Estatísticas da Wikcionário sicilian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: setembro 2017
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
set 20170%   0%   -31%      0%
ago 2017+4%   0%          0%
jun 20170%   0%   +18%      0%
mai 20170%   0%   -88%      0%
abr 20170%   0%   -72%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
set 201724 1 19 k 7 24      3,1 k
ago 20172412 19 k 7 35      3,1 k
jul 201723 1 19 k 7 7      3,1 k
jun 201723 1 19 k 7 33      3,1 k
mai 201723 1 19 k 7 28      3,1 k
abr 201723 1 19 k 7 239      3,1 k
mar 201723 1 19 k 7 845      3,1 k
fev 20172312 19 k 6,9 1,0 k      3,1 k
jan 201722 1 19 k 6,9 780      3,1 k
dez 201622   19 k 6,8 219      3,1 k
nov 201622 2 19 k 6,8 239      3,1 k
out 201622 1 19 k 6,8 250      3,1 k
set 201622 1 19 k 6,8 271      3,1 k
ago 201622 1 19 k 6,8 326      3,1 k
jul 201622 2 19 k 6,8 556      3,1 k
jun 201622   19 k 6,7 135      3,1 k
mai 201622   19 k 6,7 447      3,1 k
abr 201622 1 19 k 6,7 107      3,1 k
mar 201622 1 19 k 6,7 255      3,1 k
fev 2016221  19 k 6,7 28      3,1 k
jan 20162111 19 k 6,7 137      3,1 k
dez 201520   19 k 6,7 405      3,1 k
nov 201520   19 k 6,7 444      3,1 k
out 201520 2219 k116,6 1,6 k      3,1 k
set 201520 1118 k376,7 3,5 k      3,0 k
ago 201520 1117 k16,9 1,3 k      2,9 k
jul 201520 1 17 k 6,8 888      2,9 k
jun 201520   17 k 6,8 1,0 k      2,9 k
mai 201520   17 k 6,7 147      2,9 k
abr 201520   17 k 6,7 151      2,9 k
mar 201520   17 k 6,750310811 Mb1,1 M168 k56 k1,9 k672,9 k
fev 201520   17 k 6,750311211 Mb1,1 M168 k55 k1,9 k672,9 k
jan 201520   17 k 6,750310011 Mb1,1 M168 k55 k1,9 k672,9 k
dez 201420 1 17 k 6,750310411 Mb1,1 M167 k55 k1,9 k672,9 k
nov 201420 1 17 k16,75038711 Mb1,1 M167 k55 k1,9 k672,9 k
out 201420 1 17 k 6,75033911 Mb1,1 M167 k55 k1,9 k672,9 k
set 201420 1 17 k 6,75024311 Mb1,1 M167 k55 k1,9 k672,9 k
ago 201420 1 17 k16,750211111 Mb1,1 M167 k55 k1,9 k672,9 k
jul 201420 1 17 k 6,75018711 Mb1,1 M167 k54 k1,9 k672,8 k
jun 201420 1 17 k 6,75019311 Mb1,1 M166 k54 k1,9 k672,8 k
mai 201420 1117 k16,750017011 Mb1,1 M166 k54 k1,9 k672,8 k
abr 20142011 17 k 6,75004611 Mb1,1 M166 k54 k1,9 k672,8 k
mar 201419 1 17 k 6,75004611 Mb1,1 M166 k54 k1,9 k672,8 k
fev 201419   17 k 6,75004211 Mb1,1 M166 k54 k1,9 k672,8 k
jan 201419 1117 k 6,750046711 Mb1,1 M166 k54 k1,9 k672,8 k
dez 201319   17 k 6,74991,2 k11 Mb1,1 M166 k54 k1,9 k672,8 k
nov 201319   17 k 6,6499111 Mb1,1 M166 k52 k1,9 k672,8 k
out 201319   17 k 6,6499811 Mb1,1 M165 k52 k1,9 k642,8 k
set 201319   17 k 6,6499311 Mb1,1 M165 k52 k1,9 k642,8 k
ago 201319   17 k 6,649946211 Mb1,1 M165 k52 k1,9 k642,8 k
jul 201319   17 k 6,649926811 Mb1,1 M165 k52 k1,9 k642,8 k
jun 201319   17 k 6,649915711 Mb1,1 M165 k51 k1,9 k642,8 k
mai 201319 1 17 k 6,649942211 Mb1,1 M165 k51 k1,9 k642,8 k
abr 201319   17 k 6,549918011 Mb1,1 M165 k51 k1,9 k642,8 k
mar 201319   17 k 6,549913611 Mb1,1 M165 k51 k1,9 k642,8 k
fev 201319   17 k 6,549917011 Mb1,1 M165 k50 k1,9 k642,8 k
jan 201319   17 k 6,549933511 Mb1,1 M165 k50 k1,9 k642,8 k
dez 201219   17 k 6,549925611 Mb1,1 M165 k50 k1,9 k642,8 k
nov 201219   17 k 6,549923711 Mb1,1 M165 k50 k1,9 k642,8 k
out 201219 2 17 k 6,549940011 Mb1,1 M165 k49 k1,9 k642,8 k
set 20121912 17 k 6,449947611 Mb1,1 M165 k49 k1,9 k642,8 k
ago 201218   17 k 6,449933411 Mb1,1 M165 k49 k1,9 k632,8 k
jul 201218 1 17 k 6,449925511 Mb1,1 M165 k48 k1,9 k632,8 k
jun 201218 1117 k86,44991,1 k11 Mb1,1 M165 k48 k1,9 k632,8 k
mai 201218 1 17 k 6,450026811 Mb1,0 M163 k47 k1,9 k632,7 k
abr 201218   17 k 6,450032111 Mb1,0 M163 k46 k1,9 k632,7 k
mar 201218   17 k 6,450027111 Mb1,0 M163 k46 k1,9 k632,7 k
