13,5 k       111
jan 201643 k46120361,6 k13,4 k       111
dez 201542 k46020361,6 k13,4 k       111
nov 201541 k45419361,5 k13,3 k       111
out 201540 k45219361,5 k13,1 k       111
set 201539 k45119361,5 k13,0 k       111
ago 201538 k45019361,5 k13,0 k       111
jul 201537 k44919361,5 k12,9 k       111
jun 201536 k44719361,5 k12,8 k       111
mai 201535 k44719361,5 k12,8 k       111
abr 201534 k44619361,5 k12,7 k       111
mar 201533 k44519361,5 k12,6 k      2705111
fev 201532 k44519361,5 k12,6 k      1892111
jan 201531 k43919361,5 k12,6 k      1401111
dez 201430 k43419361,5 k12,6 k      1401111
nov 201429 k43219361,5 k12,6 k      1890111
out 201428 k42819261,5 k12,4 k      21221 1
set 201427 k42719261,5 k12,4 k      23351 1
ago 201426 k42319261,5 k12,3 k      19531 1
jul 201425 k42019261,5 k12,3 k      25461 1
jun 201423 k41919261,5 k12,3 k      43181 1
mai 201422 k41719261,4 k12,1 k      56721 1
abr 201420 k41619261,1 k11,5 k      42831 1
mar 201419 k41319261,1 k11,4 k      23651 1
fev 201417 k41019261,1 k11,4 k      23811 1
jan 201416 k40519261,1 k11,4 k      28471 1
dez 201314 k39919261,1 k11,3 k      22251 1
nov 201313 k39919261,1 k11,2 k      24931 1
out 201312 k39319261,1 k11,2 k      41591 1
set 201310 k39019261,1 k11,1 k      39981 1
ago 20138,6 k37619261,0 k11,0 k      19601 1
jul 20137,3 k37019261,0 k11,0 k      18131 1
jun 20136,5 k36319261,0 k11,0 k      1371 1
mai 20136,5 k36219261,0 k11,0 k      541 1
abr 20136,5 k36019261,0 k11,0 k      281 1
mar 20136,5 k35619261,0 k11,0 k      1461 1
fev 20136,4 k34719261,0 k11,0 k      271 1
jan 20136,4 k34019261,0 k11,0 k      521 1
dez 20126,4 k33719261,0 k11,0 k      531 1
nov 20126,4 k33019261,0 k11,0 k      291 1
out 20126,4 k32819261,0 k11,0 k      131 1
set 20126,4 k32419261,0 k11,0 k      661 1
ago 20126,4 k31919261,0 k11,0 k      3001 1
jul 20126,3 k31519261,0 k11,0 k      2011 1
jun 20126,2 k31219261,0 k11,0 k      691 1
mai 20126,2 k30119261,0 k11,0 k      751 1
abr 20126,2 k2951926999 1,0 k      341 1
mar 20126,2 k2881926999 1,0 k      211 1
fev 20126,1 k2871926997 1,0 k      7821 1
jan 20126,0 k2801926992 1,0 k      14131 1
dez 20115,7 k2751926948 966      12291 1
nov 20115,5 k2701926921 707      3451 1
out 20115,5 k2551926914 684      601 1
set 20115,5 k2491926914 683      531 1
ago 20115,4 k2431926911 683      261 1
jul 20115,4 k2391926910 657      541 1
jun 20115,4 k2311926908 657      321 1
mai 20115,4 k2281926907 654      491 1
abr 20115,4 k2191926906 624      9881 1
mar 20115,1 k2111826895 543      15011 1
fev 20114,7 k2081826860 524      20721 1
jan 20114,1 k1981726824 506      12671 1
dez 20103,5 k1921626811 495      15091 1
nov 20102,9 k1891616748 355      1429  1
out 20102,4 k1851615658 328      1436  1
set 20102,1 k1781615611 310      671  1
ago 20102,0 k17216 5608 309      1045   
jul 20101,9 k15516 5473 309      375   
jun 20101,8 k15416 5428 309      255   
mai 20101,8 k14516 5426 309      325   
abr 20101,8 k14316 5426 309      343   
mar 20101,8 k13916 5426 309      252   
fev 20101,8 k13416 5426 309      189   
jan 20101,8 k13216 5426 309      170   
dez 20091,8 k11916 5425 309      226   
nov 20091,8 k11816 5424 309      242   
out 20091,8 k11416 5424 309      238   
set 20091,8 k11216 5424 309      369   
ago 20091,8 k10516 5423 309      359   
jul 20091,8 k10516 5423 309      269   
jun 20091,8 k10315 5423 309      184   
mai 20091,8 k10115 5422 309      263   
abr 20091,8 k9915 5422 308      376   
mar 20091,8 k9215 5422 308      562   
fev 20091,8 k8914 5422 308      810   
jan 20091,8 k8114 5418 308      294   
dez 20081,7 k7814 5410 286      715   
nov 20081,6 k7614 5344 154      483   
out 20081,4 k6314 2283 94      785   
set 20081,1 k5014 2200 80      694   
ago 20087034912 2186 67      1   
jul 20087004912 2186 67      2   
jun 20086974711 2186 67      28   
mai 20086894211 2184 67      2   
abr 20086884211 2184 67      2   
mar 20086874111 2184 67      1   
fev 20086874011 2184 67      1   
jan 20086874011 2184 67      11   
dez 20076863811 2184 67      35   
nov 20076863611 2184 66      64   
out 20076403511 2182 64      328   
set 20074873111 2175 50      801   
ago 20072202910 2155 19      525   
jul 2007111259 2112 1      30   
jun 2007103259 2112 1          
mai 2007103259 2112 1          
abr 2007102259 2112 1      47   
mar 200764179 2109 1      5   
fev 200762169 2109 1      6   
jan 200758169 2108 1      52   
dez 200611159 2107 1      1   
nov 200610159 2106 1          
out 200610159 2106 1          
set 200610139 2106 1      6   
ago 20067128 295 1          
jul 20067128 295 1          
jun 20066118 294 1      3   
mai 20062116 280 1          
abr 20062116 280 1      1   
mar 20061116 280 1          
fev 20061116 280 1      2   
jan 20061106 280 1      4   
dez 2005153 279            
nov 200511  178            
out 200511  178            
set 200511  178            
ago 200511  178            
jul 200511  178            
jun 200511  178            
mai 200511  178            
abr 200511  178            
mar 20051   178            
fev 20051   178            
jan 20051   178            
dez 20041   178            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 Ana Səhifə

