Estatísticas da Wikcionário bielorrusso

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wiktionary bielorrusso

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2018
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mar 2018+4%   0%          +1%
dez 20170%   0%          +1%
nov 2017+4%   0%          0%
out 20170%   0%          +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 20182711 3,8 k 8,4 14      178
fev 201826   3,8 k 8,4 3      176
jan 201826 1 3,8 k 8,4 11      176
dez 201726   3,8 k 8,4 2      176
nov 20172611 3,8 k 8,4 14      175
out 201725   3,8 k 8,4 7      175
set 201725   3,8 k 8,4 6      174
ago 201725   3,8 k 8,4 4      173
jul 201725   3,8 k 8,4 10      173
jun 201725   3,8 k 8,4 4      173
mai 201725 2 3,8 k18,4 44      173
abr 201725 2 3,8 k48,5 3,7 k      172
mar 201725 113,7 k37,7 436      172
fev 20172511 3,6 k17,8 414      172
jan 201724   3,5 k 7,8 209      172
dez 201624 1 3,5 k 7,7 72      172
nov 201624   3,5 k 7,7 50      172
out 201624 1 3,5 k 7,7 218      172
set 201624 2 3,5 k17,6 273      172
ago 201624   3,5 k 7,6 1,0 k      172
jul 20162412 3,5 k 7,3 180      172
jun 20162311 3,5 k 7,3 125      172
mai 201622 1 3,5 k17,2 154      171
abr 201622 1 3,5 k 7,2 90      171
mar 20162211 3,5 k 7,2 112      171
fev 201621   3,5 k 7,2 12      163
jan 201621   3,5 k 7,2 34      163
dez 201521 1 3,5 k 7,2 289      163
nov 201521   3,4 k 7,1 119      163
out 201521 1 3,4 k 7,1 239      163
set 201521   3,4 k 7,1 151      163
ago 20152111 3,4 k 7 213      163
jul 201520   3,4 k 7 107      163
jun 201520   3,4 k 6,9 1,3 k      163
mai 201520   3,4 k 6,6 201      162
abr 201520 2 3,4 k16,5 267      162
mar 201520 1 3,4 k 6,54141354,7 Mb247 k10 k48 k1545161
fev 201520 1 3,4 k 6,4413534,7 Mb247 k10 k48 k1545161
jan 201520 1 3,4 k 6,4412664,7 Mb246 k10 k47 k1545161
dez 201420 113,4 k46,44122314,7 Mb245 k10 k47 k1545161
nov 201420 1 3,3 k 6,6413284,5 Mb238 k10 k47 k1545161
out 201420 2 3,2 k 6,64131804,5 Mb237 k10 k47 k1545161
set 201420   3,2 k 6,64133854,5 Mb236 k10 k47 k1545160
ago 201420 1 3,2 k 6,54121694,5 Mb235 k10 k45 k1545160
jul 201420   3,2 k 6,4413644,5 Mb235 k10 k44 k1545160
jun 201420 1 3,2 k26,4413964,5 Mb235 k10 k44 k1545160
mai 20142011 3,2 k 6,5414544,4 Mb230 k10 k44 k1545160
abr 201419 1 3,1 k16,5412444,4 Mb229 k9,9 k44 k1545160
mar 201419 1 3,1 k16,6410574,3 Mb226 k9,8 k44 k1544160
fev 201419   3,1 k 6,6410694,3 Mb224 k9,7 k44 k1544160
jan 201419 1 3,1 k 6,6410574,3 Mb224 k9,7 k44 k1544160
dez 201319 1 3,1 k16,64101,8 k4,3 Mb224 k9,7 k43 k1544160
nov 201319   3,0 k 6,1408664,1 Mb220 k9,6 k37 k1544160
out 201319   3,0 k 6407994,1 Mb220 k9,6 k37 k1543160
set 201319 1 3,0 k 6407184,1 Mb219 k9,6 k36 k1441160
ago 201319 113,0 k1364066364,1 Mb218 k9,5 k36 k1341160
jul 201319   2,6 k 6,74082073,6 Mb190 k8,6 k34 k1340160
jun 20131911 2,6 k16,64071833,6 Mb190 k8,6 k34 k1338160
mai 201318 2 2,6 k 6,64083403,5 Mb189 k8,6 k34 k1338160
abr 201318 2 2,6 k 6,54071633,5 Mb188 k8,5 k34 k1320159
mar 201318 1 2,6 k16,54041913,5 Mb186 k8,3 k33 k1319159
fev 201318   2,6 k 6,54041813,4 Mb183 k8,2 k33 k1314159
jan 201318   2,6 k 6,44043593,4 Mb184 k8,2 k33 k1314159
dez 201218 1 2,6 k 6,34031993,4 Mb183 k8,2 k32 k1210159
nov 201218   2,5 k 6,24031193,4 Mb182 k8,1 k32 k1210159
out 201218   2,5 k 6,24023973,4 Mb182 k8,1 k32 k1010159
set 201218 1 2,5 k164014463,4 Mb182 k8,1 k31 k98159
ago 201218   2,5 k 63963713,3 Mb177 k8,0 k31 k77159
jul 201218 112,5 k35,83963403,3 Mb176 k8,0 k30 k77159
jun 201218 1 2,4 k 5,93992693,2 Mb171 k7,8 k30 k67159
mai 2012181212,4 k45,83984953,2 Mb169 k7,7 k29 k36159
abr 201217 1 2,3 k15,93992183,0 Mb162 k7,5 k29 k36158
mar 201217 1 2,2 k 5,93942083,0 Mb158 k7,4 k28 k36157
fev 20121711 2,2 k15,83922,3 k3,0 Mb157 k7,3 k28 k36157
jan 201216 1 2,2 k24,83772612,9 Mb145 k5,1 k27 k26156
dez 201116   2,1 k 4,93754532,8 Mb140 k4,9 k27 k22156
nov 201116 1 2,1 k14,73752662,8 Mb140 k4,9 k26 k11156
out 201116 1 2,1 k14,63749762,8 Mb139 k4,8 k26 k11156
set 201116   2,1 k 4,23731132,7 Mb137 k4,8 k24 k11156
ago 201116 3 2,1 k24,13732442,7 Mb137 k4,8 k24 k11156
