Estatísticas da Wikcionário azeri

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2017
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mar 2017+2%   +1%-9%  -34%      0%
fev 20170%   +1%   +79%      0%
jan 2017+2%   +1%   +240%      0%
dez 20160%   0%   +30%      0%
nov 20160%   0%   -44%      0%
out 20160%   0%   -21%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 20175812150 k215,1 4,6 k      129
fev 201757 2149 k235,1 6,9 k      129
jan 20175712149 k165 3,9 k      129
dez 201656 3 48 k 5 1,1 k      129
nov 201656   48 k 4,9 873      129
out 201656 2 48 k 4,9 1,6 k      129
set 201656 2 48 k14,9 2,0 k      129
ago 20165615248 k174,8 18 k      129
jul 201655 2148 k274,5 4,4 k      127
jun 20165515147 k254,5 3,0 k      127
mai 201654 2246 k144,5 4,0 k      127
abr 20165416346 k294,5 3,8 k      125
mar 20165325245 k254,5 3,6 k      119
fev 201651 7144 k294,5 1,9 k      109
jan 201651 4443 k364,5 3,8 k      107
dez 201551 8342 k304,6 11 k      106
nov 20155113241 k404,4 6,2 k      105
out 201550 2240 k354,4 6,1 k      104
set 20155015139 k304,3 7,0 k      102
ago 20154924238 k284,2 5,2 k      102
jul 201547 4137 k314,2 6,9 k      102
jun 20154713236 k264,1 7,5 k      100
mai 20154613135 k294 4,6 k      99
abr 201545 2234 k394 5,4 k      99
mar 20154512233 k4246203,6 k36 Mb3,2 M9,3 k322 k9,3 k53099
fev 201544 3132 k3546192,5 k35 Mb3,1 M9,3 k317 k9,0 k52997
jan 201544 3131 k244,16212,2 k34 Mb3,1 M9,3 k313 k9,0 k52997
dez 201444 2130 k294,16282,2 k34 Mb3,1 M9,3 k304 k8,9 k52997
nov 201444 1129 k434,16312,5 k34 Mb3,1 M9,3 k300 k8,9 k52996
out 20144414128 k364,26304,0 k33 Mb3,1 M9,3 k300 k8,9 k52995
set 201443 2127 k424,36545,5 k33 Mb3,0 M9,3 k285 k8,9 k52992
ago 20144313126 k354,27024,4 k32 Mb3,0 M9,3 k253 k8,9 k52991
jul 201442 3225 k384,37463,4 k31 Mb3,0 M9,3 k219 k8,9 k52989
jun 201442 4223 k464,37644,7 k31 Mb2,9 M9,2 k208 k8,7 k53088
mai 201442 4222 k584,47317,0 k29 Mb2,8 M8,6 k205 k8,0 k51784
abr 201442 2220 k534,47084,5 k27 Mb2,6 M7,5 k198 k7,1 k50975
mar 201442 3219 k454,66762,7 k24 Mb2,2 M6,8 k196 k5,7 k50772
fev 20144215217 k464,86782,8 k23 Mb2,2 M6,8 k194 k5,6 k50771
jan 201441 4216 k4956764,2 k22 Mb2,1 M6,7 k191 k5,4 k50770
dez 20134112214 k385,26904,3 k20 Mb1,9 M6,4 k176 k4,8 k50469
nov 20134023213 k445,47363,4 k19 Mb1,8 M6,2 k148 k4,3 k50069
out 20133814212 k535,77565,0 k18 Mb1,7 M6,1 k133 k4,1 k47965
set 20133724310 k576,17814,7 k16 Mb1,6 M5,9 k121 k3,7 k45563
ago 2013352428,5 k416,87513,2 k13 Mb1,3 M5,8 k116 k2,8 k11761
jul 201333 327,3 k257,57762,8 k12 Mb1,2 M5,8 k105 k2,7 k3559
jun 20133323 6,5 k1882135312 Mb1,1 M5,8 k96 k2,6 k356
mai 20133112 6,5 k 882471512 Mb1,1 M5,8 k96 k2,6 k356
abr 20133011 6,4 k 7,982431912 Mb1,1 M5,8 k95 k2,6 k356
mar 201329 5 6,4 k27,882447512 Mb1,1 M5,8 k95 k2,6 k356
fev 20132912 6,4 k 7,882747111 Mb1,1 M5,6 k94 k2,6 k355
jan 201328 2 6,4 k 7,882778311 Mb1,1 M5,6 k94 k2,6 k355
dez 201228 2 6,4 k 7,682899311 Mb1,1 M5,6 k93 k2,6 k355
nov 20122812 6,4 k 7,582852711 Mb1,1 M5,6 k91 k2,6 k355
out 201227   6,4 k 7,482782311 Mb1,1 M5,6 k91 k2,6 k354
set 201227 3 6,4 k 7,382772511 Mb1,1 M5,6 k90 k2,6 k354
ago 201227 216,4 k17,28281,2 k11 Mb1,1 M5,6 k89 k2,6 k354
jul 201227 416,3 k5783091511 Mb1,1 M5,6 k87 k2,6 k354
jun 20122713 6,2 k17,184956211 Mb1,1 M5,6 k82 k2,6 k352
mai 20122614 6,1 k 785076311 Mb1,1 M5,6 k81 k2,6 k350
abr 201225 2 6,1 k 6,984960811 Mb1,1 M5,6 k80 k2,6 k350
mar 201225 2 6,1 k 6,884959911 Mb1,1 M5,5 k79 k2,6 k350
fev 201225 216,1 k66,78501,5 k11 Mb1,1 M5,5 k79 k2,6 k350
jan 201225 745,9 k96,78192,0 k10 Mb1,0 M5,5 k75 k2,4 k350
dez 2011251315,6 k56,67912,6 k9,8 Mb953 k5,4 k72 k2,3 k349
nov 201124 415,5 k26,47822,6 k9,3 Mb920 k5,2 k68 k2,3 k349
out 201124 2 5,4 k 67812,7 k9,2 Mb907 k5,2 k67 k2,3 k349
set 201124 3 5,4 k15,57893769,1 Mb898 k5,2 k60 k2,3 k349
ago 20112411 5,4 k 5,47923579,1 Mb896 k5,2 k59 k2,2 k348
jul 201123 3 5,4 k15,47932819,0 Mb895 k5,2 k58 k2,2 k348
jun 201123 2 5,4 k 5,37958449,0 Mb888 k5,1 k58 k2,2 k348
mai 20112313 5,3 k 5,27985998,9 Mb886 k5,1 k54 k2,2 k348
abr 201122 915,3 k85,18041,6 k8,9 Mb884 k5,1 k50 k2,2 k348
mar 201122 535,1 k1357872,0 k8,2 Mb807 k4,9 k47 k2,1 k347
fev 2011221534,7 k2357452,3 k6,9 Mb661 k4,3 k41 k1,7 k347
jan 201121 424,0 k195,36651,5 k5,5 Mb517 k2,9 k39 k961546
dez 2010211623,5 k185,77032,0 k5,1 Mb483 k2,6 k36 k754746
nov 2010201532,9 k196,17191,9 k4,3 Mb410 k1,8 k30 k502742
out 2010191532,3 k96,77251,4 k3,5 Mb342 k1,5 k26 k349742
set 201018 222,1 k46,97106763,0 Mb280 k1,3 k22 k208741
ago 2010181532,0 k476711,1 k2,6 Mb235 k1,2 k22 k208741
jul 2010172311,8 k 6,95923821,8 Mb163 k1,1 k21 k208740
jun 201015 211,8 k 6,85882551,8 Mb161 k1,1 k21 k209740
mai 201015 111,8 k 6,65893291,8 Mb160 k1,1 k20 k209740
abr 201015 111,8 k 6,55863481,8 Mb159 k1,1 k20 k209740
mar 2010151211,8 k 6,35842531,8 Mb159 k1,1 k20 k209740
fev 201014 111,8 k 6,15811921,7 Mb158 k1,1 k19 k209240
jan 201014 211,8 k 65811791,7 Mb158 k1,1 k19 k209240
dez 2009141111,8 k 5,95802331,7 Mb158 k1,1 k19 k210240
nov 200913 111,8 k 5,85802491,7 Mb158 k1,1 k19 k210240
out 200913 211,8 k 5,75812451,7 Mb158 k1,1 k19 k210240
set 2009132211,8 k 5,55793691,7 Mb157 k1,1 k18 k210240
ago 200911 111,8 k 5,45813611,7 Mb156 k1,0 k18 k210240
jul 200911 111,8 k 5,25812781,7 Mb156 k1,0 k17 k210240
jun 200911 111,8 k 55811901,7 Mb156 k1,0 k17 k210238
mai 200911 111,8 k 4,95792841,7 Mb155 k1,0 k17 k210238
abr 200911 111,8 k 4,85793941,7 Mb155 k1,0 k17 k211238
mar 200911 111,8 k 4,55806521,7 Mb155 k1,0 k16 k211238
fev 2009111211,8 k 4,25891,1 k1,7 Mb160 k1,0 k16 k211238
jan 200910 211,8 k33,66114011,6 Mb166 k1,0 k12 k212238
dez 200810 111,7 k43,65958071,5 Mb153 k96811 k225238
nov 2008101211,5 k53,35346001,3 Mb129 k8069,0 k279233
out 20089 111,4 k123,24108261014 kb94 k6997,6 k269133
set 20089 111,0 k123,6363745670 kb62 k5126,1 k126132
ago 20089   684 4,338280492 kb44 k4145,6 k109 27
jul 20089   681 4,2383117488 kb44 k4145,4 k109 27
jun 2008911 679 4,138285484 kb44 k4045,3 k109 26
mai 20088   671 4385126479 kb44 k3955,1 k108 26
abr 20088   670 3,838653475 kb44 k3954,8 k108 26
mar 20088   669 3,738665467 kb44 k3954,4 k108 26
fev 20088   669 3,638697464 kb44 k3954,2 k108 26
jan 2008811 669 3,5386100451 kb44 k3953,3 k108 26
dez 2007711 668 3,338653438 kb44 k3952,3 k108 26
nov 20076 1 66813,338579435 kb44 k3952,1 k110 26
out 2007612162453,4399404406 kb40 k3932,0 k110 24
set 20075 1148393,5364840283 kb28 k3161,1 k79 11
