Estatísticas da Wikcionário fijiano

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2016
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2016    0%   +2%      0%
jul 2016    0%   +52%      0%
jun 2016    0%   -54%      0%
mai 2016    0%   +180%      0%
abr 2016    0%   -32%      0%
mar 2016    0%   +1128%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 20166   31 k 4,9 1,1 k      21
jul 20166   31 k 4,9 1,1 k      21
jun 20166   31 k 4,8 701      21
mai 20166   31 k 4,8 1,5 k      21
abr 20166   31 k 4,8 538      21
mar 20166   31 k 4,8 786      21
fev 20166   31 k 4,7 64      21
jan 20166   31 k 4,7 459      21
dez 20156   31 k 4,7 1,6 k      20
nov 20156   31 k 4,7 1,1 k      19
out 20156   31 k14,6 2,1 k      19
set 20156   31 k 4,6 3,0 k      19
ago 20156   31 k 4,5 2,2 k      19
jul 20156   31 k 4,4 4,1 k      19
jun 20156   31 k 4,3 4,6 k      19
mai 20156   31 k 4,1 1,7 k      19
abr 20156   31 k 4,1 2,0 k      19
mar 20156   31 k 4426206,4 Mb154 k12 k334 k55219
fev 20156   31 k 4423436,4 Mb154 k12 k333 k55219
jan 20156   31 k 4425736,4 Mb154 k12 k333 k55219
dez 20146   31 k14425616,3 Mb154 k12 k331 k55219
nov 20146   31 k 3,942466,3 Mb153 k12 k330 k55219
out 20146   31 k 3,9429356,3 Mb153 k12 k330 k55219
set 20146   31 k 3,9422,8 k6,3 Mb153 k12 k329 k45219
ago 20146   31 k 3,8422,2 k6,2 Mb153 k12 k324 k45219
jul 20146   31 k 3,7425976,2 Mb153 k12 k320 k45219
jun 20146   31 k 3,7422936,2 Mb153 k12 k319 k45219
mai 20146   31 k 3,7423026,2 Mb153 k12 k318 k45219
abr 20146   31 k13,7422816,1 Mb152 k12 k318 k45219
mar 20146   31 k 3,7424826,1 Mb152 k12 k317 k25219
fev 20146   31 k 3,7425416,1 Mb152 k12 k316 k15219
jan 20146   31 k 3,7421,3 k6,1 Mb152 k12 k315 k15219
dez 20136   31 k 3,6422,6 k6,1 Mb152 k12 k312 k15219
nov 20136   31 k 3,5421,1 k6,0 Mb150 k12 k308 k15219
out 20136   31 k 3,5426936,0 Mb150 k12 k306 k15219
set 20136   31 k 3,5422056,0 Mb150 k12 k305 k15219
ago 20136   31 k 3,5423,5 k6,0 Mb150 k12 k305 k15219
jul 20136   31 k 3,4421,8 k5,9 Mb150 k12 k301 k15219
jun 20136   31 k 3,3421,0 k5,9 Mb149 k12 k299 k15219
mai 20136   31 k 3,3422,3 k5,9 Mb149 k12 k297 k15219
abr 20136   31 k 3,2421,5 k5,8 Mb149 k12 k295 k15219
mar 20136   31 k 3,2421,3 k5,8 Mb148 k12 k293 k15219
fev 20136   31 k 3,1421,4 k5,8 Mb148 k12 k291 k15219
jan 20136   31 k 3,1422,6 k5,7 Mb146 k12 k287 k15219
dez 20126   31 k 3423,1 k5,6 Mb144 k12 k283 k15218
nov 20126   31 k 2,9425,6 k5,5 Mb135 k12 k271 k15218
out 20126   31 k6552,74229 k5,1 Mb107 k12 k248 k15218
set 20126   11 k 5,1421,1 k2,7 Mb62 k12 k150 k15217
ago 20126   11 k 5429652,7 Mb62 k12 k149 k15217
jul 20126   11 k 4,9421,1 k2,7 Mb62 k12 k148 k15217
jun 20126   11 k 4,8421,0 k2,6 Mb62 k12 k146 k15217
mai 20126   11 k 4,7421,3 k2,6 Mb62 k12 k144 k15217
abr 20126   11 k 4,6421,7 k2,6 Mb62 k12 k141 k15217
mar 20126 1 11 k 4,4421,1 k2,5 Mb62 k12 k139 k15217
fev 20126   11 k 4,3421,5 k2,5 Mb62 k12 k136 k15217
jan 20126   11 k 4,2421,2 k2,4 Mb62 k12 k132 k 5217
dez 20116   11 k 4,1424,2 k2,4 Mb62 k13 k128 k 5216
nov 20116 1111 k1923,74235 k1,9 Mb62 k13 k94 k 5216
out 201161115,1 k1641,1305,4 k356 kb19 k4,1 k6,9 k  14
set 20115   43 7,3361023 kb282151,2 k  12
ago 20115   43 736123 kb282151,2 k  12
jul 20115   43 736223 kb282151,2 k  12
jun 20115   43 736923 kb282151,2 k  12
mai 20115   42 6,937423 kb279151,1 k  12
abr 20115   42 6,8371422 kb279151,1 k  12
mar 20115   39 739322 kb273151,1 k  12
fev 20115   39 6,939 22 kb273151,1 k  12
jan 20115   39 6,9391122 kb273151,1 k  12
dez 2010511 39 6,6393319 kb27315892  12
nov 20104   27 8,334815 kb16911673  12
out 20104 1 23 9,438515 kb15910653  12
set 20104   23 9,238315 kb15910648  12
ago 20104 1 23 9,1381015 kb15910645  12
jul 20104 1 23 8,7381015 kb15910635  12
jun 20104 1 22 8,6393614 kb15510565  12
mai 2010411 13 11,845205,9 kb104 168  12
abr 20103   11 12,122556,8 kb37412170 2711
mar 20103 1 11 11,622556,8 kb37412170 2711
fev 20103   11 11,222516,7 kb37412165 2711
jan 20103   11 11,122526,7 kb37412164 2711
