Estatísticas da Wikcionário malaio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wiktionary malaio

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: maio 2018
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mai 20180%   +1%   +18%      0%
abr 20180%   0%   -62%      0%
mar 20180%   +2%          0%
jan 20180%   0%   -61%      0%
dez 20170%   +1%   +42%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mai 201831 1 3,7 k112,2 40      208
abr 201831 2 3,6 k 12,2 34      208
mar 201831 1 3,6 k212,2 90      207
fev 201831   3,6 k 12,4 7      207
jan 201831 1 3,6 k 12,4 22      207
dez 201731 1 3,6 k112,4 57      207
nov 20173113 3,5 k 12,6 40      207
out 201730 2 3,5 k 12,6 18      207
set 201730 2 3,5 k112,6 47      207
ago 201730 1 3,5 k 12,7 38      207
jul 201730 1 3,5 k 12,7 36      207
jun 201730 1 3,5 k 12,8 31      207
mai 201730 1 3,5 k112,8 32      206
abr 201730   3,4 k 12,9 2,5 k      206
mar 201730 1 3,4 k112,2 429      206
fev 201730   3,4 k 12,1 189      206
jan 20173011 3,4 k 12,1 143      206
dez 201629   3,4 k 12,1 81      206
nov 201629   3,4 k 12 37      206
out 201629   3,4 k 12 90      206
set 201629   3,4 k 12 136      206
ago 201629   3,4 k 12 50      206
jul 201629   3,4 k 11,9 212      206
jun 201629   3,4 k 11,9 993      203
mai 201629   3,4 k 11,6 163      203
abr 201629 1 3,4 k 11,6 40      203
mar 201629   3,4 k 11,6 36      203
fev 201629 1 3,4 k111,6 68      203
jan 201629   3,3 k 11,7 48      203
dez 201529   3,3 k 11,7 72      203
nov 201529 1 3,3 k 11,7 77      203
out 201529 1 3,3 k 11,6 149      203
set 20152912 3,3 k 11,6 119      202
ago 201528 1 3,3 k 11,6 122      202
jul 201528   3,3 k 11,6 54      202
jun 201528 1 3,3 k 11,6 1,5 k      202
mai 201528 1 3,3 k 11,2 48      202
abr 201528 1 3,3 k 11,2 124      202
mar 201528 2 3,3 k211,29631584,2 Mb422 k26 k33 k172135202
fev 2015281423,2 k411,39643414,1 Mb413 k26 k33 k166134194
jan 201527 3 3,1 k311,69592233,9 Mb391 k25 k32 k171126191
dez 201427 1 3,0 k111,89521653,8 Mb374 k24 k31 k172121191
nov 20142712 3,0 k111,9952473,7 Mb368 k23 k31 k172118191
out 201426 213,0 k3129501663,7 Mb363 k23 k31 k172119191
set 201426 212,9 k412,39451943,6 Mb347 k22 k30 k170110191
ago 201426 2 2,8 k112,7954723,4 Mb334 k22 k30 k167102191
jul 201426 1 2,8 k112,7952823,4 Mb330 k22 k29 k16597191
jun 201426 1 2,7 k112,9962703,4 Mb326 k22 k29 k16496191
mai 201426 312,7 k3139672123,3 Mb323 k21 k29 k16496191
abr 201426 212,6 k313,59881943,2 Mb311 k20 k27 k16092191
mar 201426 212,5 k513,910043203,1 Mb299 k20 k27 k16092191
fev 201426 212,3 k114,710522623,0 Mb287 k19 k25 k15583191
jan 20142612 2,3 k 14,810611132,9 Mb283 k19 k25 k15483191
dez 201325 1 2,3 k 14,810601712,9 Mb282 k19 k25 k15483191
nov 201325 2 2,3 k 14,71060482,9 Mb282 k19 k25 k15483191
out 201325 1 2,3 k 14,7105982,9 Mb281 k19 k25 k15483191
set 201325 2 2,3 k 14,71059182,9 Mb281 k19 k25 k15483191
ago 201325 1 2,3 k 14,710592242,9 Mb281 k19 k25 k15483191
jul 201325 2 2,3 k 14,610591522,9 Mb281 k19 k24 k15483191
jun 201325 2 2,3 k 14,610511092,9 Mb278 k19 k24 k15483191
mai 201325 1 2,3 k 14,610551032,9 Mb278 k19 k24 k15483190
abr 201325 1 2,3 k 14,51056992,9 Mb278 k19 k24 k15483190
mar 201325 1 2,3 k 14,51058972,9 Mb277 k19 k24 k15583190
fev 201325 2 2,3 k214,510572682,9 Mb277 k19 k24 k15582190
jan 201325 2 2,2 k214,811162322,8 Mb274 k19 k20 k15527190
dez 201225 1 2,1 k 15,211311472,8 Mb274 k19 k20 k15526190
nov 201225 1 2,1 k115,111311332,8 Mb274 k19 k19 k15527190
out 201225   2,1 k 15,211382182,7 Mb269 k19 k19 k15626187
set 201225   2,1 k 15,111371772,7 Mb268 k19 k19 k15626187
ago 201225 1 2,1 k 1511311612,7 Mb267 k19 k19 k15626187
jul 20122511 2,1 k 1511301012,7 Mb266 k19 k19 k15626187
jun 201224 2 2,1 k 1511241822,7 Mb264 k19 k19 k15626187
mai 201224 2 2,1 k 14,911251552,7 Mb263 k19 k18 k15626186
abr 201224 1 2,1 k 14,911271252,7 Mb263 k19 k18 k15526186
mar 201224 1 2,1 k 14,811271212,7 Mb263 k19 k18 k15526186
fev 201224 1 2,1 k 14,811271592,7 Mb262 k19 k18 k15526186
jan 2012241  2,1 k 14,711222462,7 Mb261 k19 k18 k15526186
dez 20112314 2,1 k114,611213452,7 Mb261 k19 k17 k15526186
nov 201122 1 2,1 k 14,611291332,6 Mb257 k19 k16 k15525186
out 20112223 2,1 k 14,611321132,6 Mb256 k19 k16 k15525186
set 201120   2,0 k 14,61129272,6 Mb254 k18 k16 k15425186
ago 201120 1 2,0 k 14,61129572,6 Mb254 k18 k16 k15425185
jul 201120   2,0 k 14,611291882,6 Mb254 k18 k16 k15425185
jun 201120   2,0 k 14,51130472,6 Mb254 k18 k16 k15425185
mai 201120 1 2,0 k 14,511302602,6 Mb254 k18 k16 k15425184
abr 201120 1 2,0 k 14,41131912,6 Mb253 k18 k16 k15425184
mar 201120   2,0 k 14,411301312,6 Mb253 k18 k15 k15425184
fev 201120 1 2,0 k 14,31131712,6 Mb253 k18 k15 k15425184
jan 201120   2,0 k 14,31131522,6 Mb253 k18 k15 k15425184
dez 201020   2,0 k 14,31131762,6 Mb253 k18 k15 k15525184
nov 201020 112,0 k 14,211316702,6 Mb253 k18 k15 k15525184
out 201020 112,0 k 13,911312682,6 Mb253 k18 k15 k15525184
set 201020 112,0 k 13,811313162,6 Mb253 k18 k14 k15525184
ago 2010201212,0 k 13,611311552,6 Mb253 k18 k14 k15525184