ago 20075 1121733,924856287 kb7,7 k33448030 9
jul 2007511 111 2,72394141 kb3,4 k1343261 3
jun 20074   103 2,5236238 kb3,1 k982901 3
mai 20074   103 2,4236538 kb3,1 k982891 3
abr 2007412 10212,42355238 kb3,1 k982861 3
mar 20073   64 32301423 kb1,9 k162801 3
fev 20073 1 62 2,92232422 kb1,9 k62761 3
jan 2007311 5822,72249921 kb1,7 k62532 3
dez 20062   11 5,333965,5 kb33461281 3
nov 20062   10 5,231935,2 kb30661281 3
out 20062   10 4,931825,2 kb30561281 3
set 2006211 10 4,731365,2 kb29961281 3
ago 20061   7 5,9365 4,6 kb26461281 3
jul 20061   7 5,936514,6 kb26461281 3
jun 20061   6 6,7406164,5 kb25061281 3
mai 20061   2 121474 5,9 kb357 127 293
abr 20061   2 12147415,9 kb357 127 293
mar 20061   1 231442 4,0 kb228 127 293
fev 20061   1 23144274,0 kb228 127 293
jan 20061   1 16143294,0 kb227 127 291
dez 20051   1 732761,7 kb41 127  1
nov 20051   1 1  14       
out 20051   1 1  14       
set 20051   1 1  14       
ago 20051   1 1  14       
jul 20051   1 1  14       
jun 20051   1 1  14       
mai 20051   1 1  14       
abr 20051   1 1  14       
mar 20051   1 1  14       
fev 20051   1 1  14       
jan 20051   1 1  14       
dez 200411  1 1 114       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201749324935512481 35      140
out 201648 42 49 81 56      140
jul 201648 4836492384 36      140
abr 201648242421492081 30      140
jan 201650 3915481983 26      140
out 201550 4928472083 29      140
jul 201550 3336471882 38      140
abr 201550 5031491684 32      140
jan 20155036413751247894238319147734140
out 20144829303650177383036308845734140
jul 20145032372652216872937308851733140
abr 20145031462761176872340319151734140
jan 20145042322563126272542349250734140
out 20135029332569134672143369155734140
jul 20135038422674202473552449157880140
abr 201351256451776519569544592618109140
jan 201353455254766723364524392618107140
out 201252378249736424360504189628105140
jul 201251523538714327359494087608107140
abr 201252395252716629366494086617107140
jan 2012513523177034323415343836110106140
out 2011514255496868374465345816112104140
jul 2011524443496756464645243806211105140
abr 2011533320376634483484841806210103140
jan 201153353927692242643575184641898140
out 201058283331763531748615592682995140
jul 2010611951618066261074706498703790140
abr 2010634882587858281072676296673691140
jan 20106533575374613110726660946335102140
out 20096340625573563110696560936333100140
jul 2009674181577359379676355946232100140
abr 2009645182556953399616354886127100140
jan 2009646053356939499506153876428101140
out 20086436583673255415336959926923105139
jul 200864327346795975757278711007234117139
abr 20086742794978647171777670997033112139
jan 20086335585174596868727265957229111139
out 20077231473872366464527260917126112139
jul 200775345844925964647799941019887108138
abr 20078133474789566161859891999680107138
jan 2007913356469345555574100931129364100138
out 2006101406743106535050108110113109966497138
jul 2006113416938108534646113112113107905597138
abr 200611038543511049424284104102113805340138
jan 200693466034103413737729897102734441130
out 200585   98    118     118
jul 200579   92    113     113
abr 200575   85    100     100
jan 200567   71    88     88
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  5  10  1  3  5  10  25  100  250  1000  5  10  100 
mar 201742221111 4432        3       21 
fev 201773222111 4431        72221   22 
jan 20177422211  4431        31111   22 
dez 20169531    332  1      221     21 
nov 20165      442         2       322
out 201652211   4431 221    533211  22 
set 201653211   4421 322    1022221  33 
ago 201696543211 3321154221  10433321 221
jul 201682221111 3331        21      221
jun 201666542111 222  1      62      221
mai 20168322222  3322 2      4111    11 
abr 201696653311 2221 2111   76421   111
mar 2016106553211 2221 411    833321  22 
fev 2016137742111 11   1      84432   11 
jan 201684444431 222  421    44432   221
dez 2015159854332 3332 52221  19643322 221
nov 20156333322212221 3      7222111 221
out 2015104222222 3331 2      96321   321
set 2015107533111 4441 621    94211   222
ago 2015105433221 4441 2      82222   222
jul 201565411111 3331 1      422211  222
jun 201585332211 3331 1      21      221
mai 201564322111 3331 21     73322   221
abr 201583222221 4432 31   2263221   321
mar 201593222221 332  2    11331     221
fev 201594322111 222  32     103      221
jan 201586322111 442  41     93211   221
jan 20177422211  4431        31111   22 
out 201652211   4431 221    533211  22 
jul 201682221111 3331        21      221
abr 201696653311 2221 2111   76421   111
jan 201684444431 222  421    44432   221
out 2015104222222 3331 2      96321   321
jul 201565411111 3331 1      422211  222
abr 201583222221 4432 31   2263221   321
jan 201586322111 442  41     93211   221
out 201484431111 1111        411     2  
jul 201474322221 222         311111  111
abr 201484222222 221  311    13311111 111
jan 201484444221 443  42     125322   22 
out 201364443222 222  3      9431111 1  
jul 20136333222  221  111    911111  21 
abr 201331111   541         3       221
jan 201352211   761  31     211     21 
out 201291     332  31     631     22 
jul 2012764311   542  7222   154311   22 
abr 20128421    653  22     311     22 
jan 201212875441  761  6431   954211  32 
out 201152221   5431 211    6       11 
jul 20117432    431  311    71      11 
abr 201114995511  431  522    85432   11 
jan 20119442222  541  4331   821111  11 
out 20105555532       7431   127752   11 
jul 20105533211       2221   42222      
abr 20104311111              5411    22 
jan 2010622111   1    3      5111    1  
out 2009322111        11     3          
jul 20092211111  1           41      11 
abr 20093211111  11          211        
jan 20094321111  22          72211   11 
out 20083211111  22   42     953111     
jul 20081      11   1      3          
abr 20082      11          1          
jan 20081111    11   2      2          
out 2007222221   11   2      42222      
jul 200731111                          
abr 200732221               22111      
jan 200711111   11          11         
out 2006                   1          
jul 2006                   1          
abr 20061           1      1          
jan 200611          4      521        
out 2005                              
jul 2005                              
abr 2005                              
jan 2005                              