dez 20093   11 10,9225 6,7 kb37412162 2711
nov 20093   11 10,9225 6,7 kb37412162 2711
out 20093   11 10,9225 6,7 kb37412162 2711
set 20093   11 10,922546,7 kb37412162 2711
ago 20093   11 10,522546,6 kb37412158 2711
jul 20093   11 10,222526,6 kb37412154 2711
jun 200931  11 1022536,5 kb37412152 2711
mai 20092   11 9,722526,5 kb37412149 2711
abr 20092   11 9,5225 6,5 kb37412147 2711
mar 20092   11 9,522536,5 kb37412147 2711
fev 20092   11 9,322546,7 kb37412156 2711
jan 20092   11 8,922526,6 kb37412151 2711
dez 20082   11 8,7225 6,6 kb37412149 2711
nov 20082   11 8,722516,6 kb37412149 2711
out 20082   11 8,622516,6 kb37412148 2711
set 20082   11 8,522566,6 kb37412146 2711
ago 20082   11 8225 6,3 kb37412123 2711
jul 20082   11 822526,3 kb37412123 2711
jun 20082   11 7,822526,2 kb37412117 2711
mai 20082   11 7,622526,2 kb37412117 2710
abr 20082   11 7,5225 6,0 kb3741298 2710
mar 20082   11 7,5225 6,0 kb3741298 2710
fev 20082   11 7,5225 6,0 kb3741298 2710
jan 20082   11 7,5225 6,0 kb3741298 2710
dez 20072   11 7,5225 6,0 kb3741298 2710
nov 20072   11 7,5225 6,0 kb3741298 2710
out 20072   11 7,5225 6,0 kb3741298 2710
set 20072   11 7,5225 6,0 kb3741298 2710
ago 20072   11 7,5225 6,0 kb3741298 2710
jul 20072   11 7,5225 6,0 kb3741298 2710
jun 20072   11 7,522536,0 kb3741298 2710
mai 20072   10 7,923325,8 kb359695 2710
abr 20072   10 7,723315,8 kb359695 2710
mar 20072   10 7,623345,8 kb359694 2710
fev 20072   10 7,223355,7 kb359690 2710
jan 20072   10 6,723345,7 kb359686 2710
dez 20062   10 6,323345,6 kb359684 2710
nov 20062   10 5,923665,6 kb361680 2710
out 20062   10 5,323375,5 kb359675 2710
set 20062   10 4,6233 5,4 kb359662 2710
ago 20062   10 4,6233 5,4 kb359662 2710
jul 20062   10 4,623325,4 kb359662 2710
jun 20062   10 4,4233105,3 kb359662 279
mai 20062   10 3,4233 4,7 kb359612 279
abr 20062   10 3,4233 4,7 kb359612 279
mar 20062   10 3,4233 4,7 kb359612 279
fev 2006211 10 3,4233194,7 kb359612 279
jan 20061   10 1,5233 4,5 kb359612 27 
dez 20051   10 1,5233 4,5 kb359612 27 
nov 20051   10 1,5233 4,5 kb359612 27 
out 20051   10 1,5233 4,5 kb359612 27 
set 20051   10 1,5233 4,5 kb359612 27 
ago 20051   10 1,5233 4,5 kb359612 27 
jul 20051   10 1,5233 4,5 kb359612 27 
jun 20051   10 1,523314,5 kb359612 27 
mai 20051   10 1,4233 4,5 kb35969 27 
abr 20051   10 1,4233 4,5 kb35969 27 
mar 20051   10 1,4233 4,5 kb35969 27 
fev 20051   10 1,423314,5 kb35969 27 
jan 20051   10 1,34811,9 kb72 9   
dez 20041   10 1,2233 4,5 kb35969 27 
nov 20041   10 1,2233 4,5 kb35969 27 
out 20041   10 1,2233 4,5 kb35969 27 
set 20041   10 1,2233 4,5 kb35969 27 
ago 20041   10 1,2233 4,5 kb35969 27 
jul 2004111 10 1,2233124,5 kb35969 27 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 2016124   59 75 60      128
abr 2016123   58 74 57      128
jan 2016123   54 78 59      128
out 2015123   526279 49      128
jul 2015122   51 77 50      128
abr 2015121   51 80 44      128
jan 2015119347443495780109617687824511375128
out 2014119387746486183109527587824311374128
jul 2014118348248475786109597287824211274128
abr 2014118337547465487109577287814211174128
jan 2014117428549445887107507085794212174128
out 2013117437846446286105457084774212174128
jul 2013116408051436385102446882754112173128
abr 2013115378051426587102436779744112071128
jan 2013115458254426786101436576744112070128
out 20121123479484148910076580714212069128
jul 201211147875362685599537791694911968128
abr 2012111397752626558100467791694911968128
jan 201210935775061646698527689685011969128
out 20111093572447279998331041018492118115128
jul 2011115448149125699797121125128127122117115128
abr 2011113337945124609696118125128127122116114128
jan 2011112358050124619393117125128126122116113128
out 2010120349181126609191123126128126122114113128
jul 2010119459590126659191123126128126121113112128
abr 2010125461238212758898912112712612412511171128
jan 2010123311207712660858512212712612312311171128
out 2009121391197912655848412412712612312211071128
jul 2009121391158012659828212012712612312211068128