jul 201019 212,0 k 13,511315342,6 Mb253 k18 k14 k15523184
jun 201019 2 2,0 k 13,311321012,5 Mb253 k18 k13 k15523184
mai 201019 312,0 k 13,311313632,5 Mb252 k18 k13 k15523184
abr 2010191422,0 k 13,111261,3 k2,5 Mb250 k18 k13 k15923184
mar 201018 322,0 k 12,511034592,5 Mb244 k18 k13 k16523184
fev 2010181322,0 k 12,311057182,4 Mb243 k18 k13 k16923184
jan 201017 412,0 k 1210891,1 k2,4 Mb239 k18 k12 k17422184
dez 200917 322,0 k 11,510701,3 k2,4 Mb234 k18 k12 k17722184
nov 200917 322,0 k 10,910481,0 k2,3 Mb228 k18 k12 k18022184
out 2009171422,0 k 10,410351,1 k2,2 Mb224 k18 k12 k18322184
set 200916 322,0 k 9,910198342,2 Mb219 k18 k12 k19422184
ago 200916 312,0 k29,510173832,1 Mb216 k17 k12 k19622184
jul 200916 311,9 k 9,610312642,1 Mb209 k16 k11 k19922184
jun 200916 321,9 k19,510261,1 k2,1 Mb208 k16 k11 k20122184
mai 200916 321,9 k 910329732,0 Mb206 k16 k11 k20222184
abr 200916 321,9 k 8,510295352,0 Mb204 k16 k11 k20422184
mar 200916 311,9 k 8,310306152,0 Mb203 k16 k11 k20820184
fev 2009161411,9 k 810293132,0 Mb202 k16 k9,8 k21120184
jan 200915 1 1,9 k 7,91032482,0 Mb201 k16 k9,1 k21520184
dez 20081511 1,9 k 7,91032562,0 Mb199 k16 k9,0 k22320184
nov 200814 3 1,8 k17,910271081,9 Mb198 k16 k9,0 k22320183
out 200814 3 1,8 k27,910372541,9 Mb196 k16 k8,8 k22320183
set 2008141311,8 k 810754371,9 Mb195 k16 k8,7 k22320183
ago 200813 2 1,8 k 7,81068691,9 Mb192 k15 k8,6 k22320183
jul 200813 1 1,8 k 7,81069681,9 Mb191 k15 k8,5 k22320183
jun 200813 1 1,8 k17,710681061,9 Mb190 k15 k8,5 k22320183
mai 200813 2 1,7 k 7,810642871,8 Mb186 k15 k8,3 k22120183
abr 200813 211,7 k27,710604461,8 Mb183 k15 k7,9 k22020183
mar 200813 221,7 k37,710426731,7 Mb170 k14 k7,7 k24720183
fev 200813 221,6 k127,610401,9 k1,6 Mb155 k13 k6,9 k24120180
jan 2008131311,2 k88,210251,0 k1,0 Mb92 k7,0 k4,3 k18411179
dez 20071224 97519,31047119599 kb46 k1,3 k2,2 k1085178
nov 200710 1 947 9,5109225582 kb44 k1,2 k2,1 k1095177
out 200710 21941 9,510831,1 k570 kb43 k1,2 k2,1 k1085176
set 200710 31934 8,41049653531 kb41 k1,2 k2,0 k1066176
ago 200710 21921 7,810851,6 k504 kb39 k1,1 k2,0 k1096176
jul 200710 21909 6,21027828423 kb36 k1,0 k1,9 k1086176
jun 200710 21896 5,4997964373 kb33 k9801,9 k1046150
mai 200710 31886 4,3865869315 kb27 k9251,8 k1026149
abr 200710 21874203,4827734259 kb24 k8581,7 k976149
mar 200710 21271 8,3830565240 kb23 k7941,6 k866130
fev 200710 2125816,5767516215 kb19 k7271,7 k805744
jan 20071023123115,1681376170 kb15 k5951,4 k583041
dez 2006811 190 4,271540124 kb11 k3791,1 k17308
nov 20067 1 179 4,269435110 kb9,6 k3018831308
out 20067 2 171 4,26437097 kb8,2 k2447721308
set 20067 1 162 45574978 kb6,2 k185696 308
ago 20067 2116013,757815373 kb5,4 k156564 448
jul 2006712112423,645115853 kb3,7 k124496 448
jun 20066 2 72 44652945 kb3,3 k107458 447
mai 2006611 65 44212835 kb2,2 k97326 446
abr 20065   52 4,4465332 kb1,9 k97248 456
mar 20065 1 51 4,54811432 kb1,8 k97248 456
fev 2006511 47 4,53784626 kb1,3 k77233 456
jan 20064   45 3,7378226 kb1,3 k77225 45 
dez 20054   45 3,7378726 kb1,3 k77223 45 
nov 2005411 43 3,73781724 kb1,3 k7793 45 
out 20053   35 4436124 kb1,3 k7793 45 
set 20053   35 4436524 kb1,3 k7793 45 
ago 20053   35 3,9287452 kb8875933   
jul 20053   33 44813222 kb1,3 k7023 45 
jun 20053   33 3490221 kb1,3 k6826 45 
mai 20053   33 2,9490221 kb1,3 k6823 45 
abr 20053   33 2,9491 21 kb1,3 k6823 45 
mar 20053   33 2,9491 21 kb1,3 k6823 45 
fev 20053   33 2,9491421 kb1,3 k6823 45 
jan 20053   32 2,8491321 kb1,3 k6823 45 
dez 20043   32 2,8491 21 kb1,3 k6723 45 
nov 20043   32 2,8491121 kb1,3 k6723 45 
out 20043   32 2,7491321 kb1,3 k6723 45 
set 20043   31 2,7491221 kb1,3 k6723 45 
ago 20043   31 2,6491 21 kb1,3 k6713 45 
jul 2004311 3112,64914121 kb1,3 k6713 45 
jun 20042 1 15 2,7517916 kb1,1 k526 45 
mai 20042   14 2,3548216 kb1,0 k525 45 
abr 20042   12 2,538525,0 kb612425   
mar 20042   12 2,334264,5 kb541424   
fev 20042   12 1,8349 4,7 kb553424 2 
jan 20042   12 1,8349 4,7 kb553424 2 
dez 2003211 12 1,8349124,7 kb553424 2 
nov 2003111 6 1,7275102,0 kb219214 2 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201868 46 101 7 61      147
jan 201866 61 101 7 74      147
out 201766 45 101 7 69      147
jul 201766 57 101 7 65      147
abr 201766   101 6 64      147
jan 2017663359 100 6 105      147
out 201666   100 6 94      147
jul 201665   100 6 91      147
abr 201664 57 100 6 105      147
jan 201664   98 7 102      147
out 201563 62 97 7 100      147
jul 201564   97 7 118      147
abr 201564 68 97 8 96      147
jan 20156437434397427478857069925855147
out 20146440463896425477857169915754147
jul 20146234584897554493867171915558147
abr 20146031453596414465847173915558147
jan 20146031454995593489846970915558147
out 201360435846956134114846969895458147
jul 20136039485193643484816868875657147
abr 20135836665193653387816767875656147
jan 20135845535493542286796466925481147
out 20125636824993641285786465885479147
jul 20125538685491701297766265875480147
abr 20125739635290661289766266855480147
jan 20125430805089641280746166835281147