jul 201116   2,0 k 4,1371962,6 Mb132 k4,5 k24 k11153
jun 201116 1 2,0 k14,13693402,6 Mb132 k4,3 k23 k11153
mai 201116 1 2,0 k343692552,6 Mb130 k4,3 k23 k11152
abr 201116   1,9 k 43681702,5 Mb124 k4,2 k22 k11152
mar 201116 1 1,9 k13,93681902,5 Mb124 k4,2 k22 k11152
fev 20111611 1,9 k 3,93691952,4 Mb123 k4,2 k22 k11152
jan 201115 111,9 k93,83666842,4 Mb121 k4,2 k21 k11151
dez 201015 1 1,6 k143722532,1 Mb105 k3,7 k19 k11150
nov 201015 2 1,6 k33,93721792,1 Mb104 k3,7 k19 k11150
out 201015 221,5 k343783912,0 Mb99 k3,6 k19 k11150
set 201015 221,4 k543775191,8 Mb92 k3,3 k17 k11149
ago 2010151211,3 k24,13822951,6 Mb82 k3,2 k16 k11149
jul 201014 321,2 k44,13844351,6 Mb78 k3,1 k15 k11149
jun 2010141621,1 k64,13825381,4 Mb70 k2,9 k14 k11149
mai 201013 2288964,33755551,2 Mb57 k2,7 k12 k 1147
abr 201013132688184,83661,4 k913 kb43 k2,2 k9,4 k 1147
mar 20101212 163 1217922119 kb4,3 k3712,3 k11147
fev 201011 1 159 12,116223109 kb3,7 k3482,3 k11147
jan 201011 1 157 12,115717106 kb3,5 k3342,3 k11147
dez 20091112 157 1215740106 kb3,5 k3342,2 k11147
nov 200910 1 157 11,81572395 kb3,5 k3332,2 k11134
out 200910 1 157 11,61576195 kb3,5 k3332,2 k11134
set 200910 1 157 11,21586794 kb3,5 k3332,1 k11134
ago 200910 1 155 10,91603693 kb3,5 k3332,0 k11134
jul 200910 1 155 10,71601693 kb3,5 k3332,0 k11134
jun 200910 1 155 10,61604792 kb3,5 k3332,0 k11134
mai 200910 1 155 10,31604392 kb3,5 k3332,0 k11133
abr 20091012 155 101606392 kb3,5 k3332,0 k11133
mar 20099 2 154 9,71434884 kb3,0 k3202,0 k11133
fev 20099111150 9,613610379 kb2,7 k2861,9 k11133
jan 20098   150 8,91361175 kb2,7 k2861,6 k11133
dez 20088   149 8,9136475 kb2,7 k2831,6 k11133
nov 20088   149 8,91361974 kb2,7 k2831,6 k11133
out 20088   149 8,8136274 kb2,7 k2831,6 k11133
set 20088   149 8,7136674 kb2,7 k2821,6 k11133
ago 20088   149 8,71361974 kb2,7 k2821,6 k11133
jul 20088   149 8,6136673 kb2,7 k2821,5 k11133
jun 20088 1 149 8,51362973 kb2,7 k2821,5 k11133
mai 20088   145 8,61395772 kb2,7 k2821,5 k11133
abr 20088   145 8,21391369 kb2,7 k2811,3 k11133
mar 2008811 14518,113912167 kb2,7 k2811,1 k11133
fev 20087   103 10,21591258 kb2,1 k2341,1 k1192
jan 20087   103 10,11592258 kb2,1 k2341,1 k1192
dez 20077   103 9,91593157 kb2,1 k2341,0 k1192
nov 20077   103 9,6159156 kb2,1 k2329891192
out 20077   103 9,61591056 kb2,1 k2329881192
set 20077   103 9,5158256 kb2,1 k2319751192
ago 20077   103 9,5158356 kb2,1 k2319731192
jul 20077   103 9,41583156 kb2,1 k2319661192
jun 20077   103 9,1166558 kb2,3 k2639301192
mai 20077   103 9,11664158 kb2,3 k2639241192
abr 2007723 103 8,716611057 kb2,3 k2638711192
mar 2007511 99 7,91263545 kb1,7 k48921 190
fev 20074   98 7,61255045 kb1,7 k48897 190
jan 20074   95 7,41285443 kb1,6 k48835 190
dez 20064   95 6,81271542 kb1,6 k48793 190
nov 20064   95 6,61271542 kb1,6 k48781 190
out 20064   95 6,51267241 kb1,6 k48766 190
set 20064   94 5,81165339 kb1,5 k40736 190
ago 20064   94 5,2116238 kb1,5 k40629 190
jul 20064   92 5,3116337 kb1,4 k40618 190
jun 20064   91 5,31178137 kb1,4 k40616 190
mai 2006411 91 4,41506829 kb1,4 k4097 190
abr 20063   91 3,7384326 kb8284093 190
mar 20063   90 3,7416 25 kb7663990 190
fev 200632229033,741630725 kb7663990 190
jan 20061   1 26726 5,3 kb2811164  1
dez 20051   1 2672655,3 kb2811164  1
nov 20051   1 21694 3,8 kb275135  1
out 20051   1 21694 3,8 kb275135  1
set 20051   1 21694183,8 kb275135  1
ago 200511  1 3983193 12 6   
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201878 73 100 28 85      147
out 201777   100 29 82      147
jul 201774   99 29 79      147
abr 201773 52 994021 59      147
jan 201775   99 28 96      147
out 201675 68 99 29 83      147
jul 2016734257 99 33 97      147
abr 201681 70 99 33 84      147
jan 201681   97 34 110      147
out 201576 80 96 35 91      147
jul 201582   96 37 108      147
abr 201581 63 966438 86      147
jan 2015783772439658382297807987859583147
out 2014774055469562372476797886829582147
jul 2014773483489557372596797886839582147
abr 2014763173489457372589787885829582147
jan 2014764279499259382697747483819481147
out 2013754379469261392577757382839581147
jul 2013753982519164342580767682839680147
abr 2013753658519165382579767481829687147
