Estatísticas da Wikcionário bielorrusso

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2016
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 20160%   0%   +472%      0%
jul 2016+5%   0%   +44%      0%
jun 2016+5%   0%   -19%      +1%
mai 20160%   +1%   +71%      0%
abr 20160%   0%   -20%      0%
mar 2016+5%   0%          +5%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 201623   3,5 k 7,6 1,0 k      174
jul 20162311 3,5 k 7,3 180      174
jun 20162211 3,5 k 7,3 125      174
mai 201621 1 3,5 k17,3 154      173
abr 201621 1 3,5 k 7,3 90      173
mar 20162111 3,5 k 7,3 112      173
fev 201620   3,5 k 7,2 12      165
jan 201620   3,5 k 7,2 35      165
dez 201520 1 3,5 k 7,2 289      165
nov 201520   3,4 k 7,2 119      165
out 201520 1 3,4 k 7,1 239      165
set 201520   3,4 k 7,1 151      165
ago 20152011 3,4 k 7 214      165
jul 201519   3,4 k 7 107      165
jun 201519   3,4 k 7 1,3 k      165
mai 201519   3,4 k 6,6 201      164
abr 201519 2 3,4 k16,5 267      164
mar 201519 1 3,4 k 6,54141354,7 Mb247 k10 k48 k1545163
fev 201519 1 3,4 k 6,5413534,7 Mb247 k10 k48 k1545163
jan 201519 1 3,4 k 6,5412664,7 Mb246 k10 k47 k1545163
dez 201419 113,4 k46,44122314,7 Mb245 k10 k47 k1545163
nov 201419 1 3,3 k 6,6413284,5 Mb238 k10 k47 k1545163
out 201419 1 3,3 k 6,64131804,5 Mb237 k10 k47 k1545163
set 201419   3,2 k 6,64133854,5 Mb236 k10 k47 k1545162
ago 201419 1 3,2 k 6,54121694,5 Mb235 k10 k45 k1545162
jul 201419   3,2 k 6,4413644,5 Mb235 k10 k44 k1545162
jun 201419 1 3,2 k26,4413964,5 Mb235 k10 k44 k1545162
mai 20141911 3,2 k 6,5414544,4 Mb230 k10 k44 k1545162
abr 201418 1 3,2 k16,5412454,4 Mb229 k9,9 k44 k1545162
mar 201418 1 3,1 k16,6410584,3 Mb226 k9,8 k44 k1544162
fev 201418   3,1 k 6,6410694,3 Mb224 k9,7 k44 k1544162
jan 201418 1 3,1 k 6,6410574,3 Mb224 k9,7 k44 k1544162
dez 201318 1 3,1 k16,64101,8 k4,3 Mb224 k9,7 k43 k1544162
nov 201318   3,1 k 6,1408684,1 Mb220 k9,6 k37 k1544162
out 201318   3,1 k 6,14071014,1 Mb220 k9,6 k37 k1543162
set 201318 1 3,1 k 6407214,1 Mb219 k9,6 k36 k1441162
ago 201318 113,0 k1364066374,1 Mb218 k9,5 k36 k1341162
jul 201318   2,6 k 6,74082103,6 Mb190 k8,6 k34 k1340162
jun 20131811 2,6 k16,74071853,6 Mb190 k8,6 k34 k1338162
mai 201317 1 2,6 k 6,74083413,5 Mb189 k8,6 k34 k1338162
abr 201317 2 2,6 k 6,64071673,5 Mb188 k8,5 k34 k1320161
mar 201317 1 2,6 k16,54041923,5 Mb186 k8,3 k33 k1319161
fev 201317   2,6 k 6,54041813,4 Mb183 k8,2 k33 k1314161
jan 201317   2,6 k 6,44043633,4 Mb184 k8,2 k33 k1314161
dez 201217 1 2,6 k 6,34031993,4 Mb183 k8,2 k32 k1210161
nov 201217   2,6 k 6,24031213,4 Mb182 k8,1 k32 k1210161
out 201217   2,5 k 6,24023993,4 Mb182 k8,1 k32 k1010161
set 201217 1 2,5 k164014483,4 Mb182 k8,1 k31 k98161
ago 201217   2,5 k 63963713,3 Mb177 k8,0 k31 k77161
jul 201217 112,5 k35,83963413,3 Mb176 k8,0 k30 k77161
jun 201217 1 2,4 k 5,93992723,2 Mb171 k7,8 k30 k67161
mai 2012171212,4 k45,93984953,2 Mb169 k7,7 k29 k36161
abr 201216 1 2,3 k15,93992183,0 Mb162 k7,5 k29 k36160
mar 201216 1 2,3 k 5,93942083,0 Mb158 k7,4 k28 k36159
fev 20121611 2,2 k15,83922,3 k3,0 Mb157 k7,3 k28 k36159
jan 201215 1 2,2 k24,93772622,9 Mb145 k5,1 k27 k26158
dez 201115   2,1 k 4,93754542,8 Mb140 k4,9 k27 k22158
nov 201115 1 2,1 k14,73752662,8 Mb140 k4,9 k26 k11158
out 201115 1 2,1 k14,63749772,8 Mb139 k4,8 k26 k11158
set 201115   2,1 k 4,23731132,7 Mb137 k4,8 k24 k11158
ago 201115 2 2,1 k24,13732442,7 Mb137 k4,8 k24 k11158
jul 201115   2,0 k 4,1371972,6 Mb132 k4,5 k24 k11155
jun 201115 1 2,0 k14,13693402,6 Mb132 k4,3 k23 k11155
mai 201115 1 2,0 k343692552,6 Mb130 k4,3 k23 k11154
abr 201115   1,9 k 43681702,5 Mb124 k4,2 k22 k11154
mar 201115 1 1,9 k13,93681902,5 Mb124 k4,2 k22 k11154
fev 20111511 1,9 k 3,93691952,4 Mb123 k4,2 k22 k11154
jan 201114 111,9 k93,83666852,4 Mb121 k4,2 k21 k11153
