Estatísticas da Wikcionário bielorrusso

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2017
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2017+4%   +1%   +98%      0%
jan 20170%   0%   +190%      0%
dez 20160%   0%   +44%      0%
nov 20160%   0%   -77%      0%
out 20160%   0%   -20%      0%
set 20160%   +1%   -73%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 20172511 3,6 k17,8 414      174
jan 201724   3,5 k 7,8 209      174
dez 201624 1 3,5 k 7,7 72      174
nov 201624   3,5 k 7,7 50      174
out 201624 1 3,5 k 7,7 218      174
set 201624 2 3,5 k17,6 273      174
ago 201624   3,5 k 7,6 1,0 k      174
jul 20162412 3,5 k 7,3 180      174
jun 20162311 3,5 k 7,3 125      174
mai 201622 1 3,5 k17,3 154      173
abr 201622 1 3,5 k 7,3 90      173
mar 20162211 3,5 k 7,3 112      173
fev 201621   3,5 k 7,2 12      165
jan 201621   3,5 k 7,2 35      165
dez 201521 1 3,5 k 7,2 289      165
nov 201521   3,4 k 7,2 119      165
out 201521 1 3,4 k 7,1 239      165
set 201521   3,4 k 7,1 151      165
ago 20152111 3,4 k 7 214      165
jul 201520   3,4 k 7 107      165
jun 201520   3,4 k 7 1,3 k      165
mai 201520   3,4 k 6,6 201      164
abr 201520 2 3,4 k16,5 267      164
mar 201520 1 3,4 k 6,54141354,7 Mb247 k10 k48 k1545163
fev 201520 1 3,4 k 6,5413534,7 Mb247 k10 k48 k1545163
jan 201520 1 3,4 k 6,5412664,7 Mb246 k10 k47 k1545163
dez 201420 113,4 k46,54122314,7 Mb245 k10 k47 k1545163
nov 201420 1 3,3 k 6,6413284,5 Mb238 k10 k47 k1545163
out 201420 2 3,3 k 6,64131804,5 Mb237 k10 k47 k1545163
set 201420   3,2 k 6,64133854,5 Mb236 k10 k47 k1545162
ago 201420 1 3,2 k 6,54121694,5 Mb235 k10 k45 k1545162
jul 201420   3,2 k 6,4413644,5 Mb235 k10 k44 k1545162
jun 201420 1 3,2 k26,4413964,5 Mb235 k10 k44 k1545162
mai 20142011 3,2 k 6,5414544,4 Mb230 k10 k44 k1545162
abr 201419 1 3,2 k16,5412454,4 Mb229 k9,9 k44 k1545162
mar 201419 1 3,1 k16,6410584,3 Mb226 k9,8 k44 k1544162
fev 201419   3,1 k 6,6410694,3 Mb224 k9,7 k44 k1544162
jan 201419 1 3,1 k 6,6410574,3 Mb224 k9,7 k44 k1544162
dez 201319 1 3,1 k16,64101,8 k4,3 Mb224 k9,7 k43 k1544162
nov 201319   3,1 k 6,1408684,1 Mb220 k9,6 k37 k1544162
out 201319   3,1 k 6,14071014,1 Mb220 k9,6 k37 k1543162
set 201319 1 3,1 k 6407214,1 Mb219 k9,6 k36 k1441162
ago 201319 113,0 k1364066374,1 Mb218 k9,5 k36 k1341162
jul 201319   2,6 k 6,74082103,6 Mb190 k8,6 k34 k1340162
jun 20131911 2,6 k16,74071853,6 Mb190 k8,6 k34 k1338162
mai 201318 2 2,6 k 6,74083413,5 Mb189 k8,6 k34 k1338162
abr 201318 2 2,6 k 6,64071673,5 Mb188 k8,5 k34 k1320161
mar 201318 1 2,6 k16,54041923,5 Mb186 k8,3 k33 k1319161
fev 201318   2,6 k 6,54041813,4 Mb183 k8,2 k33 k1314161
jan 201318   2,6 k 6,44043623,4 Mb184 k8,2 k33 k1314161
dez 201218 1 2,6 k 6,34031993,4 Mb183 k8,2 k32 k1210161
nov 201218   2,5 k 6,34031213,4 Mb182 k8,1 k32 k1210161
out 201218   2,5 k 6,24023993,4 Mb182 k8,1 k32 k1010161
set 201218 1 2,5 k164014483,4 Mb182 k8,1 k31 k98161
ago 201218   2,5 k 63963713,3 Mb177 k8,0 k31 k77161
jul 201218 112,5 k35,83963413,3 Mb176 k8,0 k30 k77161
jun 201218 1 2,4 k 5,93992723,2 Mb171 k7,8 k30 k67161
mai 2012181212,4 k45,93984953,2 Mb169 k7,7 k29 k36161
abr 201217 1 2,3 k15,93992183,0 Mb162 k7,5 k29 k36160
mar 201217 1 2,3 k 5,93942083,0 Mb158 k7,4 k28 k36159
fev 20121711 2,2 k15,83922,3 k3,0 Mb157 k7,3 k28 k36159
jan 201216 1 2,2 k24,93772622,9 Mb145 k5,1 k27 k26158
dez 201116   2,1 k 4,93754542,8 Mb140 k4,9 k27 k22158
nov 201116 1 2,1 k14,73752662,8 Mb140 k4,9 k26 k11158
out 201116 1 2,1 k14,63749772,8 Mb139 k4,8 k26 k11158
set 201116   2,1 k 4,23731132,7 Mb137 k4,8 k24 k11158
ago 201116 3 2,1 k24,13732442,7 Mb137 k4,8 k24 k11158
jul 201116   2,0 k 4,1371972,6 Mb132 k4,5 k24 k11155
jun 201116 1 2,0 k14,13693402,6 Mb132 k4,3 k23 k11155
mai 201116 1 2,0 k343692552,6 Mb130 k4,3 k23 k11154
abr 201116   1,9 k 43681702,5 Mb124 k4,2 k22 k11154