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1244100.0%127,079100.0%
38534.8%126,82999.8%
105723.4%126,66599.7%
323313.5%126,20499.3%
1002510.2%125,75899.0%
316166.6%124,13097.7%
1000135.3%122,86796.7%
316252.0%109,47686.1%
1000031.2%98,79077.7%
3162320.8%78,34361.6%

 

4 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
YeralashUC5 03,6921,3971-jan 10, 2017791,746634--
IBAnkUC47...181811mar 13, 2017171515--
BD2412UC84+19411-jan 12, 2015808--1-
Article1UC243...11--mar 31, 2017 ----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Faiq ƏsgərUC139,535dez 01, 20131215ago 23, 2015585
SinanUC238,808jul 13, 20073548dez 08, 2016112
Əsgər FUC320,447ago 23, 2015585set 01, 2016210
InterwicketUC46,994jan 29, 20092982nov 08, 20102334
Sinek~azwiktionaryUC62,190set 07, 20092761abr 22, 20131438
Hacı FaiqUC72,063out 01, 20131276out 31, 20131246
Hacı ƏsgərUC81,950nov 01, 20131245nov 30, 20131216
Hacı FətullaUC91,789set 01, 20131306set 30, 20131277
Mirzə MəmmədquluUC101,547ago 01, 20131337ago 31, 20131307
Aabdullayev851UC111,444nov 17, 2015499fev 18, 201740
Lo XimiendoUC121,349nov 22, 20102320fev 07, 201751
Mirza HasanquluUC131,059jun 19, 20131380jul 31, 20131338
SalicynaUC14507fev 07, 20112243ago 25, 20112044
123snake45UC15405mai 11, 20131419nov 26, 2016124
Cekli829UC16351set 15, 20092753dez 31, 201689
Sabri76UC17316jun 20, 20102475dez 12, 2016108
A.VahidUC18243nov 03, 20131243abr 27, 2016337
Octahedron80UC19201jul 06, 2016267ago 19, 2016223
VagoUC20190jul 12, 20102453jul 07, 20112093
Safavi~azwiktionaryUC21185jun 05, 20121759jul 22, 20121712

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 2.912 edições foram feitas por usuários anônimos, de um total de 254.475 edições ( 1e %)
  