jan 2006: 1 1 Ana Səhifə

fev 2006: 1 2 Ana Səhifə

abr 2006: 1 1 Azərbaycan dili

jun 2006: 1 1 qartal

set 2006: 1 1 آتا

dez 2006: 1 1 kiçik

jan 2007: 1 1 arzu

fev 2007: 1 1 əl telefonu

mar 2007: 1 1 cənub

abr 2007: 1 1 səyahət

jul 2007: 1 1 armud

ago 2007: 1 2 türkcə , 2 1 köpək

set 2007: 1 2 yaşamaq , 2 1 april

out 2007: 1 2 ülgü , 2 2 görüş , 3 2 qorumaq , 4 1 gül

nov 2007: 1 1 səhra

dez 2007: 1 1 boşqab

jan 2008: 1 1 Moskva

fev 2008: 1 1 türkcə

mar 2008: 1 1 Ana Səhifə

abr 2008: 1 1 виноград

mai 2008: 1 1 August

jun 2008: 1 1 krım tatarca

jul 2008: 1 1 جالگاه

ago 2008: 1 1 Wolf

set 2008: 1 2 afrikaans , 2 2 Afrika dili , 3 2 Qırım Tatarca , 4 2 Ana Səhifə , 5 1 od

out 2008: 1 2 мак , 2 2 ana , 3 1 teatr

nov 2008: 1 2 patlıcan , 2 2 Finlandiya , 3 2 alt , 4 2 Məkkə , 5 2 nənə , 6 2 nar , 7 2 armud , 8 2 Ana Səhifə , 9 1 qovaq

dez 2008: 1 2 ürək , 2 1 fişəng

jan 2009: 1 2 lüğət , 2 2 zər , 3 2 qaynar , 4 1 гусь

fev 2009: 1 2 yarasa , 2 2 Kullanıcı:Mardetanha , 3 1 hörümçək

mar 2009: 1 1 döngə

abr 2009: 1 2 august , 2 1 Азербайджанский язык

mai 2009: 1 3 qozu , 2 3 qoy

jun 2009: 1 2 suiti

jul 2009: 1 2 Arbeit , 2 2 Katze , 3 1 katze

ago 2009: 1 2 птица , 2 2 bayraq , 3 1 mənzərə

set 2009: 1 2 cekcə , 2 2 Cek dili , 3 2 self control

out 2009: 1 2 həftə , 2 1 qapaq

nov 2009: 1 1 qapaq

dez 2009: 1 2 qovun , 2 2 banan , 3 2 Ana Səhifə , 4 1 həftə

jan 2010: 1 2 kəfgir , 2 2 pendir , 3 1 süzgəc

fev 2010: 1 1 page

mar 2010: 1 2 iribaş , 2 2 Kaulquappe

abr 2010: 1 2 skripka , 2 2 saqqal , 3 1 iribaş

mai 2010: 1 2 Ana Səhifə , 2 1 həftə

jun 2010: 1 2 Ellenbogen , 2 2 Ellbogen , 3 2 elbow

jul 2010: 1 2 teleskop , 2 2 hamam , 3 2 tiraj , 4 2 Opponent , 5 2 Cek dili , 6 2 qaşıq , 7 2 günəş , 8 2 Azərbaycan dili