out 20115718454988681290726164795182147
jul 20116044834984701274716164774982147
abr 20115833614582611287696064764780147
jan 20115435815080611392676063764678147
out 20105337855679601372676062754576147
jul 20105545626376671468655660754275147
abr 20105336453573581449635558723976147
jan 20105533415470611346625555693775147
out 20095536454070562449625455693776147
jul 20095440515771592369615255683473147
abr 20095352463568535358605153682972147
jan 20095161664268596374605050672772147
out 20085036394367456351595048652869146
jul 20085032534666596379584948632668146
abr 20084842473966497351554543622564146
jan 20084738404265332242585156642676146
out 2007504247406663646432675976702782146
jul 2007494548366659646434706175702480145
abr 2007474049356322616146716276692176145
jan 2007452036347453555555726578642450145
out 2006504048436852505071726784656546145
jul 2006473237326738464653717182666335145
abr 2006543955357049424277687174635535145
jan 2006544861346641373792677073544537137
out 2005543451266336323270606467594129121
jul 2005483444246035292946525658663025116
abr 2005452543215031202078495554602422103
jan 200540243619432816165042434454182390
out 200429273116332111114134333635112176
jul 200424132410241655202528292991255
abr 20049785954413991075819
jan 2004744374331088774616
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  1000  2500  5  10  100 
mai 201831111      211       31          
abr 20185221       1         31111       
mar 201852111      41        211         
fev 201821        4         41          
jan 2018211        1         1           
dez 201721111      1         22111       
nov 20174332       1         111      11 
out 2017322                  21          
set 20173222       221       42211       
ago 20173311       3         33111       
jul 201733111      211       2111     211
jun 20174211       51        9331        
mai 201711111                1111     1  
abr 201731    22112         31111    21 
mar 201732111  332 1         5211111     
fev 201731    33  2         9111     1  
jan 201711111  33            1           
dez 20161     21  1                     
nov 201632    31                     11 
out 20161     22                     22 
set 20161     321 1         1111     21 
ago 20162     33  11        21       11 
jul 20163     431           2211     111
jun 2016      332 2         3        11 
mai 20162     22  1         21          
abr 2016321    22  2         31111       
mar 20161     11  1                  11 
fev 201622111      2         2111        
jan 20161     11  2         1        11 
abr 20185221       1         31111       
jan 2018211        1         1           
out 2017322                  21          
jul 201733111      211       2111     211
abr 201731    22112         31111    21 
jan 201711111  33            1           
out 20161     22                     22 
jul 20163     431           2211     111
abr 2016321    22  2         31111       
jan 20161     11  2         1        11 
out 20152111   32            3111     21 
jul 2015      22  2         6        11 
abr 20151111   22  21     222422111   221
jan 201574322  22  4321      5543221  11 
out 2014332211                633221      
jul 201453111  11  211       4331        
abr 2014322211  1   1111      8221        
jan 2014222    21  2111      521         
out 2013211        211       532111      
jul 201322221  111 111       6111        
abr 20132111   21  111       4111        
jan 201322211  221 22        42221    11 
out 201221    221 21        6211     1  
jul 20124211   21  311       14322        
abr 20123111   43  221       533         
jan 2012      321 2         6        21 
out 20113332   32  2111      711      11 
jul 2011      331 1         21          
abr 201121111  21            421         
jan 20112     11  1         41          
out 20102111111     31        5221        
jul 20104221111     211       11          
abr 20106444422     42111     741      11 
jan 20104443311     211111    5333        
out 20096443321     322111    733111      
jul 2009433331      22111     5222111  11 
abr 20094333221     42111     7432111     
jan 20093111   11  832111    11531111  11 
out 200853333  11  844311    1477521111   
jul 200821111  1   42211     54211111    
abr 2008222221  11  422111    42211111    
jan 20085333311 11  444211    53333111    
out 200722221111    31        3322111     
jul 20072222111 11  54311     4433111     
abr 20072222211 11  22111     2222111     
jan 2007333331  11  321       4332        
out 20062221   11  1         3111        
jul 2006322211      21        5           
abr 20061                               
jan 2006                    2           
out 2005                                
jul 2005                                
abr 2005                                
jan 2005                                
out 2004                                
jul 200421111                1111        
abr 20042                   1           
jan 2004                    2111        