23 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC137,309abr 23, 20121802mar 31, 2017---
JAnDbotUC224,314mai 18, 20112143mar 31, 2017---
OctraBotUC320,969ago 12, 2016230mar 31, 2017-55
UT-interwiki-BotUC411,068jul 13, 2016260mar 30, 2017-33
MalafayaBotUC510,413nov 18, 20111959jul 23, 2016250--
Luckas-botUC66,051mar 03, 20092949jan 27, 20141158--
YS-BotUC75,502set 08, 20121664out 19, 2015528--
KamikazeBotUC84,180out 18, 20111990mar 06, 20131485--
VolkovBotUC9972out 01, 20073468abr 05, 20131455--
AvocatoBotUC10631out 31, 20111977ago 25, 20131313--
WikitanvirBotUC11630abr 14, 20112177jan 19, 20121897--
ArthurBotUC12620nov 14, 20102328nov 12, 20111965--
RoggBotUC13443fev 07, 20092973jun 12, 20112118--
SpaceBirdyBotUC14378jul 07, 20083188dez 30, 20092647--
MjbmrbotUC15356jan 18, 20112263mar 28, 20112194--
WarddrBOTUC16300jul 25, 20121709ago 18, 20131320--
RobotGMwiktUC17212jan 09, 20073733jun 06, 20083219--
CarsracBotUC18107out 16, 20092722mai 30, 20131400--
Makecat-botUC1923nov 10, 20121601abr 05, 20131455--
AlexbotUC202fev 24, 20083322fev 24, 20083322--
GhalyBotUC212jan 06, 20131544jan 06, 20131544--
MelancholieBotUC221out 07, 20092731out 07, 20092731--
タチコマ robotUC231jul 28, 2015611jul 28, 2015611--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggSvg
mar 201750 k48344381,8 k23,8 k1      111
fev 201750 k48344381,8 k23,8 k1      111
jan 201749 k48144381,7 k23,8 k1      111
dez 201648 k48144381,7 k23,8 k1      111
nov 201648 k48144381,7 k23,8 k1      111
out 201648 k48044381,7 k23,8 k1      111
set 201648 k47943381,7 k23,8 k1      111
ago 201648 k47643381,7 k23,8 k1      111
jul 201648 k47337361,7 k13,7 k       111
jun 201647 k47337361,7 k13,7 k       111
mai 201646 k47237361,7 k13,7 k       111
abr 201646 k47137361,7 k13,7 k       111
mar 201645 k46937361,6 k13,7 k       111
fev 201644 k46735361,6 k13,6 k       111
jan 201643 k46728351,6 k13,5 k       111
dez 201542 k46628351,6 k13,5 k       111
nov 201541 k46027351,5 k13,3 k       111
out 201540 k45827351,5 k13,1 k       111
set 201539 k45727351,5 k13,1 k       111
ago 201538 k45627351,5 k13,1 k       111
jul 201537 k45527351,5 k12,9 k       111
jun 201536 k45327351,5 k12,8 k       111
mai 201535 k45327351,5 k12,8 k       111
abr 201535 k45227351,5 k12,7 k       111
mar 201533 k45127351,5 k12,6 k      2705111
fev 201532 k45127351,5 k12,6 k      1892111
jan 201531 k44527351,5 k12,6 k      1401111
dez 201430 k44027351,5 k12,6 k      1401111
nov 201429 k43827351,5 k12,6 k      1893111
out 201428 k43427251,5 k12,4 k      21231 1
set 201427 k43327251,5 k12,4 k      23351 1
ago 201426 k42827251,5 k12,3 k      19561 1
jul 201425 k42327251,5 k12,3 k      25481 1
jun 201423 k42227251,5 k12,3 k      43181 1
mai 201422 k42027251,4 k12,1 k      56741 1
abr 201420 k41927251,1 k11,5 k      42831 1
mar 201419 k41627251,1 k11,4 k      23681 1
fev 201417 k41327251,1 k11,4 k      23821 1
jan 201416 k40827251,1 k11,4 k      28481 1
dez 201314 k40227251,1 k11,3 k      22251 1
nov 201313 k40227251,1 k11,2 k      24991 1
out 201312 k39627251,1 k11,2 k      41601 1
set 201310 k39327251,1 k11,1 k      40011 1
ago 20138,6 k37927251,0 k11,1 k      19621 1
jul 20137,3 k37327251,0 k11,1 k      18151 1
jun 20136,5 k36627251,0 k11,0 k      1371 1
mai 20136,5 k36527251,0 k11,0 k      541 1
abr 20136,5 k36327251,0 k11,0 k      281 1
mar 20136,5 k35927251,0 k11,0 k      1461 1
fev 20136,4 k35027251,0 k11,0 k      271 1
jan 20136,4 k34327251,0 k11,0 k      521 1
dez 20126,4 k34027251,0 k11,0 k      531 1
nov 20126,4 k33327251,0 k11,0 k      291 1
out 20126,4 k33127251,0 k11,0 k      131 1
set 20126,4 k32727251,0 k11,0 k      661 1
ago 20126,4 k32127251,0 k11,0 k      3001 1
jul 20126,4 k31727251,0 k11,0 k      2071 1
jun 20126,2 k31427251,0 k11,0 k      711 1
mai 20126,2 k30327251,0 k11,0 k      751 1
abr 20126,2 k29727251,0 k 1,0 k      341 1
mar 20126,2 k29027251,0 k 1,0 k      221 1
fev 20126,2 k28927251,0 k 1,0 k      7821 1
jan 20126,0 k28227251,0 k 1,0 k      14131 1
dez 20115,7 k2772725956 971      12291 1
nov 20115,5 k2722725929 712      3451 1
out 20115,5 k2562725922 689      601 1
set 20115,5 k2502725922 688      531 1
ago 20115,4 k2442725919 688      261 1
jul 20115,4 k2402725918 662      541 1
jun 20115,4 k2322725916 662      321 1
mai 20115,4 k2292725915 659      491 1
abr 20115,4 k2192725914 629      9881 1
mar 20115,1 k2112625903 548      15031 1
fev 20114,7 k2082625868 529      20721 1
jan 20114,1 k1982525828 511      12691 1
dez 20103,5 k1922425814 500      15091 1
nov 20102,9 k1892415751 360      1429  1
out 20102,4 k1852414661 331      1436  1
set 20102,1 k1782414614 313      671  1
ago 20102,0 k17223 4611 312      1045   
jul 20101,9 k15523 4476 312      375   
jun 20101,9 k15423 4431 312      255   
mai 20101,8 k14523 4429 312      325   
abr 20101,8 k14323 4429 312      343   
mar 20101,8 k13923 4429 312      252   
fev 20101,8 k13423 4429 312      189   
jan 20101,8 k13223 4429 312      170   
dez 20091,8 k11923 4428 312      226   
nov 20091,8 k11823 4427 312      242   
out 20091,8 k11423 4427 312      238   
set 20091,8 k11223 4427 312      369   
ago 20091,8 k10522 4426 312      359   
jul 20091,8 k10522 4426 312      269   
jun 20091,8 k10321 4426 312      184   
mai 20091,8 k10121 4425 312      263   
abr 20091,8 k9921 4425 311      377   
mar 20091,8 k9221 4425 311      562   
fev 20091,8 k8920 4425 311      810   
jan 20091,8 k8120 4421 311      294   
dez 20081,7 k7820 4413 289      715   
nov 20081,6 k7620 4347 157      483   
out 20081,4 k6320 1284 97      785   
set 20081,1 k5020 1201 83      696   
ago 20087114918 1186 70      1   
jul 20087084918 1186 70      2   
jun 20087054717 1186 70      28   
mai 20086974217 1184 70      2   
abr 20086964217 1184 70      2   
mar 20086954117 1184 70      1   
fev 20086954017 1184 70      1   
jan 20086954017 1184 70      11   
dez 20076943817 1184 69      35   
nov 20076943617 1184 68      64   
out 20076483517 1182 66      329   
set 20074943117 1175 52      802   
ago 20072262916 1155 20      530   
jul 20071142515 1112 2      30   
jun 20071062515 1112 2          
mai 20071062515 1112 2          
abr 20071052515 1112 2      47   
mar 2007671715 1109 2      5   
fev 2007651615 1109 2      6   
jan 2007611615 1108 2      52   
dez 2006141514 1107 2      1   
nov 2006131514 1106 2          
out 2006131514 1106 2          
set 2006131314 1106 2      6   
ago 2006101212 195 2          
jul 2006101212 195 2          
jun 200691112 194 2      3   
mai 200651110 180 1          
abr 200651110 180 1      1   
mar 200641110 180 1          
fev 200641110 180 1      6   
jan 200621010 180 1      4   
dez 2005255 179            
nov 2005111  78            
out 2005111  78            
set 2005111  78            
ago 2005111  78            
jul 2005111  78            
jun 2005111  78            
mai 2005111  78            
abr 2005111  78            
mar 20051 1  78            
fev 20051 1  78            
jan 20051 1  78            
dez 20041 1  78            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 main Page

jan 2006: 1 1 Ana Səhifə

fev 2006: 1 2 Main Page , 2 2 Ana Səhifə , 3 1 ana Səhifə

abr 2006: 1 1 Azərbaycan dili

jun 2006: 1 1 qartal

set 2006: 1 1 آتا

dez 2006: 1 1 kiçik

jan 2007: 1 1 arzu

fev 2007: 1 1 əl telefonu

mar 2007: 1 1 cənub

abr 2007: 1 1 səyahət

jul 2007: 1 1 armud

ago 2007: 1 2 türkcə , 2 1 köpək

set 2007: 1 2 yaşamaq , 2 1 april

out 2007: 1 2 ülgü , 2 2 görüş , 3 2 qorumaq , 4 1 gül

nov 2007: 1 1 səhra

dez 2007: 1 1 boşqab

jan 2008: 1 1 Moskva

fev 2008: 1 1 türkcə

mar 2008: 1 1 Ana Səhifə

abr 2008: 1 1 виноград

mai 2008: 1 1 August

jun 2008: 1 1 krım tatarca

jul 2008: 1 1 جالگاه

ago 2008: 1 1 Wolf

set 2008: 1 2 afrikaans , 2 2 Afrika dili , 3 2 Qırım Tatarca , 4 2 Ana Səhifə , 5 1 od