mar 201116 1 1,9 k13,93681902,5 Mb124 k4,2 k22 k11154
fev 20111611 1,9 k 3,93691952,4 Mb123 k4,2 k22 k11154
jan 201115 111,9 k93,83666852,4 Mb121 k4,2 k21 k11153
dez 201015 1 1,6 k143722532,1 Mb105 k3,7 k19 k11152
nov 201015 2 1,6 k33,93721792,1 Mb104 k3,7 k19 k11152
out 201015 221,5 k343783912,0 Mb99 k3,6 k19 k11152
set 201015 221,4 k543775191,8 Mb92 k3,3 k17 k11151
ago 2010151211,3 k24,13822951,6 Mb82 k3,2 k16 k11151
jul 201014 321,2 k44,13844361,6 Mb78 k3,1 k15 k11151
jun 2010141621,1 k64,23825391,4 Mb70 k2,9 k14 k11151
mai 201013 2289364,43755551,2 Mb57 k2,7 k12 k 1149
abr 201013132692184,93661,4 k913 kb43 k2,2 k9,4 k 1149
mar 201012 2 165 12,117923119 kb4,3 k3712,3 k11149
fev 20101211 161 12,216224109 kb3,7 k3482,3 k11149
jan 201011 1 159 12,215717106 kb3,5 k3342,3 k11149
dez 20091112 159 12,115740106 kb3,5 k3342,2 k11149
nov 200910 1 159 11,91572395 kb3,5 k3332,2 k11136
out 200910 1 159 11,71576195 kb3,5 k3332,2 k11136
set 200910 1 159 11,31586794 kb3,5 k3332,1 k11136
ago 200910 1 157 11,11603693 kb3,5 k3332,0 k11136
jul 200910 1 157 10,81601693 kb3,5 k3332,0 k11136
jun 200910 1 157 10,71604992 kb3,5 k3332,0 k11136
mai 200910 1 157 10,41604392 kb3,5 k3332,0 k11135
abr 20091012 157 10,11606392 kb3,5 k3332,0 k11135
mar 20099 3 156 9,81435184 kb3,0 k3202,0 k11135
fev 20099111152 9,713610379 kb2,7 k2861,9 k11135
jan 20098   152 91361175 kb2,7 k2861,6 k11135
dez 20088   151 9136475 kb2,7 k2831,6 k11135
nov 20088   151 91361974 kb2,7 k2831,6 k11135
out 20088   151 8,9136274 kb2,7 k2831,6 k11135
set 20088   151 8,9136674 kb2,7 k2821,6 k11135
ago 20088   151 8,81361974 kb2,7 k2821,6 k11135
jul 20088   151 8,7136673 kb2,7 k2821,5 k11135
jun 20088 1 151 8,71362973 kb2,7 k2821,5 k11135
mai 20088 1 147 8,71396372 kb2,7 k2821,5 k11135
abr 20088   147 8,31391369 kb2,7 k2811,3 k11135
mar 2008811 14718,213912267 kb2,7 k2811,1 k11135
fev 20087   105 10,31591258 kb2,1 k2341,1 k1194
jan 20087   105 10,21592258 kb2,1 k2341,1 k1194
dez 20077   105 101593157 kb2,1 k2341,0 k1194
nov 20077   105 9,7159156 kb2,1 k2329891194
out 20077   105 9,71591056 kb2,1 k2329881194
set 20077   105 9,6158256 kb2,1 k2319751194
ago 20077   105 9,5158356 kb2,1 k2319731194
jul 20077   105 9,51583356 kb2,1 k2319661194
jun 20077   105 9,2166558 kb2,3 k2639301194
mai 20077   105 9,21664358 kb2,3 k2639241194
abr 2007723 105 8,716612857 kb2,3 k2638711194
mar 2007511 99 81263745 kb1,7 k48921 192
fev 20074   98 7,71255045 kb1,7 k48897 192
jan 20074   95 7,41285443 kb1,6 k48835 192
dez 20064   95 6,81271542 kb1,6 k48793 192
nov 20064   95 6,71271542 kb1,6 k48781 192
out 20064   95 6,51267241 kb1,6 k48766 192
set 20064   94 5,81165339 kb1,5 k40736 192
ago 20064   94 5,3116238 kb1,5 k40629 192
jul 20064   92 5,3116337 kb1,4 k40618 192
jun 20064   91 5,41178137 kb1,4 k40616 192
mai 2006411 91 4,51506829 kb1,4 k4097 192
abr 20063   91 3,7384326 kb8284093 192
mar 20063   90 3,7416 25 kb7663990 192
fev 200632229033,741631125 kb7663990 192
jan 20061   1 26726 5,3 kb2811164  1
dez 20051   1 2672655,3 kb2811164  1
nov 20051   1 21694 3,8 kb275135  1
out 20051   1 21694 3,8 kb275135  1
set 20051   1 21694183,8 kb275135  1
ago 200511  1 3983193 12 6   
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201775   99 28 96      142
out 201675 69 99 29 83      142
jul 2016734057 99 33 97      142
abr 201682 73 99 32 84      142
jan 201682   97 34 109      142
out 201577 81 96 35 91      142
jul 201582   96 37 108      142
abr 201580 63 966438 86      142
jan 2015793671439658362296807987859681142
out 2014774056479562372477797886829580142
jul 2014773283489557372596797886839580142
abr 2014773173489455372589787885829580142
jan 2014774279499259382697747483819479142
out 2013764379469262392577757382839579142
jul 2013753982519164342580767682839778142
abr 2013763658519165362579767481829785142
jan 2013764582549167392382757380829590142