abr 2009125501147812653797912512712512312211066128
jan 200912259804212558777711612512412111810865128
out 200812136734312462777711312412412111810762127
jul 200811732714512159757511612312311811710360127
abr 200811442774911964717110912212111611410257127
jan 200811243775111759686811012011911511310056127
out 20071113974501156364641081191171131109750127
jul 20071094271441135764641171171151121109553126
abr 20071043976471126161611081141121121099049126
jan 20071014781431086555551021101101081067950126
out 200695386543103535050961041041051057147126
jul 200695396737100524646961031011031006141126
abr 200692385435964942429010396981025240126
jan 20069743573484413737989284881004341118
out 2005903249268035323276837886814035110
jul 2005863043257235292974757279722930105
abr 200579244021663120207372677267233094
jan 200570223519582716165471756961176585
out 200460252916392111115445435443112673
jul 200449162510311855283735423192454
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  1  3  5  10  5  10  1  3  5  10  25  5  10  100 
ago 2016        222  11    11   11 
jul 20161       333             11 
jun 2016        222             11 
mai 2016        222        1       
abr 20161       222  1     11      
mar 20161       221             11 
fev 20162       11                 
jan 201621      222             1  
dez 20151       2221       221  11 
nov 20151       222  1     2    11 
out 2015        3331 2     1    21 
set 2015        3331 2          11 
ago 2015        3331       3    11 
jul 20153       3331 1     1    11 
jun 2015        3331       11111111
mai 20152       3331            11 
abr 201521      333      221    11 
mar 20152       332  2   11     11 
fev 20152       222  31    51   11 
jan 2015        332  1     221  111
dez 20141       332  1     1    111
nov 20141       11   21    2    11 
out 20142       111        21      
set 2014        1111 3     3    1  
ago 20142       2221       31   11 
jul 2014        222                
jun 20141       221                
mai 201411      221        1       
abr 20142       221        5       
mar 20146       221  1     2       
fev 20142       222  1     3       
jan 20141       3321 1     41   11 
jul 20161       333             11 
abr 20161       222  1     11      
jan 201621      222             1  
out 2015        3331 2     1    21 
jul 20153       3331 1     1    11 
abr 201521      333      221    11 
jan 2015        332  1     221  111
out 20142       111        21      
jul 2014        222                
abr 20142       221        5       
jan 20141       3321 1     41   11 
out 20131       111  1     41      
jul 20131       2211       4    1  
abr 20133       6621       41   11 
jan 20131       7731       1       
out 201231      664313     431  11 
jul 20122       762  1     4       
abr 20122       6621 11    111  1  
jan 20123       553        2    21 
out 2011111111111 22   1     51111   
jul 2011             1     21      
abr 201111      1          211     
jan 2011        1          3       
out 2010111                 1       
jul 2010111                         
abr 20102                  51      
jan 20101            1     1111    
out 2009                   2       
jul 20091                  3       
abr 2009                   211     
jan 2009                   111     
out 2008             1     422     
jul 2008                   1       
abr 2008                           
jan 2008             1     2       
out 2007             3     31      
jul 2007                           
abr 2007                           
jan 2007             1     1       
out 2006        1          1       
jul 20061                  1       
abr 2006                           
jan 2006             1     5       
out 2005                           
jul 2005                           
abr 2005                           
jan 20051                          
out 2004                           
jul 2004111                         