out 2008: 1 2 мак , 2 2 ana , 3 1 teatr

nov 2008: 1 2 patlıcan , 2 2 Finlandiya , 3 2 alt , 4 2 Məkkə , 5 2 nənə , 6 2 nar , 7 2 armud , 8 2 Ana Səhifə , 9 1 qovaq

dez 2008: 1 2 ürək , 2 1 fişəng

jan 2009: 1 2 lüğət , 2 2 zər , 3 2 qaynar , 4 1 гусь

fev 2009: 1 2 yarasa , 2 2 Kullanıcı:Mardetanha , 3 1 hörümçək

mar 2009: 1 1 döngə

abr 2009: 1 2 august , 2 1 Азербайджанский язык

mai 2009: 1 3 qozu , 2 3 qoy

jun 2009: 1 2 suiti

jul 2009: 1 2 Arbeit , 2 2 Katze , 3 1 katze

ago 2009: 1 2 птица , 2 2 bayraq , 3 1 mənzərə

set 2009: 1 2 cekcə , 2 2 Cek dili , 3 2 self control

out 2009: 1 2 həftə , 2 1 qapaq

nov 2009: 1 1 qapaq

dez 2009: 1 2 qovun , 2 2 banan , 3 2 Ana Səhifə , 4 1 həftə

jan 2010: 1 2 kəfgir , 2 2 pendir , 3 1 süzgəc

fev 2010: 1 1 page

mar 2010: 1 2 iribaş , 2 2 Kaulquappe

abr 2010: 1 2 skripka , 2 2 saqqal , 3 1 iribaş

mai 2010: 1 2 Ana Səhifə , 2 1 həftə

jun 2010: 1 2 Ellenbogen , 2 2 Ellbogen , 3 2 elbow

jul 2010: 1 2 teleskop , 2 2 hamam , 3 2 tiraj , 4 2 Opponent , 5 2 Cek dili , 6 2 qaşıq , 7 2 günəş , 8 2 Azərbaycan dili

ago 2010: 1 4 evlənmək , 2 3 çalma , 3 3 qızılquş , 4 3 lil , 5 3 öskürək , 6 3 ağartmaq , 7 3 yaralanmamaq , 8 3 konj , 9 3 çiyələk , 10 3 gecə , 11 3 heyva , 12 3 təsirlik , 13 3 ayı , 14 2 cover , 15 2 paxla , 16 2 palto , 17 2 menecer , 18 2 laboratoriya , 19 2 zərf , 20 2 gec , 21 2 kabel , 22 2 küknar , 23 2 yumaq , 24 2 katır , 25 2 qatır

set 2010: 1 2 brom , 2 2 шурин , 3 2 деверь , 4 2 qayın , 5 2 fıstıq , 6 2 золото , 7 2 altun , 8 2 sink , 9 2 mis , 10 2 Kimyəvi elementlərin dövri sistemi , 11 2 arsen , 12 2 мышьяк , 13 2 малахит , 14 2 meruňka , 15 2 кајсија , 16 2 кайсия , 17 2 marelica , 18 2 morela

out 2010: 1 4 sumaq , 2 3 türk , 3 3 yunan , 4 3 zəfər , 5 3 kürü , 6 3 dolma , 7 3 qırxayaq , 8 3 düymələmək , 9 3 yenot , 10 3 γαρύφαλλο , 11 3 nightingale , 12 3 süngü , 13 3 qəssab , 14 3 ekmek , 15 3 mesafe , 16 3 talaşa , 17 3 qonşu , 18 3 ayı , 19 2 верный , 20 2 alman , 21 2 помидор , 22 2 огурец , 23 2 француженка , 24 2 гречанка , 25 2 fransız

nov 2010: 1 3 nəticə , 2 3 yengeç , 3 3 maye , 4 3 ləngitmək , 5 3 yarpaq , 6 3 avokado , 7 3 kəpənək , 8 3 qələbə , 9 3 zoğ , 10 3 лягушка , 11 3 xərçəng , 12 3 üzüm , 13 2 çömçəquyruq , 14 2 otobüslerde , 15 2 domingo , 16 2 ორშაბათი , 17 2 siçovul , 18 2 salı , 19 2 pazartesi , 20 2 şahmatçı , 21 2 vücut , 22 2 safran , 23 2 xəzinə , 24 2 xəstələnmək , 25 2 heykeltıraş

dez 2010: 1 3 təsdiqləmək , 2 2 πάπια , 3 2 Golf , 4 2 valyuta , 5 2 ördəkburun , 6 2 körfəz , 7 2 nərd , 8 2 döymə , 9 2 əzələ , 10 2 solaxay , 11 2 yelkən , 12 2 zürafa , 13 2 nauka , 14 2 tamaşaçı , 15 2 şənbə , 16 2 octopus , 17 2 ördek , 18 2 Aubergine , 19 2 tərəvəz , 20 2 Affe , 21 2 ördək , 22 2 Wolf , 23 1 черепахи

jan 2011: 1 3 üstəgəl , 2 2 vegetasiya , 3 2 diod , 4 2 qovluq , 5 2 söğüt , 6 2 sfenks , 7 2 eyelash , 8 2 tavsiye , 9 2 видишь , 10 2 sevinmək , 11 2 çovğun , 12 2 strategiya , 13 2 velosiped , 14 2 abide , 15 2 sing , 16 2 speak , 17 1 lens

fev 2011: 1 3 barometr , 2 3 balıqçı , 3 3 yaltaqlıq , 4 3 mikrocərrahiyyə , 5 3 səkkiz , 6 3 əl telefonu , 7 3 Ana Səhifə , 8 2 xardal , 9 2 ilə , 10 2 hörük , 11 2 boyun , 12 2 çünki , 13 2 diktor , 14 2 yaltaqlanmaq , 15 2 yaltaq , 16 2 güzəşt , 17 2 külüng , 18 2 zənci , 19 2 qübbə , 20 2 incir , 21 2 on iki , 22 2 on bir , 23 2 dwadzieścia cztery , 24 2 dwadzieścia trzy , 25 2 hər

mar 2011: 1 3 yastıq , 2 3 şaquli , 3 3 üfüqi , 4 3 erkək , 5 3 maraqlı , 6 3 lava , 7 3 yaba , 8 3 hinduşka , 9 3 ovsunlamaq , 10 3 sześćdziesiąt pięć , 11 3 gəmi , 12 3 dekabr , 13 3 noyabr , 14 3 oktyabr , 15 3 sentyabr , 16 3 avqust , 17 2 pääsuke , 18 2 Fərat , 19 2 Dəclə , 20 2 itkin , 21 2 növbə , 22 2 ünsiyyət , 23 2 sərhədçi , 24 2 sahib , 25 2 yiyə