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1138100.0%29,398100.0%
35137.0%29,27899.6%
103021.7%29,16399.2%
321813.0%28,97398.6%
10096.5%28,46696.8%
31664.3%27,96295.1%
100042.9%27,13892.3%
316221.4%23,27679.2%
1000010.7%18,45062.8%

 

3 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
AuroraUC3 02,02411,5925set 17, 20054638214-5433
TofeikuUC4 01,838298349nov 04, 20131668991204408
AinianishaUC137...11--mai 26, 20184----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
On Wheezier PlotUC118,450jul 24, 20064328out 20, 20102779
InterwicketUC24,826jan 29, 20093408nov 08, 20102760
26 RamadanUC5458dez 01, 20112372mar 08, 201883
SNN95UC6366abr 23, 20131863abr 27, 201833
PM PoonUC7262set 22, 20054633ago 13, 20064308
KamalzackUC8136ago 12, 20112483dez 02, 2015910
KurniasanUC9106set 23, 20083536jan 25, 20112682
Jeluang TerluangUC1088set 29, 2016608fev 01, 2018118
Amir Hamzah 2008UC1173out 20, 20112414ago 02, 20122127
YosriUC1272nov 10, 20035315mar 31, 201860
WhjaygUC1360jan 17, 20083786fev 28, 20083744
AlamnirvanaUC1455abr 06, 20102976abr 18, 20112599
Sa'yUC1548fev 06, 20151209mar 08, 20151179
Khairulkhalid~mswiktionaryUC1639jun 30, 20045082jul 21, 20045061
Putera Luqman Tunku AndreUC1733dez 23, 20073811jan 01, 20083802
Jufert~mswiktionaryUC1831jan 17, 20074151mar 11, 20074098
CommonsDelinkerUC1929nov 09, 20073855mar 12, 201879
Thijs!botUC2018ago 22, 20064299jun 20, 20073997
ZfcUC2116nov 07, 20054587nov 07, 20054587
MunshiUC2214ago 25, 20102835ago 25, 20102835

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 2.467 edições foram feitas por usuários anônimos, de um total de 44.617 edições ( 5e %)
  