jan 2013754582549167392382757380829492147
out 2012713682498964432277737279799997147
jul 201271528450875146227671717978103102147
abr 201272397152876244237872728176118105147
jan 201275357150855455257770738675116104147
out 201174428249856556246170708372123123147
jul 201173448349857064258269708271122121147
abr 201170338445856167257871708271121119147
jan 201173357148843666255369708071121119147
out 201072377346844564236871708172118119147
jul 201070455749874361237273738274117118147
abr 201072475645922689894781868682119118147
jan 2010763310677113618585119108114115103114118147
out 20097941100791115684849110611111399112118147
jul 2009764010281109598282114105111112100111117147
abr 2009734669781095379798810511111098110116147
jan 20097861834210859777710110610910996108117147
out 20087736754310663777711110510910790107117146
jul 20087232734610359757511410410810587105115146
abr 2008694279491016471719310110610387106112146
jan 2008744377511025968689010210410286103111146
out 20077042765099636464971001031018598112146
jul 200766457644975964648696101988396109145
abr 20076223354790616161729398948390107145
jan 200787508446866655558890961027383100145
out 2006824067437952505070819198667596145
jul 2006774169387453464695798696616394145
abr 20068339553565494242787483921005590145
jan 20061114861341124137371119595102584592137
out 200510434512610336323279898796704183121
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
mar 20183111      2     2111111   
fev 20183        1     5         
jan 2018321             1         
dez 20171        1     11        
nov 20172111            11111     
out 20175                        
set 20173              21        
ago 20173              1         
jul 20175              2      221
jun 20172        1     2111      
mai 201733211           2         
abr 201732222 33111     52221  22 
mar 2017211111 332       42222  1  
fev 201711111 431       422211 11 
jan 201731   321       2221   1  
dez 2016111   22  2     11     1  
nov 2016     42        22     1  
out 20164211  311 1     21     22 
set 201622211 321       21     11 
ago 20161    331 11    32     11 
jul 20163221  33        5111   111
jun 2016221   22        2      11 
mai 201621111 22  1     1111      
abr 20162111  22        2         
mar 201611111 11        5      11 
fev 201621   1                   
jan 201611   22        1      11 
jan 2018321             1         
out 20175                        
jul 20175              2      221
abr 201732222 33111     52221  22 
jan 201731   321       2221   1  
out 20164211  311 1     21     22 
jul 20163221  33        5111   111
abr 20162111  22        2         
jan 201611   22        1      11 
out 2015211   331       211    21 
jul 20151    33  1     2      11 
abr 201532211 331     2252221  111
jan 2015111   33  11    21     111
out 2014322   111       311    1  
jul 201411   22        211       
abr 20141111  21        5         
jan 20141111  22  1     41     11 
out 20131    11  1     31        
jul 20131    221       61111  11 
abr 2013222   111 1     511    111
jan 20131    621              11 
out 2012     321 1     51     111
jul 2012111111 421       511    11 
abr 201211111 54  11    53211  11 
jan 201211111 631       3111   211
out 20113111  441 3     5      11 
jul 201111   33        31     11 
abr 20112    321       321    11 
jan 20112111111431       51111  11 
out 20104322221          62221  11 
jul 20105332221          21111     
abr 20103333222    3322  54221111  
jan 20101111      1     2111      
out 200911111           3         
jul 20091111      2     3         
abr 200932222     2     4332211   
jan 2009     1         111    11 
out 20081        1     522       
jul 2008               1         
abr 2008     11        1         
jan 2008     11  2     3         
out 2007     1   3     3         
jul 20071    11        1      1  
abr 200763322 11  1     42222     
jan 2007     11                  
out 2006     11        21        
jul 20061              1         
abr 200611       1               
jan 2006         3     6211      
out 2005                         