abr 2011: 1 3 cüyür , 2 3 qaratoyuq , 3 3 buket , 4 3 anlamaq , 5 3 ayçiçeği , 6 2 oiseau , 7 2 riyaziyyat , 8 2 eyvan , 9 2 tükətmək , 10 2 xəsis , 11 2 xəta , 12 2 xasiyyət , 13 2 təhqiqat , 14 2 dərs , 15 2 məşğələ , 16 2 təəccüb , 17 2 marş , 18 2 təxmin , 19 2 təhqiq , 20 2 təhdid , 21 2 təhqir , 22 2 tarif , 23 2 tərif , 24 2 izah , 25 2 təfsir

mai 2011: 1 3 Xorvatiya

jun 2011: 1 2 göbələk , 2 2 tərcümə , 3 1 claymore

jul 2011: 1 2 Serbiya , 2 2 Slovakiya , 3 1 çobanyastığı

ago 2011: 1 3 hədəf , 2 1 patlamak

set 2011: 1 2 γκέισα , 2 2 əqrəb , 3 1 kuyu

out 2011: 1 1 oyar

nov 2011: 1 2 maçã , 2 2 renk , 3 2 elma , 4 2 Pluton , 5 2 merkez , 6 2 manzana , 7 2 ailə , 8 2 alma , 9 1 mouse

dez 2011: 1 2 Misir , 2 2 tartaruga , 3 2 uğur , 4 2 krowa , 5 2 ποδήλατο , 6 2 geyinmək , 7 2 hazırlaşmaq , 8 2 vektor , 9 2 mizrab , 10 2 qarğıdalı , 11 2 mühərrik , 12 2 tumurcuq , 13 2 пчела , 14 2 şahmat , 15 1 marzo

jan 2012: 1 3 kenquru , 2 3 osminoq , 3 3 dinozavr , 4 3 arvad , 5 3 gəlin , 6 3 Lixtenşteyn , 7 3 böyürtkən , 8 2 xloroform , 9 2 platinum , 10 2 chloroform , 11 2 chemistry , 12 2 akustik , 13 2 velosipedçi , 14 2 idmançı , 15 2 təyyarəçi , 16 2 dəmir , 17 2 Qana , 18 2 Bosniya və Herseqovina , 19 2 oğul , 20 2 növbə , 21 2 koramal , 22 2 bibioğlu , 23 2 bibiqızı , 24 2 kitabxana , 25 2 tüstü

fev 2012: 1 2 Əskişəhər , 2 2 səhabə , 3 2 həvari , 4 2 mezarlık , 5 2 rəqəm , 6 2 nömrə , 7 1 Naxçıvan

mar 2012: 1 2 Azerbaijan , 2 1 choose

abr 2012: 1 2 arx , 2 1 donna

mai 2012: 1 2 ölkə , 2 1 panno

jun 2012: 1 2 aigua , 2 1 Aserbajdsjan

jul 2012: 1 3 body , 2 2 מים , 3 2 para , 4 2 bed , 5 2 ur , 6 2 Allah , 7 1 böcek

ago 2012: 1 2 Afghanistan , 2 2 əl , 3 1 miercuri

set 2012: 1 1 düğün

out 2012: 1 1 yumruq

nov 2012: 1 2 Versicherung , 2 2 owl , 3 2 Apfel , 4 1 Biləsuvar

dez 2012: 1 2 Cibuti , 2 1 çırpı

jan 2013: 1 2 Əlcəzair , 2 2 kəpənək , 3 1 Yugoslavya

fev 2013: 1 2 yardım , 2 1 xaç

mar 2013: 1 3 dırmıq , 2 3 Xocalı , 3 2 masturbasiya , 4 2 bambuk , 5 2 koreyalı , 6 1 մաստուրբացիա

abr 2013: 1 1 Balakən

mai 2013: 1 1 artmaq

jun 2013: 1 2 rojo , 2 2 axtarmaq , 3 1 hacer

jul 2013: 1 2 ti , 2 2 aimer , 3 2 Zaragoza , 4 2 копчёный , 5 2 fem , 6 2 اندک , 7 2 الان , 8 2 اسم , 9 2 biçmək , 10 2 sombra , 11 2 səbət , 12 2 копьё , 13 2 корзина , 14 2 aqua , 15 2 kingdom , 16 2 krallıq , 17 2 кормить , 18 2 лаваш , 19 2 косой , 20 2 косолапый , 21 2 костёр , 22 2 Stadt , 23 2 vedere , 24 2 vendere , 25 2 venire

ago 2013: 1 2 helado , 2 2 batir , 3 2 mezclar , 4 2 reír , 5 2 moreno , 6 2 кличка , 7 2 suivre , 8 2 başsağlığı , 9 2 qamçı , 10 2 careful , 11 2 birləşmək , 12 2 gün , 13 2 şam , 14 2 candle , 15 2 but , 16 2 Apia , 17 2 Samoa , 18 2 козёл , 19 2 enmək , 20 2 peigne , 21 2 öö , 22 2 yığmaq , 23 2 oğul , 24 2 Braziliya , 25 2 ya

set 2013: 1 3 yırtmaq , 2 3 yanmaq , 3 3 qısa , 4 3 qırıcı , 5 3 acı , 6 3 pəncərə , 7 3 göz , 8 3 qız , 9 3 qara , 10 2 yorğun , 11 2 Dunay , 12 2 qul , 13 2 parıltı , 14 2 balqabaq , 15 2 olmaq , 16 2 dağ , 17 2 bilet , 18 2 vicdansız , 19 2 daha , 20 2 hamilə , 21 2 yordam , 22 2 qiymət , 23 2 window , 24 2 исступлённый , 25 2 истерзать

out 2013: 1 3 ღვინო , 2 3 aldatmaq , 3 2 basdırmaq , 4 2 Maldiv adaları , 5 2 جزر المالديف , 6 2 Qərbi Sahara , 7 2 Batı Sahra , 8 2 Sahara Occidental , 9 2 Алабама , 10 2 planet , 11 2 Nasáu , 12 2 Nassau , 13 2 Нассау , 14 2 махуэ , 15 2 гъэ , 16 2 адэ , 17 2 бзэ , 18 2 пхъэгулъ , 19 2 bura , 20 2 suçlu , 21 2 изменить , 22 2 измениться , 23 2 изменник , 24 2 tutmak , 25 2 rüşvet

nov 2013: 1 2 zəhər , 2 2 yükləmək , 3 2 È un libro , 4 2 звать , 5 2 Dili , 6 2 Doha , 7 2 çağırmaq , 8 2 móðir , 9 2 mor , 10 2 sındırmaq , 11 2 söymək , 12 2 derramar , 13 2 o'ttiz , 14 2 sakkiz , 15 2 yetti , 16 2 besh , 17 2 uch , 18 2 ikki , 19 2 Solomon adaları , 20 2 Solomon Islands , 21 2 məqsəd , 22 2 Valletta , 23 2 qapıçı , 24 2 meyvə , 25 2 düzənlik