dez 201014 1 1,6 k143722532,1 Mb105 k3,7 k19 k11152
nov 201014 2 1,6 k33,93721792,1 Mb104 k3,7 k19 k11152
out 201014 221,5 k343783912,0 Mb99 k3,6 k19 k11152
set 201014 221,4 k543775191,8 Mb92 k3,3 k17 k11151
ago 201014 211,3 k24,13822951,6 Mb82 k3,2 k16 k11151
jul 201014 321,2 k44,13844361,6 Mb78 k3,1 k15 k11151
jun 2010141621,1 k64,23825391,4 Mb70 k2,9 k14 k11151
mai 201013 2289464,43755551,2 Mb57 k2,7 k12 k 1149
abr 201013132693184,93661,4 k913 kb43 k2,2 k9,4 k 1149
mar 201012 2 166 1217923119 kb4,3 k3712,3 k11149
fev 20101211 162 12,116224109 kb3,7 k3482,3 k11149
jan 201011 1 160 12,215717106 kb3,5 k3342,3 k11149
dez 20091112 160 1215740106 kb3,5 k3342,2 k11149
nov 200910 1 160 11,81572395 kb3,5 k3332,2 k11136
out 200910 1 160 11,71576195 kb3,5 k3332,2 k11136
set 200910 1 160 11,31586894 kb3,5 k3332,1 k11136
ago 200910 1 157 11,11603693 kb3,5 k3332,0 k11136
jul 200910 1 157 10,81601693 kb3,5 k3332,0 k11136
jun 200910 1 157 10,71604992 kb3,5 k3332,0 k11136
mai 200910 1 157 10,41604392 kb3,5 k3332,0 k11135
abr 20091012 157 10,11606392 kb3,5 k3332,0 k11135
mar 20099 3 156 9,81435184 kb3,0 k3202,0 k11135
fev 20099111152 9,713610379 kb2,7 k2861,9 k11135
jan 20098   152 91361175 kb2,7 k2861,6 k11135
dez 20088   151 9136475 kb2,7 k2831,6 k11135
nov 20088   151 91361974 kb2,7 k2831,6 k11135
out 20088   151 8,9136274 kb2,7 k2831,6 k11135
set 20088   151 8,9136674 kb2,7 k2821,6 k11135
ago 20088   151 8,81361974 kb2,7 k2821,6 k11135
jul 20088   151 8,7136673 kb2,7 k2821,5 k11135
jun 20088 1 151 8,71362973 kb2,7 k2821,5 k11135
mai 20088 1 147 8,71396372 kb2,7 k2821,5 k11135
abr 20088   147 8,31391369 kb2,7 k2811,3 k11135
mar 2008811 14718,213912267 kb2,7 k2811,1 k11135
fev 20087   105 10,31591258 kb2,1 k2341,1 k1194
jan 20087   105 10,21592258 kb2,1 k2341,1 k1194
dez 20077   105 101593157 kb2,1 k2341,0 k1194
nov 20077   105 9,7159156 kb2,1 k2329891194
out 20077   105 9,71591056 kb2,1 k2329881194
set 20077   105 9,6158256 kb2,1 k2319751194
ago 20077   105 9,5158356 kb2,1 k2319731194
jul 20077   105 9,51583356 kb2,1 k2319661194
jun 20077   105 9,2166558 kb2,3 k2639301194
mai 20077   105 9,21664358 kb2,3 k2639241194
abr 2007723 105 8,716612857 kb2,3 k2638711194
mar 2007511 99 81263745 kb1,7 k48921 192
fev 20074   98 7,71255045 kb1,7 k48897 192
jan 20074   95 7,41285443 kb1,6 k48835 192
dez 20064   95 6,81271542 kb1,6 k48793 192
nov 20064   95 6,71271542 kb1,6 k48781 192
out 20064   95 6,51267241 kb1,6 k48766 192
set 20064   94 5,81165339 kb1,5 k40736 192
ago 20064   94 5,3116238 kb1,5 k40629 192
jul 20064   92 5,3116337 kb1,4 k40618 192
jun 20064   91 5,41178137 kb1,4 k40616 192
mai 2006411 91 4,51506829 kb1,4 k4097 192
abr 20063   91 3,7384326 kb8284093 192
mar 20063   90 3,7416 25 kb7663990 192
fev 200632219033,741631125 kb7663990 192
jan 20061   1 26726 5,3 kb2811164  1
dez 20051   1 2672655,3 kb2811164  1
nov 20051   1 21694 3,8 kb275135  1
out 20051   1 21694 3,8 kb275135  1
set 20051   1 21694183,8 kb275135  1
ago 200511  1 3983193 12 6   
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 2016763874 98 33 96      128
abr 201683 69 98 32 84      128
jan 201682   96 34 109      128
out 201582 78 95 35 90      128
jul 201585   95 37 107      128
abr 201582 62 956438 85      128
jan 2015803469439557362295797886859478128
out 2014783869469461372476787785829377128
jul 2014783482489457372596787785839377128
abr 2014793370479355372588777784829377128
jan 2014784275499258382697747483819276128
out 2013784378469262392577757382839376128
jul 2013764080519163342580767682839475128
abr 2013763757519165362579767481829482128
jan 2013764582549167392382757380829387128
out 2012743479488962432276737279799692128
jul 20127447774987504722767171797810096128
abr 20127539705287604523787272817611097128
jan 20127535685085545425777073867511096128