ago 2010: 1 4 evlənmək , 2 3 çalma , 3 3 qızılquş , 4 3 lil , 5 3 öskürək , 6 3 ağartmaq , 7 3 yaralanmamaq , 8 3 konj , 9 3 çiyələk , 10 3 gecə , 11 3 heyva , 12 3 təsirlik , 13 3 ayı , 14 2 cover , 15 2 paxla , 16 2 palto , 17 2 menecer , 18 2 laboratoriya , 19 2 zərf , 20 2 gec , 21 2 kabel , 22 2 küknar , 23 2 yumaq , 24 2 katır , 25 2 qatır

set 2010: 1 2 brom , 2 2 шурин , 3 2 деверь , 4 2 qayın , 5 2 fıstıq , 6 2 золото , 7 2 altun , 8 2 sink , 9 2 mis , 10 2 Kimyəvi elementlərin dövri sistemi , 11 2 arsen , 12 2 мышьяк , 13 2 малахит , 14 2 meruňka , 15 2 кајсија , 16 2 кайсия , 17 2 marelica , 18 2 morela

out 2010: 1 4 sumaq , 2 3 türk , 3 3 yunan , 4 3 zəfər , 5 3 kürü , 6 3 dolma , 7 3 qırxayaq , 8 3 düymələmək , 9 3 yenot , 10 3 γαρύφαλλο , 11 3 nightingale , 12 3 süngü , 13 3 qəssab , 14 3 ekmek , 15 3 mesafe , 16 3 talaşa , 17 3 qonşu , 18 3 ayı , 19 2 верный , 20 2 alman , 21 2 помидор , 22 2 огурец , 23 2 француженка , 24 2 гречанка , 25 2 fransız

nov 2010: 1 3 nəticə , 2 3 yengeç , 3 3 maye , 4 3 ləngitmək , 5 3 yarpaq , 6 3 avokado , 7 3 kəpənək , 8 3 qələbə , 9 3 zoğ , 10 3 лягушка , 11 3 xərçəng , 12 3 üzüm , 13 2 çömçəquyruq , 14 2 otobüslerde , 15 2 domingo , 16 2 ორშაბათი , 17 2 siçovul , 18 2 salı , 19 2 pazartesi , 20 2 şahmatçı , 21 2 vücut , 22 2 safran , 23 2 xəzinə , 24 2 xəstələnmək , 25 2 heykeltıraş

dez 2010: 1 3 təsdiqləmək , 2 2 πάπια , 3 2 Golf , 4 2 valyuta , 5 2 ördəkburun , 6 2 körfəz , 7 2 nərd , 8 2 döymə , 9 2 əzələ , 10 2 solaxay , 11 2 yelkən , 12 2 zürafa , 13 2 nauka , 14 2 tamaşaçı , 15 2 şənbə , 16 2 octopus , 17 2 ördek , 18 2 Aubergine , 19 2 tərəvəz , 20 2 Affe , 21 2 ördək , 22 2 Wolf , 23 1 черепахи

jan 2011: 1 3 üstəgəl , 2 2 vegetasiya , 3 2 diod , 4 2 qovluq , 5 2 söğüt , 6 2 sfenks , 7 2 eyelash , 8 2 tavsiye , 9 2 видишь , 10 2 sevinmək , 11 2 çovğun , 12 2 strategiya , 13 2 velosiped , 14 2 abide , 15 2 sing , 16 2 speak , 17 1 lens

fev 2011: 1 3 barometr , 2 3 balıqçı , 3 3 yaltaqlıq , 4 3 mikrocərrahiyyə , 5 3 səkkiz , 6 3 əl telefonu , 7 3 Ana Səhifə , 8 2 xardal , 9 2 ilə , 10 2 hörük , 11 2 boyun , 12 2 çünki , 13 2 diktor , 14 2 yaltaqlanmaq , 15 2 yaltaq , 16 2 güzəşt , 17 2 külüng , 18 2 zənci , 19 2 qübbə , 20 2 incir , 21 2 on iki , 22 2 on bir , 23 2 dwadzieścia cztery , 24 2 dwadzieścia trzy , 25 2 hər

mar 2011: 1 3 yastıq , 2 3 şaquli , 3 3 üfüqi , 4 3 erkək , 5 3 maraqlı , 6 3 lava , 7 3 yaba , 8 3 hinduşka , 9 3 ovsunlamaq , 10 3 sześćdziesiąt pięć , 11 3 gəmi , 12 3 dekabr , 13 3 noyabr , 14 3 oktyabr , 15 3 sentyabr , 16 3 avqust , 17 2 pääsuke , 18 2 Fərat , 19 2 Dəclə , 20 2 itkin , 21 2 növbə , 22 2 ünsiyyət , 23 2 sərhədçi , 24 2 sahib , 25 2 yiyə