dez 2013: 1 2 Məhəmməd , 2 2 Yeni iliniz mübarək! , 3 2 qayə , 4 2 занимательный , 5 2 заниматься , 6 2 заноза , 7 2 заносчивый , 8 2 занятие , 9 2 заочный , 10 2 zabit , 11 2 yük , 12 2 yalan , 13 2 заунывный , 14 2 işğal etmək , 15 2 миндаль , 16 2 şəkər , 17 2 zarafat , 18 2 əməl , 19 2 boran , 20 2 cərimə , 21 2 müdafiəçi , 22 2 ərizə , 23 2 lemon , 24 2 bite , 25 2 Qambiya

jan 2014: 1 3 məna , 2 2 Ərəbistan dənizi , 3 2 bükmək , 4 2 təbiət , 5 2 peyk , 6 2 süni , 7 2 qanacaq , 8 2 hərf , 9 2 əski , 10 2 old , 11 2 əhəmiyyətli , 12 2 əhəmiyyətsiz , 13 2 hürriyyət , 14 2 önemsiz , 15 2 azadlıq , 16 2 etkisiz , 17 2 etkili , 18 2 güncel , 19 2 özgürlük , 20 2 səhv , 21 2 buğ , 22 2 buxar , 23 2 örtülü , 24 2 tədarük , 25 2 tədarük etmək

fev 2014: 1 3 udmaq , 2 2 Кишинёв , 3 2 Chișinău , 4 2 cüt , 5 2 Birləşmiş Ərəb Əmirlikləri , 6 2 cavab , 7 2 cavab vermək , 8 2 parlaq , 9 2 cəllad , 10 2 vergi , 11 2 rapu , 12 2 testa , 13 2 giornale , 14 2 frutto , 15 2 egli , 16 2 dente , 17 2 bambina , 18 2 bambino , 19 2 cambra , 20 2 бал , 21 2 siekiera , 22 1 Irlande

mar 2014: 1 2 Mərkəzi Afrika Respublikası , 2 2 kütlə , 3 2 balet , 4 2 televiziya , 5 2 cin , 6 2 şeytan , 7 2 adi , 8 2 rəf , 9 2 cinayət , 10 2 zəncir , 11 2 qəsəbə , 12 2 vadi , 13 2 qüllə , 14 2 qısa , 15 2 occasion , 16 2 Georgia , 17 2 Türkmənistan , 18 2 vəzifə , 19 2 Bosniya və Herseqovina , 20 2 Gürcüstan , 21 2 yeni , 22 2 bacı , 23 2 Azerbaijan , 24 2 saat , 25 1 бачыць

abr 2014: 1 2 adroit , 2 2 ödəniş , 3 2 abandonner , 4 2 tərk etmək , 5 2 mirvari , 6 2 Xoş gəlmisiniz! , 7 2 əsir , 8 2 sərbəst , 9 2 şüar , 10 2 действие , 11 2 çat , 12 2 daxma , 13 2 azad , 14 2 bölən , 15 2 dərnək , 16 2 varlı , 17 2 buzlaq , 18 2 çalışqan , 19 2 Асмэра , 20 2 Qırmızı dəniz , 21 2 شتر , 22 2 شارب , 23 2 Ostsee , 24 2 Балтыйскае мора , 25 2 İssık-Kul

mai 2014: 1 3 İsveçrə , 2 3 balıq , 3 3 pəncərə , 4 2 Bazel , 5 2 porco , 6 2 abacaxi , 7 2 Düşənbə , 8 2 Pamir , 9 2 jöl , 10 2 vinte , 11 2 Bugarska , 12 2 nida , 13 2 təşəkkür , 14 2 София , 15 2 Кура , 16 2 Augustus , 17 2 Julie , 18 2 Junie , 19 2 Mei , 20 2 Maart , 21 2 Februarie , 22 2 Januarie , 23 2 Desember , 24 2 Παραγουάη , 25 2 Парагвай

jun 2014: 1 3 açmaq , 2 3 çuğundur , 3 2 aprikoos , 4 2 নাক , 5 2 कान , 6 2 কান , 7 2 Шуэц , 8 2 Suécia , 9 2 əjdəha , 10 2 Estocolmo , 11 2 pencər , 12 2 вьюга , 13 2 Belqrad , 14 2 Niş , 15 2 , 16 2 Voyevodina , 17 2 South America , 18 2 Zaltsburq , 19 2 Vyana , 20 2 Wien , 21 2 ящерица , 22 2 Гондурас , 23 2 Tequsiqalpa , 24 2 Portu , 25 2 Berno

jul 2014: 1 2 Minsk , 2 2 çıxıb getmək , 3 2 aýy , 4 2 çıxarış , 5 2 leikur , 6 2 Cotonou , 7 2 Porto-Novo , 8 2 Порто-Ново , 9 2 ბენინი , 10 2 بنين , 11 2 Μπενίν , 12 2 Bénin , 13 2 кафта , 14 2 кьюб , 15 2 zwee , 16 2 duo , 17 2 două , 18 2 lien , 19 2 rate , 20 2 croupe , 21 2 rond , 22 2 dahi , 23 2 constant , 24 2 intérieur , 25 2 génie

ago 2014: 1 2 öpmək , 2 2 qalxan , 3 2 mühasirə , 4 2 xüsusi , 5 1 хьед

set 2014: 1 2 Yunoniston , 2 2 Yunanistan , 3 2 Yunanıstan , 4 1 scarabeo

out 2014: 1 2 coraggioso , 2 2 morrer , 3 2 yazıçı , 4 2 ölmək , 5 2 krava , 6 1 akã

nov 2014: 1 2 sındırmaq , 2 2 bardaq , 3 2 alın , 4 1 rust

dez 2014: 1 2 turp , 2 2 siçan , 3 2 qız , 4 1 беркайчан

jan 2015: 1 2 əbədi , 2 2 tender , 3 2 Burkina-Faso , 4 2 Januari , 5 2 göndərmək , 6 2 Florida , 7 1 mein

fev 2015: 1 2 qayğı , 2 2 завръщам , 3 2 muzey , 4 2 мы , 5 1 mukayyet olmak

mar 2015: 1 2 mərhələ , 2 2 pillə , 3 2 Çukot dənizi , 4 2 femton , 5 2 yağmaq , 6 2 mötəbər , 7 2 kəlləmayallaq , 8 2 etibar , 9 2 etimad , 10 2 ανάμνηση , 11 2 yel , 12 2 vint , 13 2 baldır , 14 2 quinze , 15 2 quince , 16 2 qıf , 17 2 sərhəd , 18 2 musiqi , 19 1 Bukareszt

abr 2015: 1 3 Buxarest , 2 2 rəy , 3 2 Сирия , 4 2 Syria , 5 2 Siria , 6 2 Suriya , 7 2 kar , 8 2 səs , 9 2 Bukarest , 10 2 qarğa , 11 2 on , 12 2 Rumıniya , 13 2 saqqal , 14 1 sizär

mai 2015: 1 2 yollamaq , 2 2 balta , 3 1 claudo

jun 2015: 1 2 tənqid , 2 2 üfunət , 3 2 Oxot dənizi , 4 2 daimi , 5 1 ولادى وستوک

jul 2015: 1 2 ເມກ , 2 2 oğurlamaq , 3 2 təbil , 4 2 arabir , 5 2 tərəfdar , 6 2 xaç , 7 2 yubatmaq , 8 2 ləngimək , 9 2 mən , 10 1 d'abord