out 201175397848856357246170708372112111128
jul 201174448149846964258169708271113110128
abr 201174337945856067257871708271112108128
jan 201173356948843666255369708071113107128
out 201072346846844563236871708172110107128
jul 201070455548874362237273738274109106128
abr 201071425645922689894781868682111106128
jan 20107431957710460858510910510910898106106128
out 2009763990791025584849010210610696104106128
jul 20097339948010159828210610110610597103105128
abr 2009714467781015379798810110610395102104128
jan 2009775980421015877779710010410393100105128
out 200877367343986277771041001041028898105127
jul 20087332714596597575106991031008597103127
abr 200868427749946471718996101988598101127
jan 20087143775195596868869499968396100127
out 20076639745092636464939398958292101127
jul 2007634271448957646481899692809098126
abr 2007582335478461616170879389808597126
jan 2007774781438265555585869195717993126
out 2006743865437553505068788691657187126
jul 2006713967377252464689778290606187126
abr 2006733854356249424275727987925284126
jan 20069943573410141373798908995564385118
out 2005943249269735323276848391674078110
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
ago 201621   331 11    21     11 
jul 20163211  33  1     5111   111
jun 2016111   22        2      11 
mai 201621111 22  1     2111      
abr 20162111  22        21        
mar 20161111  11  1     5      11 
fev 201621   1                   
jan 201611   22        1      11 
dez 20152111  221       332    11 
nov 20152    22  1     421    111
out 2015211   331       211    21 
set 20152    33  5     2      11 
ago 20154111  331       4      11 
jul 20151    33  1     2      11 
jun 201532   3211             11 
mai 20152    331 1     2      11 
abr 201532211 331 1   2252221  111
mar 2015111   32  2   111      11 
fev 2015111   22  42    52     111
jan 2015111   33  11    21     111
dez 2014211111 33  1     1111   111
nov 20141111  11  21    2      11 
out 2014321   111       311    1  
set 20141    111 3     4      11 
ago 2014211   221       31     11 
jul 201411   22        211       
jun 201411111 11        4111      
mai 20143211  11        1         
abr 20142111  21        4         
mar 201411111 21  1     4211      
fev 2014     22  1     5         
jan 20141111  22  1     41     11 
jul 20163211  33  1     5111   111
abr 20162111  22        21        
jan 201611   22        1      11 
out 2015211   331       211    21 
jul 20151    33  1     2      11 
abr 201532211 331 1   2252221  111
jan 2015111   33  11    21     111
out 2014321   111       311    1  
jul 201411   22        211       
abr 20142111  21        4         
jan 20141111  22  1     41     11 
out 20131    11  1     31        
jul 20132    221       51111  11 
abr 2013222   111 1     511    111
jan 20131    621              11 
out 2012     321 1     51     111
jul 2012111111 421       511    11 
abr 201211111 54  11    53211  11 
jan 201211111 631       3111   211
out 20113111  441 3     5      11 
jul 201111   33  1     31     11 
abr 20112    321       321    11 
jan 20112111111431       51111  11 
out 20104322221          62221  11 
jul 20104332221          21111     
abr 20103333222    3322  54221111  
jan 20101111      1     2111      
out 200911111           3         
jul 20091111      2     3         
abr 200932222     2     4332211   
jan 2009     1         111    11 
out 20081        1     522       
jul 2008               1         
abr 2008     11        1         
jan 2008     11  2     3         
out 2007     1   3     3         
jul 20071    11        1      1  
abr 200763322 11  222   42222     
jan 2007     11                  
out 2006     11        21        
jul 20061              1         
abr 200611       1               
jan 2006         3     6211      
out 2005                         