out 2012723882498964432277737279799895142
jul 20127252825187514722767171797810499142
abr 201273397352876244237972728176116102142
jan 201275357150855454257770738675115101142
out 201175427949856557246170708372120119142
jul 201173448249846964258169708271119117142
abr 201170338245856167257871708271118115142
jan 201173357148843666255369708071118114142
out 201072367046844563236871708172115114142
jul 201070445749874362237273738274114113142
abr 201072455645922689894781868682118113142
jan 2010773310077111618585117107113114103110113142
out 2009784095791085684849110511011299108113142
jul 2009764110081107598282112104110111100107112142
abr 2009734669781075379798810411010998106111142
jan 20097760824210659777710010510810896104113142
out 20087736754310463777711110410810690102113141
jul 20087332724610159757511310310710487101111141
abr 200869427949996471719210010510287102109141
jan 200873437751100596868891001031018699108141
out 2007704276509763646497981021008595108141
jul 200766457544945864648494100978393105140
abr 20076222354788616161709297938388104140
jan 20078348844685665555888995101738298140
out 2006794067437853505070809097667493140
jul 2006754169387353464693788595616292140
abr 2006793854356449424277738291995489140
jan 20061054560341074137371089494100574490132
out 200510133512610236323279888795694182118
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
fev 201711111 431       422211 11 
jan 201731   321       2221   1  
dez 2016111   22  2     11     1  
nov 2016     42        22     1  
out 20164211  311 1     21     22 
set 201622211 321       21     11 
ago 201621   331 11    21     11 
jul 20163221  33  1     5111   111
jun 2016221   22        2      11 
mai 201621111 22  1     2111      
abr 20162111  22        21        
mar 201611111 11  1     5      11 
fev 201621   1                   
jan 201611   22        1      11 
dez 20152111  221       332    11 
nov 20152    22  1     421    111
out 2015211   331       211    21 
set 20152    33  5     2      11 
ago 20154111  331       4      11 
jul 20151    33  1     2      11 
jun 201532   3211             11 
mai 20152    331 1     2      11 
abr 201532211 331 1   2252221  111
mar 2015111   32  2   111      11 
fev 2015111   22  42    52     111
jan 2015111   33  11    21     111
jan 201731   321       2221   1  
out 20164211  311 1     21     22 
jul 20163221  33  1     5111   111
abr 20162111  22        21        
jan 201611   22        1      11 
out 2015211   331       211    21 
jul 20151    33  1     2      11 
abr 201532211 331 1   2252221  111
jan 2015111   33  11    21     111
out 2014322   111       311    1  
jul 201411   22        211       
abr 20142111  21        4         
jan 20141111  22  1     41     11 
out 20131    11  1     31        
jul 20132    221       51111  11 
abr 2013222   111 1     511    111
jan 20131    621              11 
out 2012     321 1     51     111
jul 2012111111 421       511    11 
abr 201211111 54  11    53211  11 
jan 201211111 631       3111   211
out 20113111  441 3     5      11 
jul 201111   33  1     31     11 
abr 20112    321       321    11 
jan 20112111111431       51111  11 
out 20104322221          62221  11 
jul 20105332221          21111     
abr 20103333222    3322  54221111  
jan 20101111      1     2111      
out 200911111           3         
jul 20091111      2     3         
abr 200932222     2     4332211   
jan 2009     1         111    11 
out 20081        1     522       
jul 2008               1         
abr 2008     11        1         
jan 2008     11  2     3         
out 2007     1   3     3         
jul 20072    11        1      1  
abr 200763322 11  222   42222     
jan 2007     11                  
out 2006     11        21        
jul 20061              1         
abr 200611       1               
jan 2006         3     6211      
out 2005                         