fev 201218 1117 k16,45001,2 k11 Mb1,0 M163 k46 k1,9 k632,7 k
jan 201218   17 k 6,349639111 Mb1,0 M163 k45 k1,9 k632,7 k
dez 201118   17 k 6,349676611 Mb1,0 M163 k45 k1,9 k632,7 k
nov 201118   17 k 6,249641011 Mb1,0 M163 k44 k1,9 k632,7 k
out 201118 1 17 k 6,24961,2 k11 Mb1,0 M163 k44 k1,9 k632,7 k
set 201118 1117 k16,149630011 Mb1,0 M162 k42 k1,9 k632,7 k
ago 201118 1 17 k 6,149719711 Mb1,0 M162 k42 k1,9 k632,7 k
jul 201118   17 k 6,149620511 Mb1,0 M162 k42 k1,9 k632,7 k
jun 20111811 17 k 6,149618111 Mb1,0 M162 k41 k1,9 k632,7 k
mai 201117   17 k 6,149629411 Mb1,0 M162 k41 k1,9 k632,7 k
abr 201117   17 k 6,149652211 Mb1,0 M162 k41 k1,9 k632,7 k
mar 201117   17 k 649628011 Mb1,0 M162 k40 k1,9 k632,7 k
fev 20111712 17 k 649628511 Mb1,0 M162 k40 k1,9 k632,7 k
jan 201116   17 k 649529411 Mb1,0 M162 k40 k1,9 k632,7 k
dez 201016 2117 k1649571811 Mb1,0 M162 k40 k1,9 k552,7 k
nov 201016 1117 k 649516711 Mb1,0 M162 k39 k1,9 k552,7 k
out 201016 2217 k 5,949562511 Mb1,0 M162 k39 k1,9 k552,7 k
set 201016 3217 k 5,949280811 Mb1,0 M161 k38 k1,9 k552,7 k
ago 20101613117 k15,949050511 Mb1,0 M162 k38 k1,9 k552,7 k
jul 201015 2217 k 5,949080711 Mb1,0 M161 k38 k1,9 k552,7 k
jun 201015 2217 k25,84874,8 k10 Mb1,0 M161 k37 k1,9 k552,7 k
mai 201015 3217 k15,54822,2 k10 Mb994 k159 k37 k1,9 k552,7 k
abr 20101513217 k225,44983,1 k10 Mb1,0 M163 k36 k1,9 k552,7 k
mar 201014 3216 k755,450412 k10 Mb993 k159 k32 k1,9 k552,7 k
fev 201014 4214 k65,548710 k8,2 Mb820 k128 k26 k1,7 k552,3 k
jan 201014 2213 k234,84702,0 k7,7 Mb765 k121 k23 k1,7 k552,0 k
dez 200914 1113 k 4,94681517,3 Mb722 k113 k23 k1,7 k552,0 k
nov 200914 2213 k 4,94687727,3 Mb722 k113 k22 k1,7 k552,0 k
out 200914 3213 k 4,94688577,3 Mb720 k113 k22 k1,7 k552,0 k
set 20091413213 k 4,84676007,2 Mb719 k113 k22 k1,7 k552,0 k
ago 200913 2213 k 4,84671,3 k7,2 Mb718 k113 k22 k1,7 k552,0 k
jul 200913 2213 k14,74668607,2 Mb715 k112 k22 k1,7 k552,0 k
jun 200913 3213 k14,64652,3 k7,2 Mb711 k112 k21 k1,7 k552,0 k
mai 200913 2213 k14,44581,5 k7,1 Mb697 k110 k21 k1,7 k552,0 k
abr 200913 2213 k54,34583,7 k7,0 Mb696 k109 k21 k1,7 k552,0 k
mar 200913 2212 k14,14459906,8 Mb672 k102 k20 k1,7 k562,0 k
fev 20091311112 k 44333346,6 Mb652 k99 k19 k1,7 k562,0 k
jan 200912 1 12 k 44331036,6 Mb652 k99 k19 k1,7 k562,0 k
dez 200812 1112 k 44332186,6 Mb652 k99 k19 k1,7 k562,0 k
nov 200812 1 12 k 3,94311176,6 Mb648 k98 k18 k1,7 k562,0 k
out 200812 2 12 k13,94311176,6 Mb647 k98 k18 k1,7 k562,0 k
set 200812 1112 k123,94301,9 k6,5 Mb645 k97 k18 k1,7 k562,0 k
ago 200812 2112 k223,94283,3 k6,3 Mb625 k94 k18 k1,7 k561,9 k
jul 200812 1111 k313,84253,2 k5,9 Mb587 k87 k17 k1,7 k561,6 k
jun 200812 1 10 k 3,94131515,3 Mb524 k76 k14 k1,7 k561,4 k
mai 20081212110 k133,94131,0 k5,3 Mb524 k76 k14 k1,7 k561,4 k
abr 200811 1110,0 k123,94051,5 k5,0 Mb494 k72 k13 k1,7 k561,4 k
mar 2008111319,6 k293,93852,8 k4,6 Mb447 k69 k12 k1,5 k561,3 k
fev 200810 218,8 k443489583,8 Mb367 k58 k9,2 k821561,2 k
jan 200810 118,6 k93,93261,7 k3,5 Mb340 k53 k8,4 k796581,2 k
dez 2007101218,4 k 3,92761762,9 Mb278 k43 k7,7 k734581,1 k
nov 200791418,3 k263,82724,2 k2,9 Mb273 k43 k7,5 k723581,1 k
out 20078 227,6 k403,720311 k2,0 Mb180 k31 k6,9 k458785
set 20078 116,3 k42,71062,4 k927 kb65 k9,9 k6,8 k 6369
ago 20078 116,2 k 2,3103372847 kb61 k8,8 k6,7 k158160
jul 20078 116,2 k 2,3103832835 kb60 k8,6 k6,7 k158142
jun 20078 116,2 k12,1103266816 kb60 k8,4 k6,7 k158108
mai 20078 1 6,2 k 2,1103126811 kb60 k8,4 k6,7 k15867
abr 2007811 6,2 k 2,110391809 kb60 k8,4 k6,6 k15867
mar 20077 1 6,2 k 2,110355808 kb60 k8,4 k6,5 k15867
fev 20077   6,2 k 2,1103122806 kb60 k8,4 k6,4 k15867
jan 20077 1 6,2 k 2103194805 kb60 k8,4 k6,3 k15867