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
184100.0%7,759100.0%
33642.9%7,68399.0%
102327.4%7,61198.1%
321113.1%7,39895.3%
10067.1%7,07891.2%
31622.4%6,55584.5%
100022.4%6,55584.5%
316211.2%3,55545.8%

 

2 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Octahedron80UC41...33--ago 25, 20165----
Hans-Friedrich TamkeUC83...11--ago 30, 2016 ----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Al SilonovUC13,555mar 28, 20092712jul 16, 201645
InterwicketUC23,000fev 01, 20092767nov 08, 20102122
BooxterUC3127fev 01, 20063863fev 03, 20063861
ХомелкаUC4111fev 24, 20121649mai 11, 20131207
VesailokUC5104mar 28, 20092712out 30, 2014670
PradslavaUC695mar 15, 20083090mar 21, 20083084
Ellis NovakUC780mai 24, 20131194jun 21, 20131166
KubaroUC864mai 04, 20063771mai 16, 20063759
MaximLitvinUC944abr 22, 20073418jul 30, 20073319
MienskiUC1037abr 23, 20073417abr 24, 20073416
LA2UC1127mar 23, 2016160mar 31, 2016152
CarsracUC1224dez 04, 20092461dez 04, 20092461
Vedac13UC1324mai 11, 2014842mai 11, 2014842
Vit KozUC1422jan 15, 2016228jul 29, 201632
Yellow~bewiktionaryUC1520jun 20, 20102263jun 21, 20102262
ZuiarraUC1620ago 28, 20111829jul 11, 20131146
DryhvaUC1715mar 28, 20073443mar 30, 20073441
MalafayaUC1814out 07, 20082884jun 10, 20102273
Amire80UC1913ago 26, 2015370ago 30, 2015366
IlyankouUC2012fev 21, 20112017fev 21, 20112017

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 171 edições foram feitas por usuários anônimos, de um total de 26709 edições ( 0e %)
  