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
189100.0%7,888100.0%
33741.6%7,80498.9%
102427.0%7,73098.0%
321314.6%7,52095.3%
10066.7%7,11790.2%
31622.2%6,59483.6%
100022.2%6,59483.6%
316211.1%3,59445.6%

 

1 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
DevyanostikUC9+2748442015jan 19, 201739201996

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Al SilonovUC13,594mar 28, 20092893dez 09, 201680
InterwicketUC23,000fev 01, 20092948nov 08, 20102303
BooxterUC3127fev 01, 20064044fev 03, 20064042
ХомелкаUC4111fev 24, 20121830mai 11, 20131388
VesailokUC5104mar 28, 20092893out 30, 2014851
PradslavaUC695mar 15, 20083271mar 21, 20083265
Ellis NovakUC780mai 24, 20131375jun 21, 20131347
KubaroUC864mai 04, 20063952mai 16, 20063940
MaximLitvinUC1044abr 22, 20073599jul 30, 20073500
MienskiUC1137abr 23, 20073598abr 24, 20073597
Vit KozUC1235jan 15, 2016409out 20, 2016130
Sankoff64UC1330out 20, 2014861out 14, 2016136
LA2UC1427mar 23, 2016341mar 31, 2016333
CarsracUC1524dez 04, 20092642dez 04, 20092642
Vedac13UC1624mai 11, 20141023mai 11, 20141023
ZuiarraUC1721ago 28, 20112010jan 22, 201736
Yellow~bewiktionaryUC1820jun 20, 20102444jun 21, 20102443
DryhvaUC1915mar 28, 20073624mar 30, 20073622
MalafayaUC2014out 07, 20083065jun 10, 20102454
Amire80UC2113ago 26, 2015551ago 30, 2015547

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 175 edições foram feitas por usuários anônimos, de um total de 27943 edições ( 0e %)
  