17 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC17,112mai 23, 20112564abr 30, 2017395--
Luckas-botUC21,499fev 03, 20103038jan 27, 20141584--
UT-interwiki-BotUC31,139jun 27, 2016702abr 17, 2017408--
VolkovBotUC4591jan 31, 20083772mar 22, 20131895--
OctraBotUC5590jul 30, 2016669abr 13, 2017412--
RobotGMwiktUC6527set 05, 20064285jun 06, 20083645--
JAnDbotUC7375mai 01, 20074047dez 20, 2016526--
YS-BotUC8364dez 27, 20121980out 18, 2015955--
KamikazeBotUC9281dez 04, 20112369mar 07, 20131910--
AvocatoBotUC10208out 31, 20112403ago 03, 20131761--
SieBotUC1116jun 04, 20074013fev 04, 20083768--
Makecat-botUC1216nov 10, 20122027jan 23, 20131953--
CarsracBotUC1314dez 28, 20121979mai 30, 20131826--
EdmundobotUC1411dez 29, 20083439dez 29, 20083439--
EscarbotUC155nov 28, 20064201dez 19, 20073815--
AlexbotUC162jan 20, 20083783jan 20, 20083783--
QualiaBotUC172jul 23, 20083598jul 27, 20083594--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
mai 20183,9 k78544141521,5 k3396       13
abr 20183,9 k78544031521,5 k3396       12
mar 20183,8 k78444031521,5 k3396       12
fev 20183,8 k78444031521,5 k3396       12
jan 20183,8 k78044031521,5 k3396       12
dez 20173,8 k78044031521,5 k3396       12
nov 20173,7 k77844031521,5 k3394       12
out 20173,7 k77844031521,5 k3394       12
set 20173,7 k77844031521,5 k3394       12
ago 20173,7 k77644031521,5 k3394       12
jul 20173,7 k77644031521,5 k3394       12
jun 20173,7 k77644031521,5 k3394       12
mai 20173,7 k77444031521,5 k3394       12
abr 20173,6 k77443931521,5 k3394       12
mar 20173,6 k77443931521,5 k3394       12
fev 20173,6 k77343831511,4 k3389       12
jan 20173,6 k77143731511,4 k3389       12
dez 20163,6 k77143731511,4 k3389       12
nov 20163,6 k77143731511,4 k3389       12
out 20163,6 k77143731511,4 k3389       12
set 20163,6 k77143731511,4 k3389       12
ago 20163,6 k77143731511,4 k3389       12
jul 20163,6 k77043731511,4 k3389       12
jun 20163,6 k77043631511,4 k3375       12
mai 20163,6 k77043631511,4 k3375       12
abr 20163,6 k76943631511,4 k3375       12
mar 20163,6 k76843631511,4 k3375       12
fev 20163,6 k76843631511,4 k3375       12
jan 20163,5 k76843631511,4 k3375       12
dez 20153,5 k76843631511,4 k3375       12
nov 20153,5 k76343631511,4 k3375       12
out 20153,5 k76343631511,4 k3375       12
set 20153,5 k76343631511,4 k3375       12
ago 20153,5 k76343631511,4 k3374       12
jul 20153,5 k76343531511,3 k3374       12
jun 20153,5 k76143531511,3 k3374       12
mai 20153,5 k76143531511,3 k3374       12
abr 20153,5 k76143531511,3 k3370       12
mar 20153,5 k75943531511,3 k3265      11412
fev 20153,4 k75841531511,3 k3242      30212
jan 20153,3 k7134103631,1 k3232      16312
dez 20143,2 k7043973639823231      6112
nov 20143,2 k7043973639663229      4512
out 20143,2 k7013973639413229      16612
set 20143,1 k7003973638423228      19112
ago 20143,0 k6963973638353228      6012
jul 20143,0 k6923973638333227      6812
jun 20142,9 k6923973638253227      4512
mai 20142,9 k6923973638243227      19112
abr 20142,8 k6923973638193227      18312
mar 20142,7 k6903973638093227      29912
fev 20142,5 k6873973637933227      13612
jan 20142,5 k6833973637643224      1612
dez 20132,5 k6783963637633224      1012
nov 20132,5 k6783963637593224      4212
out 20132,5 k6723963637593224      712
set 20132,5 k6643963637553222      1712
ago 20132,5 k6513963637553222      912
jul 20132,5 k6483963637553222      4812
jun 20132,5 k6463963637542222      5212
mai 20132,5 k6453963607541219      1112
abr 20132,5 k6433963607541219      1912
mar 20132,5 k6393963597481218      2612
fev 20132,5 k6333963577451218      7712
jan 20132,4 k6273963577451217      7512
dez 20122,3 k6183953577421214      712
nov 20122,3 k6133953577401214      5712
out 20122,3 k6083953577171211      512
set 20122,3 k6033953577101211      312
ago 20122,3 k5993953577021210      3312
jul 20122,3 k5963953576951208      1812
jun 20122,3 k5913953576881204      1212
mai 20122,3 k5813943576831203      2212
abr 20122,3 k5783943576731202      2212
mar 20122,3 k5713943576711201      2312
fev 20122,3 k5703943576711201      912
jan 20122,3 k5653943576681201       12
dez 20112,3 k5593943576681201      6012
nov 20112,3 k5453943556451200      3612
out 20112,2 k5343943556441199      3212
set 20112,2 k5303943556441199      412
ago 20112,2 k5273943556441199      912
jul 20112,2 k5233943556441199       12
jun 20112,2 k5163943556441199      412
mai 20112,2 k5133943556341199      1712
abr 20112,2 k5093943556341199      3012
mar 20112,2 k5043943556321195      112
fev 20112,2 k5013943556321195      1712
jan 20112,2 k4963933556321195      212
dez 20102,2 k4933933556321195       12
nov 20102,2 k4923933556321195      66812
out 20102,2 k4883933556321195      26612
set 20102,2 k4853923556321195      31612
ago 20102,2 k4793923556321195      14912
jul 20102,2 k4663923556321195      53412
jun 20102,2 k4663923556321195      10012
mai 20102,2 k4583923556321195      36312
abr 20102,2 k4573893556301195      126312
mar 20102,2 k4513893556301195      45912
fev 20102,2 k4463893556061194      71412
jan 20102,2 k4423893556031194      109412
dez 20092,2 k4313893556021194      131612
nov 20092,2 k4303893556001194      102412
out 20092,2 k4293893556001194      107812
set 20092,2 k4263893556001194      81812
ago 20092,2 k4213893556001193      32612
jul 20092,1 k4213693555951193      25012
jun 20092,1 k4203663555841182      104512
mai 20092,1 k4173663555751177      95312
abr 20092,1 k4143653555391171      52312
mar 20092,1 k4043643555371166      61312
fev 20092,1 k4013643555371166      30612
jan 20092,0 k3953633555371165      2412
dez 20082,0 k3873633555371165      3012
nov 20082,0 k3833633555311160      8312
out 20082,0 k3683603515261157      23812
set 20082,0 k3563593495181155      41512
ago 20081,9 k3523591495141155      631 
jul 20081,9 k3043591485121153      551 
jun 20081,9 k3023591485101153      241 
mai 20081,9 k2533591475101152      891 
abr 20081,9 k2093201475081152      2131 
mar 20081,8 k1653201474881146      4891 
fev 20081,8 k1602631474631143      7821 
jan 20081,4 k158185143377182      5761 
dez 20071,2 k15695143169133      1111 
nov 20071,1 k11290143151132      191 
out 20071,1 k11076142145131      10561 
set 20071,1 k10976142137131      6281 
ago 20071,1 k10775142128130      15441 
jul 20071,1 k10675142111127      7941 
jun 20071,0 k8674 42110127      954  
mai 20071,0 k8572 41108127      831  
abr 20071,0 k8556 4189127      699  
mar 20074018544 4174126      488  
fev 20073028533 397018      469  
jan 20072728427 394814      315  
dez 20061988225 394014      14  
nov 20061878225 394013      12  
out 20061798125 393912      24  
set 20061708024 393912      10  
ago 20061681122 393412      149  
jul 20061321122 392911      151  
jun 200679921 392811      25  
mai 200671921 392211      18  
abr 200658818 392011      1  
mar 200657818 392011      13  
fev 200653818 391711      42  
jan 200645718 391711         
dez 200545618 391611      1  
nov 200543316 391611      16  
out 200535310 39161          
set 20053539 39161          
ago 20053539 39161          
jul 20053338 3916           
jun 20053338 3916           
mai 20053338 3816           
abr 20053328 3816           
mar 20053318 3816           
fev 20053318 3816           
jan 20053217 3816           
dez 20043217 3816           
nov 20043217 3716           
out 20043217 3716           
set 20043117 3716           
ago 20043117 3716           
jul 20043117 3716           
jun 200415 4 3716           
mai 200414 2 3316           
abr 200412   3316           
mar 200412   3216           
fev 200412   208           
jan 200412   135           
dez 200312   12           
nov 20036                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2003: 1 2 etnologi , 2 1 arkeologi