abr 2011: 1 3 cüyür , 2 3 qaratoyuq , 3 3 buket , 4 3 anlamaq , 5 3 ayçiçeği , 6 2 oiseau , 7 2 riyaziyyat , 8 2 eyvan , 9 2 tükətmək , 10 2 xəsis , 11 2 xəta , 12 2 xasiyyət , 13 2 təhqiqat , 14 2 dərs , 15 2 məşğələ , 16 2 təəccüb , 17 2 marş , 18 2 təxmin , 19 2 təhqiq , 20 2 təhdid , 21 2 təhqir , 22 2 tarif , 23 2 tərif , 24 2 izah , 25 2 təfsir

mai 2011: 1 3 Xorvatiya

jun 2011: 1 2 göbələk , 2 2 tərcümə , 3 1 claymore

jul 2011: 1 2 Serbiya , 2 2 Slovakiya , 3 1 çobanyastığı

ago 2011: 1 3 hədəf , 2 1 patlamak

set 2011: 1 2 γκέισα , 2 2 əqrəb , 3 1 kuyu

out 2011: 1 1 oyar

nov 2011: 1 2 maçã , 2 2 renk , 3 2 elma , 4 2 Pluton , 5 2 merkez , 6 2 manzana , 7 2 ailə , 8 2 alma , 9 1 mouse

dez 2011: 1 2 Misir , 2 2 tartaruga , 3 2 uğur , 4 2 krowa , 5 2 ποδήλατο , 6 2 geyinmək , 7 2 hazırlaşmaq , 8 2 vektor , 9 2 mizrab , 10 2 qarğıdalı , 11 2 mühərrik , 12 2 tumurcuq , 13 2 пчела , 14 2 şahmat , 15 1 marzo

jan 2012: 1 3 kenquru , 2 3 osminoq , 3 3 dinozavr , 4 3 arvad , 5 3 gəlin , 6 3 Lixtenşteyn , 7 3 böyürtkən , 8 2 xloroform , 9 2 platinum , 10 2 chloroform , 11 2 chemistry , 12 2 akustik , 13 2 velosipedçi , 14 2 idmançı , 15 2 təyyarəçi , 16 2 dəmir , 17 2 Qana , 18 2 Bosniya və Herseqovina , 19 2 oğul , 20 2 növbə , 21 2 koramal , 22 2 bibioğlu , 23 2 bibiqızı , 24 2 kitabxana , 25 2 tüstü

fev 2012: 1 2 Əskişəhər , 2 2 səhabə , 3 2 həvari , 4 2 mezarlık , 5 2 rəqəm , 6 2 nömrə , 7 1 Naxçıvan

mar 2012: 1 2 Azerbaijan , 2 1 choose

abr 2012: 1 2 arx , 2 1 donna

mai 2012: 1 2 ölkə , 2 1 panno

jun 2012: 1 2 aigua , 2 1 Aserbajdsjan

jul 2012: 1 3 body , 2 2 מים , 3 2 para , 4 2 bed , 5 2 ur , 6 2 Allah , 7 1 böcek

ago 2012: 1 2 Afghanistan , 2 2 əl , 3 1 miercuri

set 2012: 1 1 düğün

out 2012: 1 1 yumruq

nov 2012: 1 2 Versicherung , 2 2 owl , 3 2 Apfel , 4 1 Biləsuvar

dez 2012: 1 2 Cibuti , 2 1 çırpı

jan 2013: 1 2 Əlcəzair , 2 2 kəpənək , 3 1 Yugoslavya

fev 2013: 1 2 yardım , 2 1 xaç

mar 2013: 1 3 dırmıq , 2 3 Xocalı , 3 2 masturbasiya , 4 2 bambuk , 5 2 koreyalı , 6 1 մաստուրբացիա

abr 2013: 1 1 Balakən

mai 2013: 1 1 artmaq

jun 2013: 1 2 rojo , 2 2 axtarmaq , 3 1 hacer

jul 2013: 1 2 ti , 2 2 aimer , 3 2 Zaragoza , 4 2 копчёный , 5 2 fem , 6 2 اندک , 7 2 الان , 8 2 اسم , 9 2 biçmək , 10 2 sombra , 11 2 səbət , 12 2 копьё , 13 2 корзина , 14 2 aqua , 15 2 kingdom , 16 2 krallıq , 17 2 кормить , 18 2 лаваш , 19 2 косой , 20 2 косолапый , 21 2 костёр , 22 2 Stadt , 23 2 vedere , 24 2 vendere , 25 2 venire