dez 20067   6,2 k 210290798 kb59 k8,2 k6,2 k15867
nov 20067   6,2 k 2102103796 kb59 k8,2 k6,1 k15867
out 20067   6,2 k 2102143795 kb59 k8,2 k6,0 k15867
set 20067   6,2 k 210281794 kb59 k8,2 k5,8 k25867
ago 2006711 6,2 k 1,9102118793 kb59 k8,2 k5,8 k25867
jul 20066   6,2 k 1,9102132790 kb59 k8,2 k5,7 k15865
jun 20066   6,2 k 1,9102204788 kb59 k8,2 k5,5 k15865
mai 20066   6,1 k 1,910292785 kb59 k8,2 k5,3 k15865
abr 20066   6,1 k 1,910262783 kb59 k8,2 k5,2 k15865
mar 20066   6,1 k 1,9102267783 kb59 k8,2 k5,2 k15865
fev 2006611 6,1 k11,8102167780 kb59 k8,2 k5,0 k15865
jan 20065   6,1 k 1,8102104776 kb59 k8,2 k4,8 k15865
dez 20055 1 6,1 k 1,810216774 kb59 k8,2 k4,7 k15465
nov 20055   6,1 k 1,8102165773 kb59 k8,1 k4,7 k15465
out 20055   6,1 k 1,710250772 kb59 k8,1 k4,7 k15465
set 20055   6,1 k 1,710246771 kb59 k8,1 k4,6 k15465
ago 20055   6,1 k 1,71021,6 k771 kb59 k8,1 k4,6 k15465
jul 20055   6,1 k 1,5102511745 kb59 k8,1 k2,9 k15465
jun 20055   6,1 k 1,41021735 kb58 k8,1 k2,3 k15465
mai 20055 1 6,1 k 1,410210735 kb58 k8,1 k2,3 k15465
abr 20055   6,1 k 1,41022734 kb58 k8,1 k2,3 k15465
mar 20055 2 6,1 k 1,41022,1 k734 kb58 k8,1 k2,3 k15465
fev 20055 2 6,1 k6711012,0 k693 kb58 k8,0 k21515465
jan 200554414,2 k13611104,4 k518 kb43 k5,6 k11515340
dez 20041   3 3112287,6 kb54618106 60 
nov 20041   1 1445 1,8 kb77 106 9 
out 200411  1 144511,8 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 201779 61 75 50 83      147
abr 201779 63 74 48 125      147
jan 201782 62 73 40 70      147
out 201680 61 72 42 80      147
jul 201680 53 72 41 74      147
abr 201676 60 72 41 81      147
jan 2016783463 70 41 84      147
out 201578 5233703242 53      147
jul 201577 63 72 38 74      147
abr 201575   72 36 93      147
jan 2015753776437158331891665534801871147
out 2014754062466662331794625433791870147
jul 2014753359486557321892605133781870147
abr 2014742863486458301988605133771868147
jan 2014754265406059331873585032771868147
out 20137443794660613318114585031771871147
jul 2013733982515864351774564930761869147
abr 2013713680515865361778564830751866147
jan 2013704582545567361683544630751765147
out 2012693750495364371576524430731764147
jul 2012695271545270381581504329711665147
abr 2012693979525266351575504327681665147
jan 2012693580505264331572494127671663147
out 2011674269495168341556473927651562147
jul 2011664483494970351572463827651562147
abr 2011663384454661361666443726641359147
jan 2011663581504361381768413425631158147
out 2010653765444261401660413223621061147
jul 2010674566443967381863383021601159147
abr 2010664154403925401534373019571158147
jan 2010663365394420471737423424591158147
out 2009624156434556451654413523591257147
jul 2009634061394255431652403522571156147
abr 2009605262374042481632403322571154147
jan 200959616742385946166838332257949147
out 200856365043375743146136312255946146
jul 200855325638361644162537302255843146
abr 200854426540363039143537322356743146
jan 2008564363463630402035383124551042146
out 2007594250243314373010443825547537146
jul 2007584562393459535433565341519138145
abr 2007563859473161535077514936498539145
jan 2007555062462966504365504735457838145
out 2006514067432852453959464233436631145
jul 2006524169382653433856393931405928145
abr 2006483955352149403453373526314728145
jan 2006484861341741322845343122234028137
out 2005423451261536272648272320213623121
jul 2005363444241235262424242118212917116
abr 200532254321731181760181815142316103
jan 20052451318811514317171230171890
out 200457233116632111115059616021113476
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  1  3  5  10  25  100  250  1000  5  10  100 
set 20173111         1          1          
ago 20172222         3111       2          