20 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC15,445abr 24, 20121589jul 10, 201651--
Luckas-botUC23,340set 04, 20102187jan 27, 2014946--
JAnDbotUC32,639mai 18, 20111931ago 31, 2016---
ХомоБотUC41,970fev 24, 20121649fev 27, 20121646--
KamikazeBotUC51,408out 18, 20111778mar 07, 20131272--
OctraBotUC6920ago 25, 20165ago 25, 20165--
YS-BotUC7640set 07, 20121453out 18, 2015317--
ArthurBotUC8548jan 04, 20112065nov 12, 20111753--
RobotGMwiktUC9504jun 23, 20063721mai 30, 20083014--
VolkovBotUC10297jul 13, 20073336mar 23, 20131256--
WikitanvirBotUC11257abr 16, 20111963jan 19, 20121685--
AvocatoBotUC12220nov 01, 20111764ago 27, 20131099--
RoggBotUC13147jun 16, 20092632fev 26, 20112012--
UT-interwiki-BotUC14134jul 14, 201647ago 31, 2016---
WarddrBOTUC15126jul 25, 20121497ago 17, 20131109--
SpaceBirdyBotUC1655jun 27, 20082986dez 01, 20082829--
MjbmrbotUC1753jan 23, 20112046mar 28, 20111982--
EdwardsBotUC1834jul 03, 20111885nov 18, 20131016--
CarsracBotUC1924mar 17, 20111993mai 19, 20131199--
Makecat-botUC204nov 10, 20121389abr 05, 20131243--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
ago 20163,7 k41139 111,1 k11,1 k       
jul 20163,7 k41039 111,1 k11,1 k       
jun 20163,7 k41039 111,1 k11,1 k       
mai 20163,7 k41039 111,1 k11,1 k       
abr 20163,6 k40939 111,0 k11,1 k       
mar 20163,6 k40839 111,0 k11,1 k       
fev 20163,6 k40739 111,0 k11,1 k       
jan 20163,6 k40739 111,0 k11,1 k       
dez 20153,6 k40739 111,0 k11,1 k       
nov 20153,6 k40239 111,0 k11,1 k       
out 20153,6 k40039 111,0 k11,1 k       
set 20153,6 k40039 111,0 k11,1 k       
ago 20153,6 k39939 111,0 k11,1 k       
jul 20153,6 k39839 111,0 k11,1 k       
jun 20153,6 k39739 111,0 k11,1 k       
mai 20153,6 k39739 111,0 k11,1 k       
abr 20153,6 k39639 111,0 k11,1 k       
mar 20153,6 k39439 111,0 k11,1 k      7
fev 20153,6 k39439 111,0 k11,1 k      7
jan 20153,6 k38839 111,0 k11,1 k      9
dez 20143,5 k38639 111,0 k11,1 k      120
nov 20143,4 k38639 111,0 k11,1 k      15
out 20143,4 k38439 111,0 k11,1 k      15
set 20143,4 k38339 111,0 k11,1 k      1
ago 20143,4 k37839 111,0 k11,1 k      7
jul 20143,4 k37439 111,0 k11,1 k      3
jun 20143,4 k37439 111,0 k11,1 k      71
mai 20143,3 k37239 111,0 k11,1 k      29
abr 20143,3 k37239 111,0 k11,1 k      25
mar 20143,3 k36939 111,0 k11,1 k      29
fev 20143,3 k36639 111,0 k11,0 k       
jan 20143,3 k36139 111,0 k11,0 k      11
dez 20133,3 k35839 111,0 k11,0 k      45
nov 20133,2 k35839 1199811,0 k       
out 20133,2 k35339 1199811,0 k      2
set 20133,2 k35039 1199811,0 k      15
ago 20133,2 k33739 1199611,0 k      418
jul 20132,8 k33339 1196411,0 k      2
jun 20132,8 k32839 119641993      73
mai 20132,8 k32739 119641991      18
abr 20132,8 k32539 119641990      10
mar 20132,8 k32039 119591990      45
fev 20132,7 k31339 119591990       
jan 20132,7 k30539 119591990      1
dez 20122,7 k30439 119591990      7
nov 20122,7 k29839 119591990       
out 20122,7 k29839 119591990       
set 20122,7 k29539 119591990      46
ago 20122,7 k29039 119581990      4
jul 20122,7 k28639 119581990      104
jun 20122,6 k28439 119561984      15
mai 20122,5 k27439 119561984      125
abr 20122,4 k26939 119541982      27
mar 20122,4 k26339 119521938      19
fev 20122,4 k26139 119511938      102
jan 20122,4 k25239 119491938      71
dez 20112,3 k25039 119461935      4
nov 20112,3 k24639 119431935      20
out 20112,3 k23339 119421935      26
set 20112,3 k22839 119421935      6
ago 20112,3 k22439 119421932      86
jul 20112,2 k21739 119381928      3
jun 20112,2 k20839 119381928      43
mai 20112,2 k20539 119361922      85
abr 20112,1 k19939 119301913      3
mar 20112,1 k19139 119301913      26
fev 20112,1 k19139 119261901      19
jan 20112,1 k18539 119251901      279
dez 20101,8 k17939 119161867      17
nov 20101,8 k17739 119131861      170
out 20101,7 k17239 108981820      388
set 20101,6 k16939 108851782      510
ago 20101,4 k16239 108581727      294
jul 20101,3 k14739 108461699      434
jun 20101,2 k14639 108271648      536
mai 20101,0 k13239 107621562      541
abr 201084213039 106711480      1374
mar 201031512135 1462182      22
fev 201031111735 1455177      24
jan 201030911435 1451177      17
dez 200930910235 1451177      40
nov 200929610034 1451177      21
out 20092969834 1451177      61
set 20092969534 1451177      63
ago 20092939134 1451177      36
jul 20092939034 1451177      16
jun 20092938934 1451177      35
mai 20092928534 1450177      43
abr 20092928334 1450177      63
mar 20092917634 1212170      49
fev 20092877333 1105169      103
jan 20092876733 1105169       
dez 20082866733 1105169       
nov 20082866733 1105169       
out 20082865433 1105 69      1
set 20082864333 1105 69       
ago 20082864333 1105 69       
jul 20082864233 1105 69       
jun 20082864233 1105 69      7
mai 20082823632 1105 69      7
abr 20082823332  104 69       
mar 20082823232  104 69      95
fev 20081993132  97 23       
jan 20081993132  97 23       
dez 20071992932  97 23       
nov 20071992732  97 23       
out 20071992732  95 23       
set 20071992431  94 23       
ago 20071992430  93 23       
jul 20071992330  93 23      3
jun 20071992230  92 23       
mai 20071992130  92 23       
abr 20071992130  92 23      89
mar 20071911830  62 1      20
fev 20071901830  57 1       
jan 20071871730  57 1       
dez 20061871730  57 1       
nov 20061871730  57 1      2
out 20061871730  57 1       
set 20061861530  54 1       
ago 20061861430  54 1       
jul 20061841330  54 1      2
jun 20061831230  54 1       
mai 20061831130  54 1      64
abr 20061831130  40         
mar 20061821130  40         
fev 20061821130  40         
jan 20062103  19         
dez 2005241  4         
nov 2005211  3         
out 2005211  3         
set 2005211  3         
ago 2005111            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 галоўная старонка