23 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC15,477abr 24, 20121770fev 19, 20178--
Luckas-botUC23,340set 04, 20102368jan 27, 20141127--
JAnDbotUC32,672mai 18, 20112112fev 18, 20179--
ХомоБотUC41,970fev 24, 20121830fev 27, 20121827--
OctraBotUC51,414ago 25, 2016186fev 23, 20174--
KamikazeBotUC61,408out 18, 20111959mar 07, 20131453--
UT-interwiki-BotUC7683jul 14, 2016228fev 28, 2017---
YS-BotUC8640set 07, 20121634out 18, 2015498--
ArthurBotUC9548jan 04, 20112246nov 12, 20111934--
RobotGMwiktUC10504jun 23, 20063902mai 30, 20083195--
VolkovBotUC11297jul 13, 20073517mar 23, 20131437--
WikitanvirBotUC12257abr 16, 20112144jan 19, 20121866--
AvocatoBotUC13220nov 01, 20111945ago 27, 20131280--
RoggBotUC14147jun 16, 20092813fev 26, 20112193--
WarddrBOTUC15126jul 25, 20121678ago 17, 20131290--
SpaceBirdyBotUC1655jun 27, 20083167dez 01, 20083010--
MjbmrbotUC1753jan 23, 20112227mar 28, 20112163--
EdwardsBotUC1834jul 03, 20112066nov 18, 20131197--
CarsracBotUC1924mar 17, 20112174mai 19, 20131380--
Makecat-botUC204nov 10, 20121570abr 05, 20131424--
AvicBotUC213jul 30, 20112039ago 28, 20112010--
AlexbotUC222fev 24, 20083291fev 24, 20083291--
タチコマ robotUC232mai 27, 20121737mai 27, 20121737--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
fev 20173,7 k40739 111,1 k11,3 k       
jan 20173,7 k40539 111,1 k11,2 k       
dez 20163,7 k40539 111,1 k11,1 k       
nov 20163,7 k40539 111,1 k11,1 k       
out 20163,7 k40539 111,1 k11,1 k       
set 20163,7 k40539 111,1 k11,1 k       
ago 20163,7 k40439 111,1 k11,1 k       
jul 20163,7 k40339 111,1 k11,1 k       
jun 20163,7 k40339 111,1 k11,1 k       
mai 20163,7 k40339 111,1 k11,1 k       
abr 20163,6 k40239 111,0 k11,1 k       
mar 20163,6 k40139 111,0 k11,1 k       
fev 20163,6 k40039 111,0 k11,1 k       
jan 20163,6 k40039 111,0 k11,1 k       
dez 20153,6 k40039 111,0 k11,1 k       
nov 20153,6 k39539 111,0 k11,1 k       
out 20153,6 k39339 111,0 k11,1 k       
set 20153,6 k39339 111,0 k11,1 k       
ago 20153,6 k39239 111,0 k11,1 k       
jul 20153,6 k39139 111,0 k11,1 k       
jun 20153,6 k39039 111,0 k11,1 k       
mai 20153,6 k39039 111,0 k11,1 k       
abr 20153,6 k38939 111,0 k11,1 k       
mar 20153,6 k38739 111,0 k11,1 k      7
fev 20153,6 k38739 111,0 k11,1 k      7
jan 20153,6 k38139 111,0 k11,1 k      9
dez 20143,5 k37939 111,0 k11,1 k      120
nov 20143,4 k37939 111,0 k11,1 k      15
out 20143,4 k37739 111,0 k11,1 k      15
set 20143,4 k37639 111,0 k11,1 k      1
ago 20143,4 k37139 111,0 k11,1 k      7
jul 20143,4 k36739 111,0 k11,1 k      3
jun 20143,4 k36739 111,0 k11,1 k      71
mai 20143,3 k36539 111,0 k11,1 k      29
abr 20143,3 k36539 111,0 k11,1 k      25
mar 20143,3 k36239 111,0 k11,1 k      29
fev 20143,3 k35939 111,0 k11,0 k       
jan 20143,3 k35439 111,0 k11,0 k      11
dez 20133,3 k35139 111,0 k11,0 k      45
nov 20133,2 k35139 1199811,0 k       
out 20133,2 k34639 1199811,0 k      2
set 20133,2 k34339 1199811,0 k      15
ago 20133,2 k33039 1199611,0 k      418
jul 20132,8 k32639 1196411,0 k      2
jun 20132,8 k32139 119641993      73
mai 20132,8 k32039 119641991      18