dez 2003: 1 1 khazanah

mar 2004: 1 1 arkeologi

abr 2004: 1 2 arkeologi

mai 2004: 1 1 nga'dau

jun 2004: 1 2 ajal , 2 1 nga'dau

jul 2004: 1 2 abang , 2 1 abandon

set 2004: 1 1 ajal

fev 2005: 1 1 abang

mai 2005: 1 1 haiwan

set 2005: 1 1 arkeologi

nov 2005: 1 1 gedung

dez 2005: 1 1 bonggol

fev 2006: 1 2 cadang , 2 1 arkeologi

mar 2006: 1 1 ajal

abr 2006: 1 1 Laman Utama

mai 2006: 1 2 Laman Utama , 2 1 rumah

jun 2006: 1 1 bacaan

jul 2006: 1 1 Kamus bahasa Indonesia/Un

ago 2006: 1 2 Bumi , 2 1 Kamus bahasa Indonesia/Is

set 2006: 1 1 Wiktionary

out 2006: 1 1 perempuan

nov 2006: 1 1 e

dez 2006: 1 1 l

jan 2007: 1 2 v , 2 2 u , 3 2 t , 4 2 r , 5 2 q , 6 1 penomboran

fev 2007: 1 3 sering , 2 2 sembilan , 3 2 lapan , 4 2 tujuh , 5 2 enam , 6 2 lima , 7 2 empat , 8 2 tiga , 9 2 dua , 10 2 satu , 11 2 sifar , 12 2 3 , 13 2 2 , 14 1 kerap

mar 2007: 1 3 Laman Utama , 2 2 on'yomi , 3 2 , 4 2 agama , 5 2 agar , 6 1 kesembilan-sembilan

abr 2007: 1 1 senarai perkataan Z

mai 2007: 1 2 saat , 2 2 perisian , 3 2 hasil , 4 1 rawak

jun 2007: 1 2 badak , 2 1 Kamus Wiki

jul 2007: 1 1 luah

ago 2007: 1 2 Rumi , 2 2 riadah , 3 2 pusing , 4 2 bisa , 5 1 etnologi

set 2007: 1 2 cereka , 2 2 fiksyen , 3 2 seram , 4 2 luak , 5 2 ubat , 6 2 baru , 7 2 imbas , 8 2 alpa , 9 2 pusing , 10 2 rawak , 11 2 karut , 12 2 wahana , 13 2 , 14 2 sering , 15 2 aduk , 16 2 aduhai , 17 2 aduh , 18 2 acuh , 19 2 acap , 20 2 abiotik

out 2007: 1 2 catur , 2 2 besar , 3 1 buah

nov 2007: 1 2 b , 2 1 banci

dez 2007: 1 3 musuh , 2 3 sahabat , 3 3 rakan , 4 2 jalan

jan 2008: 1 3 muzik klasikal , 2 3 opera , 3 3 respons , 4 3 suka , 5 2 kami , 6 2 kita , 7 1

fev 2008: 1 3 kucing , 2 3 perah , 3 2 kad , 4 2 kanji , 5 2 kaki , 6 2 hidung , 7 2 telinga , 8 2 datang , 9 2 tangan , 10 2 bahasa , 11 2 anjing , 12 2 negara , 13 2 nama , 14 2 malam , 15 2 petang , 16 2 pagi , 17 2 subuh , 18 2 bintang , 19 1 Rabu

mar 2008: 1 2 planet , 2 2 Neptun , 3 1 kronik

abr 2008: 1 2 utara , 2 2 barat , 3 2 tinggi , 4 2 timur , 5 2 kayu , 6 1 oren

mai 2008: 1 2 putih mata , 2 2 biru , 3 2 hijau , 4 1 hitam

jun 2008: 1 2 tawar , 2 1 celaka

jul 2008: 1 1 mustahil

ago 2008: 1 2 mışıq , 2 1 laksa

set 2008: 1 4 percuma , 2 3 celaka , 3 2 mangga , 4 1 nga'dau

out 2008: 1 3 manre , 2 3 wedding , 3 3 indo , 4 3 seddi , 5 3 istilah , 6 3 sekolah , 7 3 resonance , 8 2 pepek , 9 2 short story , 10 2 cerpen , 11 2 golok , 12 2 تاهي , 13 2 tahi , 14 2 kau , 15 2 lampe , 16 1