jul 2017111                     21      221
jun 201711111        2          3111       
mai 201711111                   2       1  
abr 201721111    221 1          1       22 
mar 201711111    332 3          1          
fev 20175422     432 1          2       11 
jan 2017221      432 1          1       1  
dez 201642      321 3          1       1  
nov 201622211    321            1       11 
out 201621111    321 1          1       11 
set 201651111    221 2          1       11 
ago 201641111    221 21         221     111
jul 201622211    332 1          3       11 
jun 2016        22  3          4       11 
mai 20161       222 6          2          
abr 2016211      22  61         1          
mar 2016311      211 3          1       11 
fev 201642      11  1                     
jan 20162111     22  6                  11 
dez 20152       221 3          111     11 
nov 20152       221 5          311111  111
out 20153222222   321 31         422211  21 
set 2015111111111 431 1321111111  31111   11 
ago 20151111111   222 21         311111  11 
jul 2015311      221 2          1       11 
jun 20151       2211           11111   111
mai 2015        33                     11 
abr 20151       331          223211    21 
mar 20152       32  2        111       11 
fev 20153       22  32         92      11 
jan 201541      22  31         21      111
jul 2017111                     21      221
abr 201721111    221 1          1       22 
jan 2017221      432 1          1       1  
out 201621111    321 1          1       11 
jul 201622211    332 1          3       11 
abr 2016211      22  61         1          
jan 20162111     22  6                  11 
out 20153222222   321 31         422211  21 
jul 2015311      221 2          1       11 
abr 20151       331          223211    21 
jan 201541      22  31         21      111
out 201441111        1          3          
jul 201421111    11  31         2111       
abr 20143211     11  2          9          
jan 20141111111   221 1          6211       
out 201311          5          41         
jul 2013        111 1          51         
abr 20132       211 1          1          
jan 2013        431            2       11 
out 2012222      321            621     11 
jul 2012411      421 2          6111    1  
abr 2012        54  11         422        
jan 20123       331 1          2       21 
out 20113211     332            6       11 
jul 20111       221 1          21         
abr 20112       332            21         
jan 201121      221 1          5          
out 20103222222       1          72221      
jul 20107322222       1          11111      
abr 201075322221      2111111    4321111 11 
jan 201022222211      4          3222       
out 20093332221       2          4          
jul 20093222222       1          411     11 
abr 2009332222211     311        522111     
jan 2009221      32  1          411     111
out 200822221    21  3          643        
jul 200841111111  221121         62         
abr 200811111111  22  311        611111  1  
jan 200821111111  221 411111     5111       
out 2007322222111111  332211     32221111   
jul 20071111111   11             111111     
abr 2007111      11  1          111        
jan 200752111    111            2          
out 20061       111            2          
jul 2006        111            2          
abr 2006        11             211        
jan 20061       111            2          
out 2005        11                        
jul 20052       111            1          
abr 20051                      11         
jan 2005444421    2222433        432221     
out 20041                                 