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
192100.0%8,222100.0%
34245.7%8,14499.1%
102628.3%8,05998.0%
321415.2%7,85195.5%
10077.6%7,47190.9%
31622.2%6,68381.3%
100022.2%6,68381.3%
316211.1%3,68344.8%

 

3 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Al SilonovUC1 03,68312,068-mar 28, 200932893,302-1,631-
Vit KozUC11+1361311-jan 15, 201680561279-
OlegCinemaUC24+671211611609fev 23, 20183565205204

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC23,000fev 01, 20093344nov 08, 20102699
DevyanostikUC3271jan 19, 2017435out 15, 2017166
BooxterUC4125fev 01, 20064440fev 03, 20064438
ХомелкаUC5108fev 24, 20122226mai 11, 20131784
VesailokUC6104mar 28, 20093289out 30, 20141247
PradslavaUC794mar 15, 20083667mar 21, 20083661
Ellis NovakUC880mai 24, 20131771jun 21, 20131743
KubaroUC964mai 04, 20064348mai 16, 20064336
MienskiUC1037abr 23, 20073994abr 24, 20073993
LA2UC1236mar 23, 2016737out 01, 2017180
Sankoff64UC1333out 20, 20141257fev 13, 201845
MaximLitvinUC1431abr 22, 20073995abr 24, 20073993
CarsracUC1524dez 04, 20093038dez 04, 20093038
Vedac13UC1624mai 11, 20141419mai 11, 20141419
ZuiarraUC1721ago 28, 20112406jan 22, 2017432
Yellow~bewiktionaryUC1820jun 20, 20102840jun 21, 20102839
DryhvaUC1915mar 28, 20074020mar 30, 20074018
MalafayaUC2014out 07, 20083461jun 10, 20102850
Amire80UC2113ago 26, 2015947ago 30, 2015943
IlyankouUC2212fev 21, 20112594fev 21, 20112594

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 174 edições foram feitas por usuários anônimos, de um total de 32069 edições ( 0e %)
  