nov 2008: 1 2 suasa , 2 2 tollolang , 3 2 Mesia , 4 2 slave , 5 2 hamba

dez 2008: 1 2 doorknob , 2 2 tombol pintu , 3 1 leksikon

jan 2009: 1 1 wombat

fev 2009: 1 2 tadbir , 2 2 bomoh , 3 2 dukun , 4 2 pawang , 5 2 doktor , 6 2 ahli perubatan , 7 2 tabib , 8 2 tabah , 9 2 pedati , 10 1 kala

mar 2009: 1 2 kerajaan , 2 2 din , 3 2 kala , 4 2 tabah , 5 2 meong , 6 2 golok , 7 2 zaměření , 8 2 seddi , 9 2 歡迎 , 10 2 keramat , 11 2 kronik , 12 2 hari , 13 2 negara , 14 2 petang , 15 2 Zuhal , 16 2 Marikh , 17 2 candu , 18 2 tahil , 19 2 lelaki , 20 2 imbas , 21 2 Rumi , 22 2 obor , 23 1 hak

abr 2009: 1 2 ข้าว , 2 2 , 3 2 kad , 4 2 , 5 2 , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 opera , 11 2 , 12 2 snek , 13 2 muda , 14 1 manusia

mai 2009: 1 2 perkasa , 2 2 pustaka , 3 2 kaut , 4 2 pawang , 5 2 meong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 世界 , 13 2 , 14 2 , 15 2 , 16 2 , 17 2 , 18 2 國家 , 19 2 , 20 2 国家 , 21 2 , 22 2 , 23 2 , 24 2 bintang , 25 2

jun 2009: 1 2 الله , 2 2 keju , 3 2 terjemah , 4 2 , 5 2 gong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 daging , 16 2 , 17 2 , 18 2 , 19 2 , 20 2 森林 , 21 2 , 22 2 , 23 2 , 24 2 , 25 2

jul 2009: 1 3 DB , 2 2 rasa , 3 2 عيسى , 4 2 planet , 5 2 , 6 2 語言 , 7 2 , 8 2 , 9 2 alpa , 10 2 kasut , 11 2 awam , 12 2 iman , 13 2 dekad , 14 1 zat

ago 2009: 1 2 bateri , 2 2 cendawan , 3 2 pekak , 4 2 basikal , 5 2 timur , 6 2 parti , 7 2 jam , 8 2 ikan , 9 2 api , 10 2 bahasa , 11 2 besar , 12 2 dam , 13 2 gering , 14 2 dan , 15 2 sering , 16 1

set 2009: 1 2 , 2 2 , 3 2 , 4 2 askar , 5 2 kampung , 6 1

out 2009: 1 2 pelacur , 2 2 adalah , 3 2 ialah , 4 2 aktif , 5 2 ketam , 6 2 manusia , 7 2 itu , 8 2 Braille , 9 2 putih , 10 2 kayu , 11 2 hidung , 12 2 jantung , 13 2 ular , 14 2 kami , 15 2 naga , 16 2 harimau , 17 2 kuda , 18 2 orang , 19 2 sungai , 20 2 alas , 21 2 sudu , 22 1 bahari

nov 2009: 1 2 hitung , 2 2 pelacur , 3 2 arkeologi , 4 2 tropika , 5 2 bunga , 6 2 ya , 7 2 pagi , 8 2 suka , 9 2 legenda , 10 2 ais , 11 2 abai , 12 2 abactinal , 13 2 abad , 14 1 bahari

dez 2009: 1 2 logam , 2 2 album , 3 2 lari , 4 2 tangan , 5 2 petang , 6 2 mulut , 7 2 Tahun Baru , 8 2 ibu , 9 2 Matahari , 10 2 balai , 11 2 padi

jan 2010: 1 3 karya , 2 2 hitam , 3 2 katak , 4 2 atas , 5 2 padat , 6 2 kanji , 7 2 kaki , 8 2 sayang , 9 2 bambu , 10 1 rona

fev 2010: 1 3 monsun , 2 2 biologi , 3 2 kronik , 4 2 makan , 5 2 Neptun , 6 2 Utarid , 7 2 lelaki , 8 2 kambing , 9 2 dara , 10 2 aksi , 11 2 agensi , 12 2 abandon , 13 2 abacus , 14 1 toko

mar 2010: 1 2 ala , 2 2 baharu , 3 2 tidur , 4 2 cahaya , 5 2 sakit , 6 2 malam , 7 2 panas , 8 2 respons , 9 1 kodok

abr 2010: 1 3 etnologi , 2 2 origami , 3 2 terima kasih , 4 2 hitam , 5 2 bomba , 6 2 merah , 7 2 kakak , 8 2 tinggi , 9 2 kanan , 10 2 anjing , 11 2 nama , 12 2 sahabat , 13 2 kawan , 14 2 genting , 15 2 baru , 16 2 makanan , 17 2 tebuan , 18 1 usul

mai 2010: 1 2 gendut , 2 2 hakim , 3 2 langit , 4 2 hutan , 5 2 lagi , 6 2 ayam , 7 2 hasil