abr 20132,8 k31839 119641990      10
mar 20132,8 k31339 119591990      45
fev 20132,7 k30639 119591990       
jan 20132,7 k29839 119591990      1
dez 20122,7 k29739 119591990      7
nov 20122,7 k29139 119591990       
out 20122,7 k29139 119591990       
set 20122,7 k28839 119591990      46
ago 20122,7 k28339 119581990      4
jul 20122,7 k27939 119581990      104
jun 20122,6 k27739 119561984      15
mai 20122,5 k26739 119561984      125
abr 20122,4 k26239 119541982      27
mar 20122,4 k25639 119521938      19
fev 20122,4 k25439 119511938      102
jan 20122,4 k24539 119491938      71
dez 20112,3 k24339 119461935      4
nov 20112,3 k23939 119431935      20
out 20112,3 k22639 119421935      26
set 20112,3 k22139 119421935      6
ago 20112,3 k21739 119421932      86
jul 20112,2 k21039 119381928      3
jun 20112,2 k20139 119381928      43
mai 20112,2 k19839 119361922      85
abr 20112,1 k19239 119301913      3
mar 20112,1 k18539 119301913      26
fev 20112,1 k18539 119261901      19
jan 20112,1 k17939 119251901      279
dez 20101,8 k17339 119161867      17
nov 20101,8 k17139 119131861      170
out 20101,7 k16639 108981820      388
set 20101,6 k16339 108851782      510
ago 20101,4 k15639 108581727      294
jul 20101,3 k14139 108461699      434
jun 20101,2 k14039 108271648      536
mai 20101,0 k12939 107621562      541
abr 201084112739 106711480      1374
mar 201031411835 1462182      22
fev 201031011535 1455177      24
jan 201030811235 1451177      17
dez 200930810235 1451177      40
nov 200929510034 1451177      21
out 20092959834 1451177      61
set 20092959534 1451177      63
ago 20092939134 1451177      36
jul 20092939034 1451177      16
jun 20092938934 1451177      35
mai 20092928534 1450177      43
abr 20092928334 1450177      63
mar 20092917634 1212170      49
fev 20092877333 1105169      103
jan 20092876733 1105169       
dez 20082866733 1105169       
nov 20082866733 1105169       
out 20082865433 1105 69      1
set 20082864333 1105 69       
ago 20082864333 1105 69       
jul 20082864233 1105 69       
jun 20082864233 1105 69      7
mai 20082823632 1105 69      7
abr 20082823332  104 69       
mar 20082823232  104 69      95
fev 20081993132  97 23       
jan 20081993132  97 23       
dez 20071992932  97 23       
nov 20071992732  97 23       
out 20071992732  95 23       
set 20071992431  94 23       
ago 20071992430  93 23       
jul 20071992330  93 23      3
jun 20071992230  92 23       
mai 20071992130  92 23       
abr 20071992130  92 23      89
mar 20071911830  62 1      20
fev 20071901830  57 1       
jan 20071871730  57 1       
dez 20061871730  57 1       
nov 20061871730  57 1      2
out 20061871730  57 1       
set 20061861530  54 1       
ago 20061861430  54 1       
jul 20061841330  54 1      2
jun 20061831230  54 1       
mai 20061831130  54 1      64
abr 20061831130  40         
mar 20061821130  40         
fev 20061821130  40         
jan 20062103  19         
dez 2005241  4         
nov 2005211  3         
out 2005211  3         
set 2005211  3         
ago 2005111            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 галоўная старонка