22 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC19,005abr 24, 20122166abr 28, 2017336--
Luckas-botUC23,340set 04, 20102764jan 27, 20141523--
JAnDbotUC32,673mai 18, 20112508mar 16, 2017379--
ХомоБотUC41,969fev 24, 20122226fev 27, 20122223--
OctraBotUC51,555ago 25, 2016582abr 24, 2017340--
KamikazeBotUC61,408out 18, 20112355mar 07, 20131849--
UT-interwiki-BotUC7841jul 14, 2016624abr 17, 2017347--
YS-BotUC8640set 07, 20122030out 18, 2015894--
ArthurBotUC9548jan 04, 20112642nov 12, 20112330--
RobotGMwiktUC10504jun 23, 20064298mai 30, 20083591--
VolkovBotUC11297jul 13, 20073913mar 23, 20131833--
WikitanvirBotUC12257abr 16, 20112540jan 19, 20122262--
AvocatoBotUC13220nov 01, 20112341ago 27, 20131676--
RoggBotUC14147jun 16, 20093209fev 26, 20112589--
WarddrBOTUC15126jul 25, 20122074ago 17, 20131686--
SpaceBirdyBotUC1655jun 27, 20083563dez 01, 20083406--
MjbmrbotUC1753jan 23, 20112623mar 28, 20112559--
CarsracBotUC1824mar 17, 20112570mai 19, 20131776--
Makecat-botUC194nov 10, 20121966abr 05, 20131820--
AvicBotUC203jul 30, 20112435ago 28, 20112406--
AlexbotUC212fev 24, 20083687fev 24, 20083687--
タチコマ robotUC222mai 27, 20122133mai 27, 20122133--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
mar 20184,0 k40853 451,2 k11,5 k       
fev 20184,0 k40842 111,1 k11,5 k       
jan 20184,0 k40542 111,1 k11,5 k       
dez 20174,0 k40542 111,1 k11,5 k       
nov 20174,0 k40342 111,1 k11,5 k       
out 20174,0 k40342 111,1 k11,5 k       
set 20174,0 k40342 111,1 k11,5 k       
ago 20174,0 k40342 111,1 k11,5 k       
jul 20174,0 k40242 111,1 k11,5 k       
jun 20174,0 k40242 111,1 k11,5 k       
mai 20174,0 k40142 111,1 k11,5 k       
abr 20173,9 k40142 111,1 k11,5 k       
mar 20173,8 k40042 111,1 k11,4 k       
fev 20173,7 k39942 111,1 k11,3 k       
jan 20173,7 k39742 111,1 k11,2 k       
dez 20163,7 k39742 111,1 k11,1 k       
nov 20163,7 k39742 111,1 k11,1 k       
out 20163,7 k39742 111,1 k11,1 k       
set 20163,7 k39742 111,1 k11,1 k       
ago 20163,7 k39642 111,1 k11,1 k       
jul 20163,7 k39542 111,1 k11,1 k       
jun 20163,7 k39542 111,1 k11,1 k       
mai 20163,7 k39542 111,1 k11,1 k       
abr 20163,6 k39542 111,0 k11,1 k       
mar 20163,6 k39542 111,0 k11,1 k       
fev 20163,6 k39442 111,0 k11,1 k       
jan 20163,6 k39442 111,0 k11,1 k       
dez 20153,6 k39442 111,0 k11,1 k       
nov 20153,6 k39042 111,0 k11,1 k       
out 20153,6 k38842 111,0 k11,1 k       
set 20153,6 k38842 111,0 k11,1 k       
ago 20153,6 k38742 111,0 k11,1 k       
jul 20153,6 k38642 111,0 k11,1 k       
jun 20153,6 k38542 111,0 k11,1 k       
mai 20153,6 k38542 111,0 k11,1 k       
abr 20153,6 k38442 111,0 k11,1 k       
mar 20153,6 k38242 111,0 k11,1 k      7
fev 20153,6 k38242 111,0 k11,1 k      7
jan 20153,5 k37842 111,0 k11,1 k      9
dez 20143,5 k37642 111,0 k11,1 k      120
nov 20143,4 k37642 111,0 k11,1 k      15
out 20143,4 k37542 111,0 k11,1 k      15
set 20143,4 k37442 111,0 k11,1 k      1
ago 20143,4 k36942 111,0 k11,1 k      7
jul 20143,4 k36642 111,0 k11,1 k      3
jun 20143,4 k36642 111,0 k11,1 k      71
mai 20143,3 k36442 111,0 k11,1 k      29
abr 20143,3 k36442 111,0 k11,1 k      24
mar 20143,3 k36142 111,0 k11,1 k      28
fev 20143,3 k35842 111,0 k11,0 k       
jan 20143,3 k35342 111,0 k11,0 k      11
dez 20133,3 k35042 111,0 k11,0 k      45
nov 20133,2 k35042 1199811,0 k       