jun 2010: 1 1 gereja

jul 2010: 1 2 gereja , 2 2 Kamus bahasa Indonesia/Oy , 3 1 majlis

ago 2010: 1 2 buncit , 2 2 gendut , 3 2 , 4 2 adat , 5 2 aku

set 2010: 1 1 gereja

out 2010: 1 2 huruf , 2 1 origami

nov 2010: 1 1 majlis

jan 2011: 1 1

fev 2011: 1 1 maksud

mar 2011: 1 1

abr 2011: 1 1 buyut

mai 2011: 1 1 canggih

jun 2011: 1 1 Bioteknologi

ago 2011: 1 1 lawat

set 2011: 1 1 Poligon

out 2011: 1 1 kuala

nov 2011: 1 2 komku , 2 2 kita , 3 1 adi

dez 2011: 1 2 ا , 2 1 anak tumbuhan

fev 2012: 1 1 Japan

mar 2012: 1 1 trimas

abr 2012: 1 1 ابه

mai 2012: 1 2 aardvark , 2 1 keluarga

jun 2012: 1 1 Lampiran:Unikod

jul 2012: 1 2 hidrogen

ago 2012: 1 2 ijuk , 2 1 kanibalisme

set 2012: 1 1 zakar

out 2012: 1 1 adi

nov 2012: 1 1 easy come, easy go

dez 2012: 1 1 ustazah

jan 2013: 1 1 accretion

fev 2013: 1 1 administration

mar 2013: 1 2 makanan , 2 1 naif

abr 2013: 1 1 ardvark

mai 2013: 1 2 bahasa , 2 1 gedebe

jun 2013: 1 2 guring , 2 1 tutoi

jul 2013: 1 1 makzul

ago 2013: 1 1 bentang

set 2013: 1 2 gajet , 2 2 , 3 1 jelajah

out 2013: 1 1 jelajah

nov 2013: 1 3 cahaya , 2 2 kurrat

dez 2013: 1 2 harem , 2 1 berkemungkinan

jan 2014: 1 1 berkemungkinan

fev 2014: 1 2 abau , 2 2 abar , 3 2 abashed , 4 1 abyad

mar 2014: 1 2 qiamullail , 2 2 qasidah , 3 2 abiogenesis , 4 2 abintara , 5 1 ares

abr 2014: 1 2 azan , 2 2 قضاء , 3 2 berabad-abad , 4 1 玫瑰

mai 2014: 1 2 теория , 2 2 Латвия , 3 2 qari , 4 1 maslahat

jun 2014: 1 1 Ramadan

jul 2014: 1 2 апрель , 2 2 телевидение , 3 1 lê zêde kirin

ago 2014: 1 2 малайзийский , 2 2 gedebe , 3 1 팔월

set 2014: 1 2 referendum , 2 2 Malaysia , 3 2 生日快乐 , 4 2 生日快樂 , 5 2 ذوالقعدة , 6 2 September , 7 1 rodzynek

out 2014: 1 2 , 2 2 Zulhijah , 3 2 ذوالحجة , 4 1 cauldron

nov 2014: 1 2 , 2 1 oktagon

dez 2014: 1 2 mirai , 2 1 yayi

jan 2015: 1 3 idealisme , 2 2 maru , 3 2 , 4 2 nyamuk , 5 2 kecil , 6 2 しょう , 7 2 ローマ字 , 8 2 romaji , 9 2 Tulisan Cina Ringkas , 10 2 未来 , 11 2 tinja , 12 1 sepina

fev 2015: 1 3 , 2 3 아홉 , 3 3 여덟 , 4 3 일곱 , 5 3 여섯 , 6 3 информатика , 7 2 방송 , 8 2 다섯 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 하나 , 14 2 Lampiran:Variasi \"i\" , 15 2 terma , 16 2 nine , 17 2 नौ , 18 2 नवन् , 19 2 حیوان , 20 2 réinventeront , 21 2 dermatofita , 22 1 𩇓

mar 2015: 1 2 kosong , 2 2 ماتريلينيال , 3 2 matrilineal , 4 2 internasionalisme , 5 2 birokratik , 6 2 centzommayeh , 7 2 zaman , 8 2 Mac , 9 2 aristokrasi , 10 2 długo , 11 2 ആത്മാവു് , 12 1 haplologi

abr 2015: 1 1 四月

mai 2015: 1 1 kopitiam

jun 2015: 1 2 kegiatan ekonomi , 2 1

ago 2015: 1 1 daun

set 2015: 1 1 tahut

out 2015: 1 1 balas

nov 2015: 1 2 vape

dez 2015: 1 1 raja

jan 2016: 1 1 Wikipedia

fev 2016: 1 1 زون

mar 2016: 1 1 Abdullah

abr 2016: 1 1 gravity

mai 2016: 1 1 vakum

jul 2016: 1 1 𐀕𐀼𐀙

ago 2016: 1 1 Penerbit Rancangan

set 2016: 1 1 sumbang

out 2016: 1 1 1

nov 2016: 1 2 c , 2 1 1

dez 2016: 1 1 raksasa

jan 2017: 1 1 happy

fev 2017: 1 1 swafoto

mar 2017: 1 1 संस्कृत

abr 2017: 1 2 aramaiti , 2 1 d'oh

mai 2017: 1 1 lachit

jun 2017: 1 2 November , 2 1 マレー語

jul 2017: 1 1 berdikari

ago 2017: 1 1 à la mode

set 2017: 1 2 zalim , 2 1 melumpuri

out 2017: 1 2 evolusi , 2 1 𐤎𐤐𐤈

nov 2017: 1 2 , 2 1 perbualan

dez 2017: 1 1 yak

jan 2018: 1 1 niat

fev 2018: 1 1 tanda

mar 2018: 1 1 いめ

abr 2018: 1 2 abjad , 2 1 اليه بهاس

mai 2018: 1 2 kecil , 2 1 bulan puasa

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 9 de junho 2018 11:48

Dump file mswiktionary-20180601-stub-meta-history.xml.gz (edits only), size 6.0 Mb as gz -> 56 Mb
Dump processed till May 31, 2018, on server stat1005, ready at Sat-02/06/2018-06:03 after 23 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.