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
166100.0%35,448100.0%
31624.2%35,37699.8%
1057.6%35,30999.6%
3223.0%35,25599.5%
10011.5%35,17999.2%
31611.5%35,17999.2%
100011.5%35,17999.2%
316211.5%35,17999.2%
1000011.5%35,17999.2%
3162311.5%35,17999.2%

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
JagwarUC135,179out 31, 20111765out 17, 20121413
InterwicketUC276fev 12, 20092756out 29, 20102132
ŢħėőďŏŗǽUC319abr 24, 20102320mai 28, 20102286
UbuinUC416dez 22, 20102078dez 28, 20102072
Craikabula~fjwiktionaryUC59jul 12, 20044432jul 12, 20044432
TAKASUGI ShinjiUC69nov 15, 20111750jan 18, 20131320
OoswesthoesbesUC79mar 06, 20121638out 23, 20121407
Al SilonovUC89fev 05, 20131302mai 13, 2015475
KusurijaUC96jul 28, 20121494mar 29, 2015520
EspooUC105jan 03, 2016240jan 03, 2016240
YoodhaaUC114abr 06, 20111973jun 02, 20111916
PiRSquared17UC124mai 08, 20121575abr 25, 20131223
PolyglottosUC134nov 11, 20121388nov 11, 20121388
KoreanQuoterUC144fev 21, 20131286mar 04, 2015545
MalaysiaboyUC154fev 20, 2014922ago 16, 2014745
Le diableUC163nov 16, 20102114nov 16, 20102114
Thamizhpparithi MaariUC173jan 27, 20121677fev 08, 20121665
Kubura2UC183ago 23, 20131103mar 11, 2016172
PopolonUC193jan 30, 2014943fev 13, 2014929
Bond127UC203mai 27, 2014826mai 28, 2014825

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 910 edições foram feitas por usuários anônimos, de um total de 153726 edições ( 0e %)
  