out 20133,2 k34542 1199811,0 k      2
set 20133,2 k34242 1199811,0 k      13
ago 20133,2 k32942 1199611,0 k      418
jul 20132,8 k32542 1196411,0 k      1
jun 20132,8 k32042 119641993      73
mai 20132,8 k31942 119641991      18
abr 20132,8 k31742 119641990      10
mar 20132,8 k31242 119591990      45
fev 20132,7 k30542 119591990       
jan 20132,7 k29742 119591990      1
dez 20122,7 k29642 119591990      7
nov 20122,7 k29042 119591990       
out 20122,7 k29042 119591990       
set 20122,7 k28742 119591990      46
ago 20122,7 k28242 119581990      4
jul 20122,7 k27842 119581990      104
jun 20122,6 k27642 119561984      15
mai 20122,5 k26642 119561984      125
abr 20122,4 k26142 119541982      27
mar 20122,4 k25542 119521938      19
fev 20122,4 k25342 119511938      99
jan 20122,4 k24441 119491938      71
dez 20112,3 k24241 119461935      4
nov 20112,3 k23841 119431935      20
out 20112,3 k22541 119421935      26
set 20112,3 k22041 119421935      6
ago 20112,3 k21641 119421932      86
jul 20112,2 k20941 119381928      3
jun 20112,2 k20041 119381928      43
mai 20112,2 k19741 119361922      85
abr 20112,1 k19241 119301913      3
mar 20112,1 k18541 119301913      26
fev 20112,1 k18541 119261901      19
jan 20112,0 k17941 119251901      278
dez 20101,8 k17341 119161867      17
nov 20101,8 k17141 119131861      170
out 20101,7 k16641 108981820      388
set 20101,6 k16341 108851782      510
ago 20101,4 k15641 108581727      294
jul 20101,3 k14141 108461699      433
jun 20101,2 k14041 108271648      535
mai 20101,0 k12940 107621562      541
abr 201083512740 106711480      1359
mar 201031011837 1462182      21
fev 201030611537 1455177      23
jan 201030411237 1451177      17
dez 200930410237 1451177      40
nov 200929110036 1451177      21
out 20092919836 1451177      61
set 20092919536 1451177      63
ago 20092899136 1451177      36
jul 20092899036 1451177      16
jun 20092898936 1451177      34
mai 20092888536 1450177      43
abr 20092888336 1450177      63
mar 20092877636 1212170      46
fev 20092837335 1105169      103
jan 20092836735 1105169       
dez 20082826735 1105169       
nov 20082826735 1105169       
out 20082825435 1105 69      1
set 20082824335 1105 69       
ago 20082824335 1105 69       
jul 20082824235 1105 69       
jun 20082824235 1105 69      7
mai 20082783634 1105 69      1
abr 20082783334  104 69       
mar 20082783234  104 69      94
fev 20081953134  97 23       
jan 20081953134  97 23       
dez 20071952934  97 23       
nov 20071952734  97 23       
out 20071952734  95 23       
set 20071952433  94 23       
ago 20071952432  93 23       
jul 20071952332  93 23      1
jun 20071952232  92 23       
mai 20071952132  92 23       
abr 20071952132  92 23      78
mar 20071891831  62 1      18
fev 20071881831  57 1       
jan 20071851731  57 1       
dez 20061851731  57 1       
nov 20061851731  57 1      2
out 20061851731  57 1       
set 20061841531  54 1       
ago 20061841431  54 1       
jul 20061821331  54 1      2
jun 20061811231  54 1       
mai 20061811131  54 1      64
abr 20061811131  40         
mar 20061801131  40         
fev 20061801131  40         
jan 20062103  19         
dez 2005241  4         
nov 2005211  3         
out 2005211  3         
set 2005211  3         
ago 2005111            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 галоўная старонка