ago 2013: 1 2 helado , 2 2 batir , 3 2 mezclar , 4 2 reír , 5 2 moreno , 6 2 кличка , 7 2 suivre , 8 2 başsağlığı , 9 2 qamçı , 10 2 careful , 11 2 birləşmək , 12 2 gün , 13 2 şam , 14 2 candle , 15 2 but , 16 2 Apia , 17 2 Samoa , 18 2 козёл , 19 2 enmək , 20 2 peigne , 21 2 öö , 22 2 yığmaq , 23 2 oğul , 24 2 Braziliya , 25 2 ya

set 2013: 1 3 yırtmaq , 2 3 yanmaq , 3 3 qısa , 4 3 qırıcı , 5 3 acı , 6 3 pəncərə , 7 3 göz , 8 3 qız , 9 3 qara , 10 2 yorğun , 11 2 Dunay , 12 2 qul , 13 2 parıltı , 14 2 balqabaq , 15 2 olmaq , 16 2 dağ , 17 2 bilet , 18 2 vicdansız , 19 2 daha , 20 2 hamilə , 21 2 yordam , 22 2 qiymət , 23 2 window , 24 2 исступлённый , 25 2 истерзать

out 2013: 1 3 ღვინო , 2 3 aldatmaq , 3 2 basdırmaq , 4 2 Maldiv adaları , 5 2 جزر المالديف , 6 2 Qərbi Sahara , 7 2 Batı Sahra , 8 2 Sahara Occidental , 9 2 Алабама , 10 2 planet , 11 2 Nasáu , 12 2 Nassau , 13 2 Нассау , 14 2 махуэ , 15 2 гъэ , 16 2 адэ , 17 2 бзэ , 18 2 пхъэгулъ , 19 2 bura , 20 2 suçlu , 21 2 изменить , 22 2 измениться , 23 2 изменник , 24 2 tutmak , 25 2 rüşvet

nov 2013: 1 2 zəhər , 2 2 yükləmək , 3 2 È un libro , 4 2 звать , 5 2 Dili , 6 2 Doha , 7 2 çağırmaq , 8 2 móðir , 9 2 mor , 10 2 sındırmaq , 11 2 söymək , 12 2 derramar , 13 2 o'ttiz , 14 2 sakkiz , 15 2 yetti , 16 2 besh , 17 2 uch , 18 2 ikki , 19 2 Solomon adaları , 20 2 Solomon Islands , 21 2 məqsəd , 22 2 Valletta , 23 2 qapıçı , 24 2 meyvə , 25 2 düzənlik

dez 2013: 1 2 Məhəmməd , 2 2 Yeni iliniz mübarək! , 3 2 qayə , 4 2 занимательный , 5 2 заниматься , 6 2 заноза , 7 2 заносчивый , 8 2 занятие , 9 2 заочный , 10 2 zabit , 11 2 yük , 12 2 yalan , 13 2 заунывный , 14 2 işğal etmək , 15 2 миндаль , 16 2 şəkər , 17 2 zarafat , 18 2 əməl , 19 2 boran , 20 2 cərimə , 21 2 müdafiəçi , 22 2 ərizə , 23 2 lemon , 24 2 bite , 25 2 Qambiya

jan 2014: 1 3 məna , 2 2 Ərəbistan dənizi , 3 2 bükmək , 4 2 təbiət , 5 2 peyk , 6 2 süni , 7 2 qanacaq , 8 2 hərf , 9 2 əski , 10 2 old , 11 2 əhəmiyyətli , 12 2 əhəmiyyətsiz , 13 2 hürriyyət , 14 2 önemsiz , 15 2 azadlıq , 16 2 etkisiz , 17 2 etkili , 18 2 güncel , 19 2 özgürlük , 20 2 səhv , 21 2 buğ , 22 2 buxar , 23 2 örtülü , 24 2 tədarük , 25 2 tədarük etmək

fev 2014: 1 3 udmaq , 2 2 Кишинёв , 3 2 Chișinău , 4 2 cüt , 5 2 Birləşmiş Ərəb Əmirlikləri , 6 2 cavab , 7 2 cavab vermək , 8 2 parlaq , 9 2 cəllad , 10 2 vergi , 11 2 rapu , 12 2 testa , 13 2 giornale , 14 2 frutto , 15 2 egli , 16 2 dente , 17 2 bambina , 18 2 bambino , 19 2 cambra , 20 2 бал , 21 2 siekiera , 22 1 Irlande

mar 2014: 1 2 Mərkəzi Afrika Respublikası , 2 2 kütlə , 3 2 balet , 4 2 televiziya , 5 2 cin , 6 2 şeytan , 7 2 adi , 8 2 rəf , 9 2 cinayət , 10 2 zəncir , 11 2 qəsəbə , 12 2 vadi , 13 2 qüllə , 14 2 qısa , 15 2 occasion , 16 2 Georgia , 17 2 Türkmənistan , 18 2 vəzifə , 19 2 Bosniya və Herseqovina , 20 2 Gürcüstan , 21 2 yeni , 22 2 bacı , 23 2 Azerbaijan , 24 2 saat , 25 1 бачыць