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1144100.0%91,769100.0%
34531.2%91,62699.8%
102316.0%91,49599.7%
32128.3%91,29699.5%
10074.9%90,97799.1%
31653.5%90,59998.7%
100021.4%89,07497.1%
316221.4%89,07497.1%
1000010.7%79,65586.8%
3162310.7%79,65586.8%

 

3 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Word dewd544UC4 040522--mai 14, 20141234----
MGorroneUC20 017116-ago 23, 2017372-6-
Lo XimiendoUC144...11--set 22, 20177----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
SarvaturiUC179,655mai 09, 20064161dez 28, 2015641
InterwicketUC29,419jan 29, 20093165nov 08, 20102517
PeppepzUC3774abr 29, 20141249out 17, 2015713
Pippu d'AngeloUC5346jan 13, 20054642mai 14, 20083425
SabineCretellaUC6234jan 11, 20054644set 13, 20102573
CommonsDelinkerUC7144jan 16, 20083544jul 21, 201770
StrabbismuUC891fev 09, 20064250jan 25, 20073900
Hégésippe CormierUC970dez 22, 20054299nov 28, 20092862
Accarjemicu ra canigghiaUC1066fev 03, 20102795nov 19, 2016314
CodeksUC1158ago 31, 20102586set 01, 20102585
Scorpios90UC1234fev 04, 20112429set 26, 20121829
Klone123UC1327set 04, 20092947out 22, 20092899
ThelyphthoraUC1423jan 31, 2017241fev 10, 2017231
EsbarduUC1521nov 08, 20073613jun 03, 20121944
MelosUC1621fev 03, 20083526mar 21, 20083479
SergioUpload-scUC1720jan 25, 20054630jan 25, 20054630
GerardMUC1818jan 11, 20054644jul 09, 20054465
CalqUC1917mar 29, 20131645fev 23, 2017218
CraudiuUC2114ago 05, 20064073ago 05, 20064073
.sEdivadUC2211abr 03, 20112371mar 03, 20141306