fev 2006: 1 2 acoustic , 2 1 Мова

abr 2006: 1 1 радзіма

mai 2006: 1 1 радзіма

jul 2006: 1 1 raven

nov 2006: 1 1 index л

mar 2007: 1 1 карова

abr 2007: 1 3 верасень , 2 3 радзіма , 3 2 малако , 4 2 год , 5 2 жнівень , 6 2 абсент , 7 1 index:й

jul 2007: 1 1 Першая старонка

mar 2008: 1 1 らじお

mai 2008: 1 1 Першая старонка

jun 2008: 1 1 Їжа

out 2008: 1 1 мова

fev 2009: 1 1 football

mar 2009: 1 3 абажур , 2 2 курыца , 3 1 венгерская

abr 2009: 1 2 год , 2 2 мова , 3 1 эсперанта

mai 2009: 1 2 год , 2 1 football

jun 2009: 1 1 Main page

jul 2009: 1 1 венгерская

ago 2009: 1 1 林檎

set 2009: 1 1 duck

out 2009: 1 1 duck

nov 2009: 1 1 football

dez 2009: 1 1 Маскаль

jan 2010: 1 1 duck

fev 2010: 1 2 езуіт , 2 2 accounting

mar 2010: 1 2 папка , 2 2 омметр , 3 1 белый

abr 2010: 1 3 mudel , 2 3 панядзелак , 3 3 красавік , 4 3 вайна , 5 3 воўк , 6 2 پنیر , 7 2 keuz , 8 2 Käse , 9 2 ġobon , 10 2 pendir , 11 2 брынзэ , 12 2 brânză , 13 2 পনির , 14 2 पनीर , 15 2 sýr , 16 2 juust , 17 2 caseus , 18 2 siers , 19 2 sūris , 20 2 сирење , 21 2 チーズ

mai 2010: 1 2 об , 2 2 vatn , 3 2 wetter , 4 2 su , 5 2 पाणी , 6 2 лъим , 7 2 woda , 8 2 água , 9 2 һыу

jun 2010: 1 4 смоўж , 2 4 бусел , 3 3 ялавічына , 4 3 бурштын , 5 3 рэпілент , 6 3 валапюк , 7 2 spegel , 8 2 , 9 2 күзгү , 10 2 거울