abr 2014: 1 2 adroit , 2 2 ödəniş , 3 2 abandonner , 4 2 tərk etmək , 5 2 mirvari , 6 2 Xoş gəlmisiniz! , 7 2 əsir , 8 2 sərbəst , 9 2 şüar , 10 2 действие , 11 2 çat , 12 2 daxma , 13 2 azad , 14 2 bölən , 15 2 dərnək , 16 2 varlı , 17 2 buzlaq , 18 2 çalışqan , 19 2 Асмэра , 20 2 Qırmızı dəniz , 21 2 شتر , 22 2 شارب , 23 2 Ostsee , 24 2 Балтыйскае мора , 25 2 İssık-Kul

mai 2014: 1 3 İsveçrə , 2 3 balıq , 3 3 pəncərə , 4 2 Bazel , 5 2 porco , 6 2 abacaxi , 7 2 Düşənbə , 8 2 Pamir , 9 2 jöl , 10 2 vinte , 11 2 Bugarska , 12 2 nida , 13 2 təşəkkür , 14 2 София , 15 2 Кура , 16 2 Augustus , 17 2 Julie , 18 2 Junie , 19 2 Mei , 20 2 Maart , 21 2 Februarie , 22 2 Januarie , 23 2 Desember , 24 2 Παραγουάη , 25 2 Парагвай

jun 2014: 1 3 açmaq , 2 3 çuğundur , 3 2 aprikoos , 4 2 নাক , 5 2 कान , 6 2 কান , 7 2 Шуэц , 8 2 Suécia , 9 2 əjdəha , 10 2 Estocolmo , 11 2 pencər , 12 2 вьюга , 13 2 Belqrad , 14 2 Niş , 15 2 , 16 2 Voyevodina , 17 2 South America , 18 2 Zaltsburq , 19 2 Vyana , 20 2 Wien , 21 2 ящерица , 22 2 Гондурас , 23 2 Tequsiqalpa , 24 2 Portu , 25 2 Berno

jul 2014: 1 2 Minsk , 2 2 çıxıb getmək , 3 2 aýy , 4 2 çıxarış , 5 2 leikur , 6 2 Cotonou , 7 2 Porto-Novo , 8 2 Порто-Ново , 9 2 ბენინი , 10 2 بنين , 11 2 Μπενίν , 12 2 Bénin , 13 2 кафта , 14 2 кьюб , 15 2 zwee , 16 2 duo , 17 2 două , 18 2 lien , 19 2 rate , 20 2 croupe , 21 2 rond , 22 2 dahi , 23 2 constant , 24 2 intérieur , 25 2 génie

ago 2014: 1 2 öpmək , 2 2 qalxan , 3 2 mühasirə , 4 2 xüsusi , 5 1 хьед

set 2014: 1 2 Yunoniston , 2 2 Yunanistan , 3 2 Yunanıstan , 4 1 scarabeo

out 2014: 1 2 coraggioso , 2 2 morrer , 3 2 yazıçı , 4 2 ölmək , 5 2 krava , 6 1 akã

nov 2014: 1 2 sındırmaq , 2 2 bardaq , 3 2 alın , 4 1 rust

dez 2014: 1 2 turp , 2 2 siçan , 3 2 qız , 4 1 беркайчан

jan 2015: 1 2 əbədi , 2 2 tender , 3 2 Burkina-Faso , 4 2 Januari , 5 2 göndərmək , 6 2 Florida , 7 1 mein

fev 2015: 1 2 qayğı , 2 2 завръщам , 3 2 muzey , 4 2 мы , 5 1 mukayyet olmak

mar 2015: 1 2 mərhələ , 2 2 pillə , 3 2 Çukot dənizi , 4 2 femton , 5 2 yağmaq , 6 2 mötəbər , 7 2 kəlləmayallaq , 8 2 etibar , 9 2 etimad , 10 2 ανάμνηση , 11 2 yel , 12 2 vint , 13 2 baldır , 14 2 quinze , 15 2 quince , 16 2 qıf , 17 2 sərhəd , 18 2 musiqi , 19 1 Bukareszt

abr 2015: 1 3 Buxarest , 2 2 rəy , 3 2 Сирия , 4 2 Syria , 5 2 Siria , 6 2 Suriya , 7 2 kar , 8 2 səs , 9 2 Bukarest , 10 2 qarğa , 11 2 on , 12 2 Rumıniya , 13 2 saqqal , 14 1 sizär

mai 2015: 1 2 yollamaq , 2 2 balta , 3 1 claudo

jun 2015: 1 2 tənqid , 2 2 üfunət , 3 2 Oxot dənizi , 4 2 daimi , 5 1 ولادى وستوک