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 813 edições foram feitas por usuários anônimos, de um total de 131272 edições ( 0e %)
  


18 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC19,745mar 18, 20112387abr 22, 2017160--
RobotGMwiktUC28,421jan 26, 20054629jun 06, 200834021,691-
Luckas-botUC34,762mar 06, 20093129jan 27, 20141341--
RobotSCwikt~scnwiktionaryUC44,273jan 26, 20054629fev 02, 200546224,222-
UT-interwiki-BotUC52,556jul 13, 2016443abr 14, 2017168--
SpaceBirdyBotUC62,184mar 30, 20083470jan 02, 20102827--
KamikazeBotUC71,972out 18, 20112173mar 06, 20131668--
JAnDbotUC81,133jun 10, 20121937mar 31, 2017182--
OctraBotUC91,116dez 24, 2016279abr 24, 2017158--
VolkovBotUC101,035ago 20, 20073693mar 21, 20131653--
YS-BotUC11999set 13, 20121842out 18, 2015712--
AvocatoBotUC12342nov 01, 20112159ago 08, 20131513--
SzajciBotUC1355set 09, 20083307jan 12, 20093182--
CarsracBotUC1435nov 17, 20121777mai 30, 20131583--
MonoBotUC1524jan 18, 20083542jun 14, 20083394--
Makecat-botUC1620nov 10, 20121784abr 05, 20131638--
タチコマ robotUC1712mai 04, 20141244out 18, 2015712--
JackBotUC186ago 10, 20102607ago 10, 20102607--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
set 201722 k42446223718383623       1210
ago 201722 k42346223718383623       1210
jul 201722 k42246223718383623       1210
jun 201722 k42246223718383623       1210
mai 201722 k42146223718383623       1210
abr 201722 k42146223718383623       1210
mar 201722 k42146223718383623       1210
fev 201722 k42146223718383623       1210
jan 201722 k41946223718383623       1210
dez 201622 k41846223718383623       1210
nov 201622 k41846223718383623       1210
out 201622 k41846223718383623       1210
set 201622 k41846223718383623       1210
ago 201622 k41746223718383623       1210
jul 201622 k41646223718383619       1210
jun 201622 k41646223718383619       1210
mai 201622 k41645223718383619       1210
abr 201622 k41545223718383619       1210
mar 201622 k41445223718383619       1210
fev 201622 k41445223718383619       1210
jan 201622 k41445223718383619       1210
dez 201522 k41445223718383619       1210
nov 201522 k41145223718383619       1210
out 201522 k41145223718383513       1210
set 201521 k41045223718033455       1210
ago 201520 k40944223718013441       1210
jul 201520 k40942223717963438       1210
jun 201520 k40842223717963438       1210
mai 201520 k40842223717963411       1210
abr 201520 k40842223717963411       1210
mar 201520 k40735223717963407      21210
fev 201520 k40735223717963407      41210
jan 201520 k40035223717963407      71210
dez 201420 k39835223717963407      81210
nov 201420 k39835223717963407      861210
out 201420 k39535223717763406      341210
set 201420 k39435223717733406      341210
ago 201420 k39035223717703406      741210
jul 201420 k38735223717693405      311210
jun 201420 k38635223717693405      621210
mai 201420 k38635223717693405      1341210
abr 201420 k38435223717673405      191210
mar 201420 k38135223717673405      111210
fev 201420 k37935223717673405      31210
jan 201420 k37435223717673405      3301210
dez 201320 k36935223717673400      41210
nov 201320 k36935223717673400      11210
out 201320 k36335223717673400      41210
set 201320 k35935223717673400      11210
ago 201320 k34735223717673400      11210
jul 201320 k34434223717673400       1210
jun 201320 k34234223717673400      41210
mai 201320 k34034223717673400      71210
abr 201320 k33834223717673400      21210
mar 201320 k33534223717673400      11210
fev 201320 k33134223717673400      21210
jan 201320 k32634223717673400       1210
dez 201220 k32434223717673400      41210
nov 201220 k31734223717673400      51210
out 201220 k31734223717673400      141210
set 201220 k31334223717673397      311210
ago 201220 k30934223717673397      41210
jul 201220 k30634223717673397      131210
jun 201220 k30234223717673397      7361210
mai 201220 k29534223717653378      121210
abr 201220 k29134223717643377       1210
mar 201220 k28534223717643377      21210
fev 201220 k28434223717643377      9391210
jan 201220 k27634223717603373      41210
dez 201120 k27334223717603373      11210
nov 201120 k26834223717603373      31210
out 201120 k25734223717593373      271210
set 201120 k25134223717593373      1711210
ago 201119 k24834223717593369      891210
jul 201119 k24234223717593369      11210
jun 201119 k23434223717593369      111210
mai 201119 k23134223717593369       1210
abr 201119 k22634223717593369      21210
mar 201119 k22234223717593369      21210
fev 201119 k22134223717593369      981210
jan 201119 k21534223717593369      61210
dez 201019 k21034223717593369      1451210
nov 201019 k20834223717593369      1581210
out 201019 k20534223707593369      6231210
set 201019 k20234223707593369      8031210
ago 201019 k19734223707593368      4931210
jul 201019 k18134223707583361      8051210
jun 201019 k18134223707583361      48301210
mai 201019 k17134223707563361      21951210
abr 201019 k17034223707533334      30601210
mar 201019 k16634213707413274      115361110
fev 201016 k15334153707073201      10263105
jan 201015 k14834153706973192      2021105
dez 200915 k13634153706973183      144105
nov 200915 k13434153706973183      771105
out 200915 k13234153706973183      849105
set 200915 k12934153706973183      600105
ago 200915 k12534143706973183      1324104
jul 200915 k12434143706973183      858104
jun 200915 k12234143706953183      2304104
mai 200915 k12034143696943182      1482104
abr 200915 k12034143696933181      3717104
mar 200914 k11234143696923175      949104
fev 200914 k10934143696912173      267104
jan 200914 k10434143696912173      11104
dez 200814 k10334143696912173      110104
nov 200814 k10234143696912173      10104
out 200814 k8834143696912173      86104
set 200814 k7934143696901173      1838104
ago 200814 k7634143696861172      3246104
jul 200813 k7334143696861163      1449104
jun 200812 k7034143686861163      18104
mai 200812 k6732143686861163      780104
abr 200811 k6132143686841159      1384104
mar 200811 k5831123686691106      269693
fev 20089,9 k563111365663186      82183
jan 20089,8 k52299363658184      159872
dez 20079,4 k48299363655179      14172
nov 20079,4 k46299363655179      412172
out 20078,4 k45295363654174      1077332
set 20076,7 k33222358119 49      23452 
ago 20076,4 k29222358101 38      3672 
jul 20076,4 k28222358100 37      8042 
jun 20076,3 k2622224298 35      2522 
mai 20076,3 k242225988 4      92 
abr 20076,3 k232225988 4      92 
mar 20076,3 k232225987 4      52 
fev 20076,2 k231925987 4       2 
jan 20076,2 k221925987 3      742 
dez 20066,2 k221925987 3      12 
nov 20066,2 k221925987 3       2 
out 20066,2 k211925987 3      22 
set 20066,2 k191925987 3       2 
ago 20066,2 k191925987 3      152 
jul 20066,2 k181925987 3       2 
jun 20066,2 k171925987 3      12 
mai 20066,2 k161925987 3      32 
abr 20066,2 k151725987 3       2 
mar 20066,2 k141725987 3       2 
fev 20066,2 k141725987 3      262 
jan 20066,2 k141725987 3      22 
dez 20056,2 k121725987 3      52 
nov 20056,2 k71725971 3       2 
out 20056,2 k71725971 3       2 
set 20056,2 k71725971 3      12 
ago 20056,2 k71725971 3      12 
jul 20056,2 k71725971 3      32 
jun 20056,2 k71725971 3      12 
mai 20056,2 k71725971 3      62 
abr 20056,2 k71725971 3      12 
mar 20056,2 k61725971 3      212 
fev 20056,2 k61725969 3      1292 
jan 20054,3 k61725969 3      1852 
dez 20043   59            
nov 20041                
out 20041                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2004: 1 1 Pàggina principali