fev 2006: 1 2 acoustic , 2 1 Мова

abr 2006: 1 1 радзіма

mai 2006: 1 1 радзіма

jul 2006: 1 1 raven

nov 2006: 1 1 index л

mar 2007: 1 1 карова

abr 2007: 1 3 верасень , 2 3 радзіма , 3 2 малако , 4 2 год , 5 2 жнівень , 6 2 абсент , 7 1 index:й

jul 2007: 1 1 Main Page

mar 2008: 1 1 らじお

mai 2008: 1 1 Main Page

jun 2008: 1 1 Їжа

out 2008: 1 1 мова

fev 2009: 1 1 football

mar 2009: 1 3 абажур , 2 2 курыца , 3 1 венгерская

abr 2009: 1 2 год , 2 2 мова , 3 1 эсперанта

mai 2009: 1 2 год , 2 1 football

jun 2009: 1 1 Main page

jul 2009: 1 1 венгерская

ago 2009: 1 1 林檎

set 2009: 1 1 duck

out 2009: 1 1 duck

nov 2009: 1 1 football

dez 2009: 1 1 Маскаль

jan 2010: 1 1 duck

fev 2010: 1 2 езуіт , 2 2 accounting

mar 2010: 1 2 папка , 2 2 омметр , 3 1 белый

abr 2010: 1 3 mudel , 2 3 панядзелак , 3 3 красавік , 4 3 вайна , 5 3 воўк , 6 2 پنیر , 7 2 keuz , 8 2 Käse , 9 2 ġobon , 10 2 pendir , 11 2 брынзэ , 12 2 brânză , 13 2 পনির , 14 2 पनीर , 15 2 sýr , 16 2 juust , 17 2 caseus , 18 2 siers , 19 2 sūris

mai 2010: 1 2 об , 2 2 vatn , 3 2 wetter , 4 2 su , 5 2 पाणी , 6 2 лъим , 7 2 woda , 8 2 água , 9 2 һыу

jun 2010: 1 4 смоўж , 2 4 бусел , 3 3 ялавічына , 4 3 бурштын , 5 3 рэпілент , 6 3 валапюк , 7 2 spegel , 8 2 , 9 2 күзгү , 10 2 거울