jul 2015: 1 2 ເມກ , 2 2 oğurlamaq , 3 2 təbil , 4 2 arabir , 5 2 tərəfdar , 6 2 xaç , 7 2 yubatmaq , 8 2 ləngimək , 9 2 mən , 10 1 d'abord

ago 2015: 1 3 eşşək , 2 3 gün , 3 3 damcı , 4 3 lüğət , 5 3 quş , 6 3 yumurta , 7 3 qan , 8 2 prijatelj , 9 2 lisica , 10 2 noga , 11 2 strah , 12 2 страх , 13 2 лице , 14 2 káva , 15 2 пес , 16 2 bomull , 17 2 kaffe , 18 2 barn , 19 2 brun , 20 2 əziz , 21 2 Yəmən , 22 2 tikili , 23 2 birə , 24 2 uçmaq , 25 2 vurmaq

set 2015: 1 2 вораг , 2 2 evn , 3 2 dóttir , 4 2 barn , 5 2 Sinqapur , 6 2 koza , 7 2 şəkər , 8 2 fərq , 9 2 kömür , 10 2 vəzifə , 11 2 kəpənək , 12 2 палец , 13 2 barmaq , 14 2 qaçmaq , 15 2 böyük , 16 2 dəqiqə , 17 2 körpü , 18 1 fontaine

out 2015: 1 2 Berinq dənizi , 2 2 vergül , 3 2 urbo , 4 2 gicgah , 5 2 İrkutsk vilayəti , 6 2 nälkä , 7 2 kana , 8 2 erdő , 9 2 okno , 10 2 oheň , 11 2 nepřítel , 12 2 mięso , 13 2 Mósambík , 14 2 hədsiz , 15 2 көрші , 16 2 Mozambique , 17 2 øye , 18 2 เลือด , 19 2 noga , 20 2 лук , 21 2 Atlantik okean , 22 2 med , 23 2 ulu , 24 2 Mozambik , 25 2 kəpənək

nov 2015: 1 3 baba , 2 3 at , 3 2 Anqara , 4 2 addımlamaq , 5 2 vaza , 6 2 Krasnoyarsk , 7 2 Yenisey , 8 2 ortiga , 9 2 görkəmli , 10 2 Qızıl , 11 2 serán , 12 2 Xakasiya , 13 2 tongolo , 14 2 Tıva , 15 2 geydirmək , 16 2 dolaşa , 17 2 Himalay , 18 2 मेंढक , 19 2 अग्नि , 20 2 general , 21 2 işlətmək , 22 2 Katmandu , 23 2 काठमाडौं , 24 2 geyim , 25 2 fərz etmək

dez 2015: 1 3 xəbər almaq , 2 3 tanışmaq , 3 3 bildirmək , 4 3 yaymaq , 5 3 dəvət etmək , 6 3 bumbac , 7 3 Kirsche , 8 3 ət , 9 2 unga , 10 2 пынцӏа , 11 2 myydä , 12 2 ажвар , 13 2 ажва , 14 2 manqo , 15 2 Mango , 16 2 Maulbeere , 17 2 Feige , 18 2 Avocado , 19 2 Himbeere , 20 2 Erdbeere , 21 2 Pflaume , 22 2 Hartriegel , 23 2 аща , 24 2 Pfirsich , 25 2 Traube

jan 2016: 1 2 florero , 2 2 tóc , 3 2 vườn , 4 2 rừng , 5 2 vàng , 6 2 chúa , 7 2 yêu , 8 2 Cộng hòa Altai , 9 2 yoğurmaq , 10 2 aran , 11 2 Malaysia , 12 2 Milbe , 13 1 pashsha

fev 2016: 1 3 pomidor , 2 2 oilo , 3 2 zahid , 4 2 Linie , 5 2 aclıq , 6 2 Səudiyyə Ərəbistanı , 7 2 tomat , 8 2 həqiqət , 9 2 Peru , 10 2 ananas , 11 2 ordu , 12 2 ağac , 13 2 bal , 14 1 Samanyolu

mar 2016: 1 2 кодзувкот , 2 2 dördüncü , 3 2 ӕврагъ , 4 2 so , 5 2 aclıq , 6 2 alqoritm , 7 2 Səudiyyə Ərəbistanı , 8 2 qulaq , 9 2 tanrı , 10 2 burun , 11 2 körpü , 12 2 keçi , 13 2 çörək , 14 2 inək , 15 2 qarışqa , 16 2 qarğa , 17 2 dörd , 18 2 saat , 19 2 ailə , 20 1 earm