jul 2010: 1 3 ідыш , 2 3 Маскаль , 3 2 saqaf , 4 2 леведыш

ago 2010: 1 2 serigala , 2 2 борз , 3 2 úlvur

set 2010: 1 2 túbig , 2 2 , 3 2 шыв , 4 2 dowr

out 2010: 1 3 laberint , 2 2 qar , 3 2 sněh

nov 2010: 1 1 fromazy

dez 2010: 1 1 hukarere

jan 2011: 1 1 мед

fev 2011: 1 2 абавязак , 2 2 аазіс , 3 1 ладдзя

mar 2011: 1 1 மணல்

abr 2011: 1 1 история

mai 2011: 1 2 архитектура , 2 1

jun 2011: 1 1 ком

jul 2011: 1 1 месяц

ago 2011: 1 3 альфа , 2 2 кулак , 3 2 Бета

set 2011: 1 1 اسم

out 2011: 1 1 alatsinainy

nov 2011: 1 1 кніга

dez 2011: 1 2 збройні сили

jan 2012: 1 1 прагрэс

fev 2012: 1 1 некалькі

mar 2012: 1 2 сколько , 2 2 колькі , 3 1 абрус

abr 2012: 1 1 кавалак

mai 2012: 1 2 urtxintxa , 2 1 hartz

jun 2012: 1 1 baraf

jul 2012: 1 1 гургум

ago 2012: 1 1 вуха

set 2012: 1 1 зародак

dez 2012: 1 1 каханне

jan 2013: 1 1 слова

mar 2013: 1 1 굶주림

abr 2013: 1 1 мець

mai 2013: 1 2 omăt , 2 1 кароткі

jun 2013: 1 1 Пер-

jul 2013: 1 1 навука

ago 2013: 1 1 πετεηνόν

set 2013: 1 2 ёж , 2 1 радасны

out 2013: 1 1 слова

dez 2013: 1 1 livro

jan 2014: 1 1 уласцівасць

mar 2014: 1 1 платинӕ

abr 2014: 1 1 sinónimo

mai 2014: 1 2 карова , 2 1 дзень

jun 2014: 1 1 päivä

jul 2014: 1 1

ago 2014: 1 1 deň

set 2014: 1 1 дом

out 2014: 1 1 англійская мова

nov 2014: 1 1 andro

dez 2014: 1 2 забойства , 2 1 сонцаварот

jan 2015: 1 1 гук

fev 2015: 1 1 жыхар

mar 2015: 1 1 вывад

abr 2015: 1 1 ўласцівасць

mai 2015: 1 1 цяля

jun 2015: 1 1 ашәахь

jul 2015: 1 1 チーズ

ago 2015: 1 2 курыца , 2 1 вунь

set 2015: 1 1 kiša

out 2015: 1 1 սթափ

nov 2015: 1 1 aṭṭhi

dez 2015: 1 1 ფხიზელი

jan 2016: 1 1 ламбард

fev 2016: 1 1 мяса

mar 2016: 1 1 сауфагæ

abr 2016: 1 2 крэдыт , 2 1 месца

mai 2016: 1 1 дабіцца

jun 2016: 1 1 Федэрацыя

jul 2016: 1 1 балістыка

ago 2016: 1 1 Вікіслоўнік:Спісы Сводзеша для славянскіх моў

set 2016: 1 1 ბალისტიკა

out 2016: 1 2 лізінг , 2 1 страхаванне

dez 2016: 1 1 жывёла

jan 2017: 1 1 ur

fev 2017: 1 1 stridsvagn

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 21 de março 2017 12:53

Dump file bewiktionary-20170301-stub-meta-history.xml.gz (edits only), size 2.4 Mb as gz -> 18 Mb
Dump processed till Feb 28, 2017, on server stat1002, ready at Thu-09/03/2017-17:18 after 19 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.