dez 2004: 1 1 Pàggina principali

jan 2005: 1 3 etimoluggìa , 2 3 Pàggina principali , 3 2 filoluggìa , 4 2 abbanniari , 5 2 abbentu , 6 2 abbaffari , 7 2 Utente:SabineCretella/lista/D , 8 2 giappunisi , 9 1 етимология

fev 2005: 1 2 abbummatu , 2 2 abbullari , 3 2 accattari , 4 2 accabbari , 5 1 Synonym

mar 2005: 1 2 acciuncari , 2 2 acchianari , 3 1 Saturnu

abr 2005: 1 1 accucchiari

mai 2005: 1 1 ajutu

jun 2005: 1 1 lìttira

jul 2005: 1 1 maritàrisi

ago 2005: 1 1 pillari

set 2005: 1 1 mafia

dez 2005: 1 1 canciamentu

jan 2006: 1 1 pirsuna

fev 2006: 1 2 ottugrafìa , 2 1 cicala

mai 2006: 1 1 Wikizziunariu

jun 2006: 1 1 ciuciu

ago 2006: 1 1 buttana

out 2006: 1 1 strèusu

dez 2006: 1 1 nilvia

jan 2007: 1 1 fari li pistigni

mar 2007: 1 1 ncazzàrisi

abr 2007: 1 1 cafè

mai 2007: 1 1 taliata

jun 2007: 1 1 abbirintu

jul 2007: 1 1 buhhiularu

ago 2007: 1 1 cascjarizzu

set 2007: 1 1 UTC

out 2007: 1 2 ddi , 2 2 chidda , 3 2 chiddi , 4 2 chiddu , 5 2 chista , 6 2 chissi , 7 2 chissa , 8 2 luordu , 9 2 agrestu , 10 2 fallaci , 11 2 magru , 12 2 medianu , 13 2 midianu , 14 2 mansu , 15 2 mancarusu , 16 2 malacriatu , 17 2 malcriatu , 18 2 largu , 19 2 làricu , 20 2 lurdu , 21 2 linnu , 22 2 gàutu , 23 2 irbusu , 24 2 jàuru , 25 2 àjiru

nov 2007: 1 2 pàggina , 2 2 tiatru , 3 2 austu , 4 2 agneddu , 5 2 accusari , 6 2 allegru , 7 2 purtughisi , 8 2 dizziunariu , 9 2 coniugali , 10 2 sustantivu , 11 2 lazzu , 12 2 gaddutu , 13 2 furricu , 14 2 furdìcula , 15 2 fràggili , 16 2 firricu , 17 2 firranti , 18 2 filàutu , 19 2 oceddu , 20 2 babbu , 21 2 auceddu , 22 2 ddazzu , 23 2 armalu , 24 2 ardìcula , 25 2 aneddu

dez 2007: 1 2 arà , 2 1 conxunción

jan 2008: 1 1 ipericu

fev 2008: 1 2 catananna , 2 1 pena

mar 2008: 1 2 vinu , 2 2 armali , 3 2 banniari , 4 2 vanniari , 5 2 cristianu , 6 2 abbummatu , 7 2 abbullari , 8 2 abbadari , 9 2 pitanza , 10 2 bannizzari , 11 2 abbanniari , 12 2 abbiari , 13 2 abbentu , 14 2 acchianari , 15 1 signa

abr 2008: 1 1 filtru

mai 2008: 1 2 fazzulettu , 2 2 muccaturi , 3 1 Durlindana

jun 2008: 1 1 cità

jul 2008: 1 2 pìritu , 2 1 aceddu dû malutempu

ago 2008: 1 2 motherboard , 2 1 ozari

set 2008: 1 1 zifulà

out 2008: 1 1 capillutu

nov 2008: 1 1 ghiurnali

dez 2008: 1 1 gaddorfu

jan 2009: 1 1 mali

fev 2009: 1 2 esperantu , 2 1 fini

mar 2009: 1 2 rouge , 2 2 lutu , 3 2 liara , 4 2 drittu , 5 2 luta , 6 2 lissa , 7 2 lippu , 8 2 disa , 9 2 mù ccà , 10 1 brìndisi

abr 2009: 1 3 acqua , 2 2 vindita , 3 2 altru , 4 2 oy , 5 2 pir , 6 2 territoriu , 7 2 sou , 8 2 , 9 2 et , 10 2 principali , 11 2 càmmara , 12 2 tirruri , 13 2 sternu , 14 2 esternu , 15 2 nnipinnenza , 16 2 mustu , 17 2 arruri , 18 2 erruri , 19 2 cosmoluggìa , 20 2 chìmica , 21 2 furchetta , 22 2 dannu , 23 2 lardu , 24 2 lanza , 25 2 chianu