ago 2015: 1 3 eşşək , 2 3 gün , 3 3 damcı , 4 3 lüğət , 5 3 quş , 6 3 yumurta , 7 3 qan , 8 2 prijatelj , 9 2 lisica , 10 2 noga , 11 2 strah , 12 2 страх , 13 2 лице , 14 2 káva , 15 2 пес , 16 2 bomull , 17 2 kaffe , 18 2 barn , 19 2 brun , 20 2 əziz , 21 2 Yəmən , 22 2 tikili , 23 2 birə , 24 2 uçmaq , 25 2 vurmaq

set 2015: 1 2 вораг , 2 2 evn , 3 2 dóttir , 4 2 barn , 5 2 Sinqapur , 6 2 koza , 7 2 şəkər , 8 2 fərq , 9 2 kömür , 10 2 vəzifə , 11 2 kəpənək , 12 2 палец , 13 2 barmaq , 14 2 qaçmaq , 15 2 böyük , 16 2 dəqiqə , 17 2 körpü , 18 1 fontaine

out 2015: 1 2 Berinq dənizi , 2 2 vergül , 3 2 urbo , 4 2 gicgah , 5 2 İrkutsk vilayəti , 6 2 nälkä , 7 2 kana , 8 2 erdő , 9 2 okno , 10 2 oheň , 11 2 nepřítel , 12 2 mięso , 13 2 Mósambík , 14 2 hədsiz , 15 2 көрші , 16 2 Mozambique , 17 2 øye , 18 2 เลือด , 19 2 noga , 20 2 лук , 21 2 Atlantik okean , 22 2 med , 23 2 ulu , 24 2 Mozambik , 25 2 kəpənək

nov 2015: 1 3 baba , 2 3 at , 3 2 Anqara , 4 2 addımlamaq , 5 2 vaza , 6 2 Krasnoyarsk , 7 2 Yenisey , 8 2 ortiga , 9 2 görkəmli , 10 2 Qızıl , 11 2 serán , 12 2 Xakasiya , 13 2 tongolo , 14 2 Tıva , 15 2 geydirmək , 16 2 dolaşa , 17 2 Himalay , 18 2 मेंढक , 19 2 अग्नि , 20 2 general , 21 2 işlətmək , 22 2 Katmandu , 23 2 काठमाडौं , 24 2 geyim , 25 2 fərz etmək

dez 2015: 1 3 xəbər almaq , 2 3 tanışmaq , 3 3 bildirmək , 4 3 yaymaq , 5 3 dəvət etmək , 6 3 bumbac , 7 3 Kirsche , 8 3 ət , 9 2 unga , 10 2 пынцӏа , 11 2 myydä , 12 2 ажвар , 13 2 ажва , 14 2 manqo , 15 2 Mango , 16 2 Maulbeere , 17 2 Feige , 18 2 Avocado , 19 2 Himbeere , 20 2 Erdbeere , 21 2 Pflaume , 22 2 Hartriegel , 23 2 аща , 24 2 Pfirsich , 25 2 Traube

jan 2016: 1 2 florero , 2 2 tóc , 3 2 vườn , 4 2 rừng , 5 2 vàng , 6 2 chúa , 7 2 yêu , 8 2 Cộng hòa Altai , 9 2 yoğurmaq , 10 2 aran , 11 2 Malaysia , 12 2 Milbe , 13 1 pashsha

fev 2016: 1 3 pomidor , 2 2 oilo , 3 2 Província de Tiumen , 4 2 zahid , 5 2 Linie , 6 2 aclıq , 7 2 Səudiyyə Ərəbistanı , 8 2 tomat , 9 2 həqiqət , 10 2 Peru , 11 2 ananas , 12 2 ordu , 13 2 ağac , 14 2 bal , 15 1 Samanyolu

mar 2016: 1 2 кодзувкот , 2 2 dördüncü , 3 2 ӕврагъ , 4 2 so , 5 2 aclıq , 6 2 alqoritm , 7 2 Səudiyyə Ərəbistanı , 8 2 qulaq , 9 2 tanrı , 10 2 burun , 11 2 körpü , 12 2 keçi , 13 2 çörək , 14 2 inək , 15 2 qarışqa , 16 2 qarğa , 17 2 dörd , 18 2 saat , 19 2 ailə , 20 1 earm

abr 2016: 1 2 quyosh , 2 2 òspiti , 3 2 virdi , 4 2 oru , 5 2 Afgʻoniston , 6 2 академия , 7 2 εννοώ , 8 2 perkele , 9 2 tulla , 10 2 větev , 11 2 rzęsa , 12 2 корыч , 13 2 paygʻambar , 14 2 isimanna , 15 2 Gürcüstan Demokratik Respublikası , 16 2 gümüş , 17 2 artist , 18 2 düyün , 19 2 Afghanistan , 20 2 akasiya , 21 2 ip , 22 2 kirpik , 23 2 Adriatik dənizi , 24 2 turp , 25 2 mürəbbə

mai 2016: 1 2 swine , 2 2 frère , 3 2 birə , 4 2 yer , 5 2 hamar , 6 2 gün , 7 2 qəzet , 8 2 dəmir , 9 2 ip , 10 2 lüğət , 11 2 barmaq , 12 2 donuz , 13 2 böyrək , 14 2 bayquş , 15 2 axşam , 16 2 yeni , 17 2 üz , 18 2 qulaq , 19 2 soğan , 20 2 açar , 21 2 balıq , 22 2 düşmən , 23 2 burun , 24 2 göz , 25 2 bulud

jun 2016: 1 2 מרקש , 2 2 Gelenk , 3 2 Mərakeş , 4 2 həşərat , 5 2 ip , 6 2 qamış , 7 2 bayquş , 8 2 qulaq , 9 2 bibər , 10 2 çay , 11 2 pələng , 12 1 Нижнекамск

jul 2016: 1 2 balıq , 2 1 Ergänzung

ago 2016: 1 3 cegonha , 2 3 gift , 3 3 regn , 4 2 иззад , 5 2 yipek , 6 2 καίω , 7 2 κάθομαι , 8 2 κακός , 9 2 Басра , 10 2 Karbalo , 11 2 الرمادي , 12 2 cauda , 13 2 allenamento , 14 2 affogare , 15 2 Petroskoi , 16 2 ais , 17 2 saniye , 18 2 kümüş , 19 2 kartof , 20 2 mevsim , 21 2 causa , 22 2 a , 23 2 oğul , 24 2 ip , 25 2 gemi

set 2016: 1 1 amoj

out 2016: 1 1 's Hertogenbosch

nov 2016: 1 2 kompas , 2 1 Glas

dez 2016: 1 2 badımcan , 2 1 Topara

jan 2017: 1 2 Klee , 2 2 göz , 3 2 dörd , 4 2 it , 5 1 kiore

fev 2017: 1 2 βροχή , 2 2 dolu , 3 1 pohled

mar 2017: 1 1 what

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 24 de abril 2017 13:30

Dump file azwiktionary-20170401-stub-meta-history.xml.gz (edits only), size 18 Mb as gz -> 139 Mb
Dump processed till Mar 31, 2017, on server stat1002, ready at Sun-09/04/2017-04:58 after 2 min, 2 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.