18 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC143,775abr 23, 20121590jul 10, 201651--
JAnDbotUC224,786jun 03, 20111915ago 31, 2016---
Bot-JagwarUC321,493dez 30, 20111705dez 12, 2012135720,305-
Luckas-botUC48,247dez 17, 20102083jan 27, 2014946--
YS-BotUC56,239set 07, 20121453out 18, 2015317--
KamikazeBotUC66,237out 18, 20111778mar 07, 20131272--
WikitanvirBotUC71,507abr 18, 20111961jan 19, 20121685--
AvocatoBotUC81,457nov 01, 20111764ago 28, 20131098--
UT-interwiki-BotUC91,336jul 13, 201648ago 31, 2016---
VolkovBotUC10920set 12, 20082909abr 18, 20131230--
WarddrBOTUC11888jul 24, 20121498ago 22, 20131104--
CarsracBotUC12233nov 19, 20121380mai 30, 20131188--
Makecat-botUC13176nov 10, 20121389abr 05, 20131243--
RobotGMwiktUC1442jun 30, 20063714mai 27, 20083017--
GhalyBotUC1519dez 29, 20121340jan 18, 20131320--
SpaceBirdyBotUC165jul 15, 20082968fev 02, 20092766--
RoggBotUC173dez 14, 20102086jan 18, 20112051--
JackBotUC182ago 23, 2014738ago 23, 2014738--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
ago 201631 k3596 1196 111       
jul 201631 k3586 1196 111       
jun 201631 k3586 1196 111       
mai 201631 k3586 1196 111       
abr 201631 k3576 1196 111       
mar 201631 k3566 1196 111       
fev 201631 k3566 1196 111       
jan 201631 k3566 1196 111       
dez 201531 k3566 1196 111       
nov 201531 k3516 1196 111       
out 201531 k3516 1196 111       
set 201531 k3506 1189 111       
ago 201531 k3506 1189 111       
jul 201531 k3506 1188 111       
jun 201531 k3496 1188 111       
mai 201531 k3496 1134 53       
abr 201531 k3496 1134 53       
mar 201531 k3486 1134 53      2
fev 201531 k3486 1134 53      2
jan 201531 k3436 1134 53       
dez 201431 k3416 1134 49      1
nov 201431 k3416 1133 45      2
out 201431 k3396 1133 45      2
set 201431 k3386 1132 45       
ago 201431 k3346 1132 45      3
jul 201431 k3306 1132 45       
jun 201431 k3306 1132 45      1
mai 201431 k3306 1132 45      3
abr 201431 k3306 1132 45      2
mar 201431 k3276 1124 44      6
fev 201431 k3256 1124 44      3
jan 201431 k3216 1124 44      1
dez 201331 k3176 1124 44       
nov 201331 k3176 1124 40       
out 201331 k3146 1124 40      1
set 201331 k3116 1124 40       
ago 201331 k2976 1124 40      2
jul 201331 k2936 1124 40      1
jun 201331 k2896 1124 40      2
mai 201331 k2876 1124 40      1
abr 201331 k2856 1124 40      4
mar 201331 k2816 1124 40       
fev 201331 k2746 1124 40      3
jan 201331 k2686 1124 40      2
dez 201231 k2676 1123 40      2
nov 201231 k2626 1123 40      5
out 201231 k2616 1123 40      6
set 201211 k2566 1120 40       
ago 201211 k2516 1120 40      4
jul 201211 k2486 1120 40      2
jun 201211 k2466 1120 40       
mai 201211 k2376 1120 40      1
abr 201211 k2336 1120 40      2
mar 201211 k2286 1120 40      5
fev 201211 k2266 1120 40      4
jan 201211 k2186 1120 40      4
dez 201111 k2156 1120 40       
nov 201111 k2106 1120 40      18143
out 20115,1 k1956 1101 18      5369
set 2011551896 183 4       
ago 2011551856 183 4       
jul 2011551826 183 4       
jun 2011551746 183 4      1
mai 2011541716 183 4       
abr 2011541666 183 4      3
mar 2011511596 183 4       
fev 2011511596 183 4       
jan 2011511545 183 4       
dez 2010511505 183 4      17
nov 2010391485 183 4      8
out 2010351445  83 4      5
set 2010351435  83 4      3
ago 2010351385  83 4      10
jul 2010351245  83 4      9
jun 2010341245  83 4      16
mai 2010251125  81 2      20
abr 2010221093  80         
mar 2010221023  80         
fev 2010221003  80         
jan 201022983  80         
dez 200922853  80         
nov 200922833  80         
out 200922823  80         
set 200922803  80         
ago 200922763  80         
jul 200922763  80         
jun 200922743  80         
mai 200922723  79         
abr 200922713  79         
mar 200922643  79         
fev 200922623  79         
jan 200922563  79         
dez 200822563  79         
nov 200822563  79         
out 200822433  79         
set 200822323  79         
ago 200822313  79         
jul 200822303  79         
jun 200822303  79         
mai 200821262  79         
abr 200821242  79         
mar 200821242  79         
fev 200821232  79         
jan 200821232  79         
dez 200721222  79         
nov 200721202  79         
out 200721202  79         
set 200721182  79         
ago 20072116   79         
jul 20072114   79         
jun 20072114   79         
mai 20072014   79         
abr 20072014   79         
mar 20072014   79         
fev 20072014   79         
jan 20072014   79         
dez 20062013   78         
nov 20062013   78         
out 20062013   78         
set 20062011   78         
ago 20062010   78         
jul 20062010   78         
jun 2006199   78         
mai 2006198   78         
abr 2006198   78         
mar 2006198   78         
fev 2006198   78         
jan 2006108   78         
dez 2005105   78         
nov 2005101   78         
out 2005101   78         
set 2005101   78         
ago 2005101   78         
jul 2005101   78         
jun 2005101   78         
mai 2005101   78         
abr 2005101   78         
mar 200510    78         
fev 200510    78         
jan 200510    78         
dez 200410    78         
nov 200410    78         
out 200410    78         
set 200410    78         
ago 200410    78         
jul 200410    78         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2004: 1 1 viti