fev 2006: 1 2 acoustic , 2 1 Мова

abr 2006: 1 1 радзіма

mai 2006: 1 1 радзіма

jul 2006: 1 1 raven

nov 2006: 1 1 index л

mar 2007: 1 1 карова

abr 2007: 1 3 верасень , 2 3 радзіма , 3 2 малако , 4 2 год , 5 2 жнівень , 6 2 абсент , 7 1 index:й

jul 2007: 1 1 Першая старонка

mar 2008: 1 1 らじお

mai 2008: 1 1 Першая старонка

jun 2008: 1 1 Їжа

out 2008: 1 1 мова

fev 2009: 1 1 football

mar 2009: 1 3 абажур , 2 2 курыца , 3 1 венгерская

abr 2009: 1 2 год , 2 2 мова , 3 1 эсперанта

mai 2009: 1 2 год , 2 1 football

jun 2009: 1 1 Main page

jul 2009: 1 1 венгерская

ago 2009: 1 1 林檎

set 2009: 1 1 duck

out 2009: 1 1 duck

nov 2009: 1 1 football

dez 2009: 1 1 Маскаль

jan 2010: 1 1 duck

fev 2010: 1 2 езуіт , 2 2 accounting

mar 2010: 1 2 папка , 2 2 омметр , 3 1 белый

abr 2010: 1 3 mudel , 2 3 панядзелак , 3 3 красавік , 4 3 вайна , 5 3 воўк , 6 2 پنیر , 7 2 keuz , 8 2 Käse , 9 2 ġobon , 10 2 pendir , 11 2 брынзэ , 12 2 brânză , 13 2 পনির , 14 2 पनीर , 15 2 sýr , 16 2 juust , 17 2 caseus , 18 2 siers , 19 2 sūris , 20 2 сирење , 21 2 チーズ