jul 2010: 1 3 ідыш , 2 3 Маскаль , 3 2 saqaf , 4 2 леведыш

ago 2010: 1 2 serigala , 2 2 борз , 3 2 úlvur

set 2010: 1 2 túbig , 2 2 , 3 2 шыв , 4 2 dowr

out 2010: 1 3 laberint , 2 2 qar , 3 2 sněh

nov 2010: 1 1 fromazy

dez 2010: 1 1 hukarere

jan 2011: 1 1 мед

fev 2011: 1 2 абавязак , 2 2 аазіс , 3 1 ладдзя

mar 2011: 1 1 மணல்

abr 2011: 1 1 история

mai 2011: 1 2 архитектура , 2 1

jun 2011: 1 1 ком

jul 2011: 1 1 месяц

ago 2011: 1 3 альфа , 2 2 кулак , 3 2 Бета

set 2011: 1 1 اسم

out 2011: 1 1 alatsinainy

nov 2011: 1 1 кніга

dez 2011: 1 2 збройні сили

jan 2012: 1 1 прагрэс

fev 2012: 1 1 некалькі

mar 2012: 1 2 сколько , 2 2 колькі , 3 1 абрус

abr 2012: 1 1 кавалак

mai 2012: 1 2 urtxintxa , 2 1 hartz

jun 2012: 1 1 baraf

jul 2012: 1 1 гургум

ago 2012: 1 1 вуха

set 2012: 1 1 зародак

dez 2012: 1 1 каханне

jan 2013: 1 1 слова

mar 2013: 1 1 굶주림

abr 2013: 1 1 мець

mai 2013: 1 2 omăt , 2 1 кароткі

jun 2013: 1 1 Пер-

jul 2013: 1 1 навука

ago 2013: 1 1 πετεηνόν

set 2013: 1 2 ёж , 2 1 радасны

out 2013: 1 1 слова

dez 2013: 1 1 livro

jan 2014: 1 1 уласцівасць

mar 2014: 1 1 платинӕ

abr 2014: 1 1 sinónimo

mai 2014: 1 2 карова , 2 1 дзень

jun 2014: 1 1 päivä

jul 2014: 1 1

ago 2014: 1 1 deň

set 2014: 1 1 дом

out 2014: 1 1 англійская мова

nov 2014: 1 1 andro

dez 2014: 1 2 забойства , 2 1 сонцаварот

jan 2015: 1 1 гук

fev 2015: 1 1 жыхар

mar 2015: 1 1 вывад

abr 2015: 1 1 ўласцівасць

mai 2015: 1 1 цяля

jun 2015: 1 1 ашәахь

jul 2015: 1 1 チーズ

ago 2015: 1 2 курыца , 2 1 вунь

set 2015: 1 1 kiša

out 2015: 1 1 սթափ

nov 2015: 1 1 aṭṭhi

dez 2015: 1 1 ფხიზელი

jan 2016: 1 1 ламбард

fev 2016: 1 1 мяса

mar 2016: 1 1 сауфагæ

abr 2016: 1 2 крэдыт , 2 1 месца

mai 2016: 1 1 дабіцца

jun 2016: 1 1 Федэрацыя

jul 2016: 1 1 балістыка

ago 2016: 1 1 малако

set 2016: 1 1 ბალისტიკა

out 2016: 1 2 лізінг , 2 1 страхаванне

dez 2016: 1 1 жывёла

jan 2017: 1 1 ur

fev 2017: 1 1 stridsvagn

mar 2017: 1 1 Bélarus

abr 2017: 1 1 Weißrusse

mai 2017: 1 1 разведка

jun 2017: 1 1 Musik

jul 2017: 1 1 летнік

ago 2017: 1 2 мець , 2 1 тронак

set 2017: 1 2 рыдлёўка , 2 1 кӯттьк

out 2017: 1 2 прыбудова , 2 1 Прыбудова

nov 2017: 1 1 кактэйль Молатава

dez 2017: 1 1 Алейня

jan 2018: 1 1 трапіла

fev 2018: 1 1 иметь

mar 2018: 1 2 Галоўная старонка , 2 1 Экс-

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 17 de abril 2018 18:34

Dump file bewiktionary-20180401-stub-meta-history.xml.gz (edits only), size 2.7 Mb as gz -> 21 Mb
Dump processed till Mar 31, 2018, on server stat1005, ready at Sat-07/04/2018-17:26 after 14 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.