jan 2005: 1 1 Tabana levu

fev 2005: 1 1 Tabana levu

fev 2006: 1 1 Viti

jul 2006: 1 1 main Page

dez 2006: 1 1 Tabana levu

jun 2008: 1 1 Main Page

fev 2009: 1 1 viti

mar 2009: 1 1 viti

mai 2009: 1 1 gone

jun 2009: 1 1 manu

jul 2009: 1 1 viti

ago 2009: 1 1 manu

set 2009: 1 1 tolu

jan 2010: 1 1 manu

fev 2010: 1 1 turaga

mar 2010: 1 1 dua

abr 2010: 1 1 manu

mai 2010: 1 2 yapolo , 2 1 Vosa Vaka-viti

jun 2010: 1 1 bière

jul 2010: 1 1 man

ago 2010: 1 1 man

set 2010: 1 1 papillon

out 2010: 1 1 butterfly

nov 2010: 1 2 yapolo , 2 1 பெண்

dez 2010: 1 1 bebe

abr 2011: 1 1 விலங்கு

jun 2011: 1 1 தேங்காய்

out 2011: 1 1 modig

nov 2011: 1 2 ผู้ชาย , 2 2 писати , 3 2 aujourd'hui , 4 2 don't , 5 2 boil (n) , 6 2 Tabana levu , 7 1 don’t

jan 2012: 1 1 l’

fev 2012: 1 1 আদমি

mar 2012: 1 1 آدمی

abr 2012: 1 2 basikete

mai 2012: 1 1 Tabana levu

jul 2012: 1 1

ago 2012: 1 1

out 2012: 1 1 šiandien

nov 2012: 1 2 owl , 2 1 inkosi

dez 2012: 1 1

jan 2013: 1 1 아니오

fev 2013: 1 1 gnjevan

abr 2013: 1 2 Tabana levu , 2 1 bankovka

mai 2013: 1 1 kort

jun 2013: 1 1 johr

jul 2013: 1 1 אופניים

ago 2013: 1 1 bačva

out 2013: 1 1 plorar

jan 2014: 1 1 簡單

fev 2014: 1 1 中間

mar 2014: 1 1 øje

abr 2014: 1 1 дам

mai 2014: 1 1 سافر

jun 2014: 1 1 извинение

ago 2014: 1 1 Ogos

out 2014: 1 1 pizza

nov 2014: 1 1 ವುತ್ತು

dez 2014: 1 1 tiggare

fev 2015: 1 1 សរសេរ

mar 2015: 1 1 単語

abr 2015: 1 1 testament

mai 2015: 1 1 κόκκινος

jul 2015: 1 1 fiil

nov 2015: 1 1 drugys

dez 2015: 1 1 havayolu

jan 2016: 1 1 es tut mir Leid

fev 2016: 1 1 cumpleaños

mar 2016: 1 1 svijeća

abr 2016: 1 1 icke

jul 2016: 1 1 language

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 18 de setembro 2016 16:51

Dump file fjwiktionary-20160901-stub-meta-history.xml.gz (edits only), size 9.0 Mb as gz -> 71 Mb
Dump processed till Aug 31, 2016, on server stat1002, ready at Wed-07/09/2016-10:04 after 1 min, 19 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.