abr 2016: 1 2 quyosh , 2 2 òspiti , 3 2 virdi , 4 2 oru , 5 2 Afgʻoniston , 6 2 академия , 7 2 εννοώ , 8 2 perkele , 9 2 tulla , 10 2 větev , 11 2 rzęsa , 12 2 корыч , 13 2 paygʻambar , 14 2 isimanna , 15 2 Gürcüstan Demokratik Respublikası , 16 2 gümüş , 17 2 artist , 18 2 düyün , 19 2 Afghanistan , 20 2 akasiya , 21 2 ip , 22 2 kirpik , 23 2 Adriatik dənizi , 24 2 turp , 25 2 mürəbbə

mai 2016: 1 2 swine , 2 2 frère , 3 2 birə , 4 2 yer , 5 2 hamar , 6 2 gün , 7 2 qəzet , 8 2 dəmir , 9 2 ip , 10 2 lüğət , 11 2 barmaq , 12 2 donuz , 13 2 böyrək , 14 2 bayquş , 15 2 axşam , 16 2 yeni , 17 2 üz , 18 2 qulaq , 19 2 soğan , 20 2 açar , 21 2 balıq , 22 2 düşmən , 23 2 burun , 24 2 göz , 25 2 bulud

jun 2016: 1 2 מרקש , 2 2 Gelenk , 3 2 Mərakeş , 4 2 həşərat , 5 2 ip , 6 2 qamış , 7 2 bayquş , 8 2 qulaq , 9 2 bibər , 10 2 çay , 11 2 pələng , 12 1 Нижнекамск

jul 2016: 1 2 balıq , 2 1 Ergänzung

ago 2016: 1 3 cegonha , 2 3 gift , 3 3 regn , 4 2 иззад , 5 2 yipek , 6 2 καίω , 7 2 κάθομαι , 8 2 κακός , 9 2 Басра , 10 2 Karbalo , 11 2 الرمادي , 12 2 cauda , 13 2 allenamento , 14 2 affogare , 15 2 Petroskoi , 16 2 ais , 17 2 saniye , 18 2 kümüş , 19 2 kartof , 20 2 mevsim , 21 2 causa , 22 2 a , 23 2 oğul , 24 2 ip , 25 2 gemi

set 2016: 1 1 amoj

out 2016: 1 1 's Hertogenbosch

nov 2016: 1 2 kompas , 2 1 Glas

dez 2016: 1 2 badımcan , 2 1 topara

jan 2017: 1 2 Klee , 2 2 göz , 3 2 dörd , 4 2 it , 5 1 kiore

fev 2017: 1 2 βροχή , 2 2 dolu , 3 1 pohled

mar 2017: 1 1 what

abr 2017: 1 1 remiendo

mai 2017: 1 3 əl , 2 2 Alger , 3 2 Uganda , 4 2 bağlamaq , 5 2 Uqanda , 6 2 Əlcəzair , 7 2 tələffüz , 8 2 saç , 9 2 ipək , 10 2 dekabr , 11 2 sentyabr , 12 1 sandur

jun 2017: 1 2 acgöz , 2 2 luku , 3 2 lukea , 4 2 käydä , 5 2 mirë , 6 2 συναντώ , 7 2 σύμβαση , 8 2 σύκο , 9 2 пајак , 10 2 змија , 11 2 училиште , 12 2 cunhado , 13 2 небо , 14 2 сапун , 15 2 пролет , 16 1 aýaz

jul 2017: 1 2 Uganda , 2 2 təkrar etmək , 3 2 təbəssüm , 4 2 casus , 5 2 tədbir , 6 2 vadi , 7 2 imtahan , 8 2 Uqanda , 9 2 boyun , 10 2 tələffüz , 11 2 tikmək , 12 2 səs , 13 2 göy , 14 2 çay , 15 2 saat , 16 2 dil , 17 1 pogląd

ago 2017: 1 2 Mauritania , 2 1 байпак

set 2017: 1 2 Sovet Sosialist Respublikaları İttifaqı , 2 2 tələffüz , 3 1 exception

out 2017: 1 3 Ukrayna , 2 2 Ûkrayna , 3 2 Ucraína , 4 2 Ukraina , 5 2 Украина , 6 1 আয়না

nov 2017: 1 2 cümə , 2 2 iyul , 3 2 iyun , 4 1 jagster

dez 2017: 1 1 уморен

jan 2018: 1 1 тхылъымпӏэ

fev 2018: 1 3 ovqat , 2 2 qabr , 3 2 dori , 4 1 novanta

mar 2018: 1 2 meyvə , 2 2 şüyüd , 3 2 söz , 4 1 prajurit

abr 2018: 1 2 əhali , 2 1 Şərqi Avropa

mai 2018: 1 1 ۋه

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 9 de junho 2018 11:48

Dump file azwiktionary-20180601-stub-meta-history.xml.gz (edits only), size 21 Mb as gz -> 167 Mb
Dump processed till May 31, 2018, on server stat1005, ready at Sat-02/06/2018-06:33 after 1 min, 38 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.