mai 2010: 1 2 об , 2 2 vatn , 3 2 wetter , 4 2 su , 5 2 पाणी , 6 2 лъим , 7 2 woda , 8 2 água , 9 2 һыу

jun 2010: 1 4 смоўж , 2 4 бусел , 3 3 ялавічына , 4 3 бурштын , 5 3 рэпілент , 6 3 валапюк , 7 2 spegel , 8 2 , 9 2 күзгү , 10 2 거울

jul 2010: 1 3 ідыш , 2 3 Маскаль , 3 2 saqaf , 4 2 леведыш

ago 2010: 1 2 serigala , 2 2 борз , 3 2 úlvur

set 2010: 1 2 túbig , 2 2 , 3 2 шыв , 4 2 dowr

out 2010: 1 3 laberint , 2 2 qar , 3 2 sněh

nov 2010: 1 1 fromazy

dez 2010: 1 1 hukarere

jan 2011: 1 1 мед

fev 2011: 1 2 абавязак , 2 2 аазіс , 3 1 ладдзя

mar 2011: 1 1 மணல்

abr 2011: 1 1 история

mai 2011: 1 2 архитектура , 2 1

jun 2011: 1 1 ком

jul 2011: 1 1 месяц

ago 2011: 1 3 альфа , 2 2 кулак , 3 2 Бета

set 2011: 1 1 اسم

out 2011: 1 1 alatsinainy

nov 2011: 1 1 кніга

dez 2011: 1 2 збройні сили

jan 2012: 1 1 прагрэс

fev 2012: 1 1 некалькі

mar 2012: 1 2 сколько , 2 2 колькі , 3 1 абрус

abr 2012: 1 1 кавалак

mai 2012: 1 2 urtxintxa , 2 1 hartz

jun 2012: 1 1 baraf

jul 2012: 1 1 гургум

ago 2012: 1 1 вуха

set 2012: 1 1 зародак

dez 2012: 1 1 каханне

jan 2013: 1 1 слова

mar 2013: 1 1 굶주림

abr 2013: 1 1 мець

mai 2013: 1 2 omăt , 2 1 кароткі

jun 2013: 1 1 Пер-

jul 2013: 1 1 навука

ago 2013: 1 1 πετεηνόν

set 2013: 1 2 ёж , 2 1 радасны

out 2013: 1 1 слова

dez 2013: 1 1 livro

jan 2014: 1 1 уласцівасць

mar 2014: 1 1 платинӕ

abr 2014: 1 1 sinónimo

mai 2014: 1 2 карова , 2 1 дзень

jun 2014: 1 1 päivä

jul 2014: 1 1

ago 2014: 1 1 deň

set 2014: 1 1 дом

out 2014: 1 1 англійская мова

nov 2014: 1 1 andro

dez 2014: 1 2 забойства , 2 1 сонцаварот

jan 2015: 1 1 гук

fev 2015: 1 1 жыхар

mar 2015: 1 1 вывад

abr 2015: 1 1 ўласцівасць

mai 2015: 1 1 цяля

jun 2015: 1 1 ашәахь

jul 2015: 1 1 チーズ

ago 2015: 1 2 курыца , 2 1 вунь

set 2015: 1 1 kiša

out 2015: 1 1 սթափ

nov 2015: 1 1 aṭṭhi

dez 2015: 1 1 ფხიზელი

jan 2016: 1 1 ламбард

fev 2016: 1 1 мяса

mar 2016: 1 1 сауфагæ

abr 2016: 1 2 крэдыт , 2 1 месца

mai 2016: 1 1 дабіцца

jun 2016: 1 1 Федэрацыя

jul 2016: 1 1 балістыка

ago 2016: 1 1 Вікіслоўнік:Спісы Сводзеша для славянскіх моў

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 18 de setembro 2016 16:51

Dump file bewiktionary-20160901-stub-meta-history.xml.gz (edits only), size 2.3 Mb as gz -> 18 Mb
Dump processed till Aug 31, 2016, on server stat1002, ready at Wed-07/09/2016-09:39 after 20 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.