mai 2009: 1 2 transitivu , 2 2 fiata , 3 2 daga , 4 2 calessi , 5 2 guadagnari , 6 2 corra , 7 2 risposta , 8 2 riga , 9 2 pupa , 10 2 lugghiu , 11 2 carta , 12 2 birra , 13 2 anatomia , 14 2 cravatta , 15 2 giugnu , 16 2 furmaggiu , 17 2 stanza , 18 2 , 19 2 trumma , 20 2 alcol , 21 2 tunisinu , 22 2 ucràinu , 23 2 turcu , 24 2 sluvaccu , 25 2 macèduni

jun 2009: 1 2 demm , 2 2 ġemel , 3 2 sekonda , 4 2 singulari , 5 2 plurali , 6 2 aparu , 7 2 altru , 8 2 bedda , 9 2 stima , 10 2 passa , 11 2 lavari , 12 2 nascita , 13 2 barca , 14 2 um , 15 2 grazia , 16 2 volta , 17 2 visu , 18 2 terminale , 19 2 soma , 20 2 saliva , 21 2 roba , 22 2 questione , 23 2 patata , 24 2 papa , 25 2 pane

jul 2009: 1 2 termini relatati , 2 2 ras , 3 2 qalb , 4 2 pronunzji , 5 2 popolazzjoni , 6 2 nazzjon , 7 2 navigazzjoni , 8 2 lessiku , 9 2 kwotazzjonijiet , 10 2 kwotazzjoni , 11 2 koordinazzjoni , 12 2 konġunzjoni , 13 2 kollezzjoni , 14 1 francupruvinzali

ago 2009: 1 2 ogni , 2 2 malu , 3 2 normali , 4 2 riccu , 5 2 fàcili , 6 2 scienza , 7 2 scemu , 8 2 agghiu , 9 2 malacunnutta , 10 2 lintu , 11 2 làdiu , 12 2 prena , 13 2 facceri , 14 2 azzanìa , 15 2 accia , 16 1 grara

set 2009: 1 3 taccia , 2 3 amenta , 3 2 ancuni , 4 2 verru , 5 2 ntonzi , 6 2 basilicò , 7 2 basi , 8 2 vardari , 9 2 uardari , 10 2 guardari , 11 2 esami , 12 2 babbaluci

out 2009: 1 2 sfardari , 2 2 battaglia , 3 2 brocca , 4 2 boi , 5 2 cafè , 6 2 galega , 7 2 bureddu , 8 1 meriu

nov 2009: 1 2 celu , 2 2 ciumi , 3 2 cheyenne , 4 2 cherokee , 5 2 pedi , 6 1 spicchiu

dez 2009: 1 2 scaminari , 2 2 terra

jan 2010: 1 2 daga , 2 2 gula , 3 2 ladin , 4 2 lepru , 5 2 hindi , 6 2 luna , 7 2 deu , 8 1 armôna

fev 2010: 1 3 laberint , 2 2 alè , 3 2 palàura , 4 2 trita , 5 2 triti , 6 2 littori , 7 2 orra , 8 2 làntana , 9 2 angustia , 10 2 fraca , 11 2 navigazioni , 12 2 gufi , 13 2 scaliari , 14 2 nachitizzonna , 15 2 polirrimàtica , 16 2 accarièmicu , 17 2 agace , 18 2 scandiu , 19 2 tabbutu , 20 2 ànima , 21 2 ova , 22 2 sala , 23 2 ponti , 24 2 parola , 25 2 rìu

mar 2010: 1 3 глагол , 2 3 местоимение , 3 3 земля , 4 3 овёс , 5 3 kış , 6 2 azzurro , 7 2 privado , 8 2 privato , 9 2 privé , 10 2 private , 11 2 huitanta , 12 2 bana , 13 2 ilkbahar , 14 2 vircocu , 15 2 bèc , 16 2 argent , 17 2 aglon , 18 2 grafia , 19 2 abada , 20 2 abado , 21 2 pansa , 22 2 orto- , 23 2 iso- , 24 2 -ismu , 25 2 psico-

abr 2010: 1 3 tuvagghiuni , 2 3 moi , 3 2 action , 4 2 ila , 5 2 stecca , 6 2 binu , 7 2 beca , 8 2 ira , 9 2 ruma , 10 2 sonni , 11 2 blocchi , 12 2 frendi , 13 2 bega , 14 2 emma , 15 2 panti , 16 2 lova , 17 2 legga , 18 2 ghenga , 19 2 fessa , 20 2 buccia , 21 2 falò , 22 2 faia , 23 2 dora , 24 2 contri , 25 2 checca

mai 2010: 1 2 scujàttulu , 2 2 asarciziu , 3 2 cureanu , 4 2 águila , 5 2 fuerte , 6 2 cráneo , 7 2 bastante , 8 2 abuso , 9 2 adultu , 10 2 osso , 11 2 abelha , 12 2 abraço , 13 2 abuse , 14 2 USA , 15 2 abus , 16 2 action , 17 2 bore , 18 2 biology , 19 2 basque , 20 2 bailar , 21 2 asturiano , 22 2 aragonês , 23 2 arabe , 24 2 agosto , 25 2 vieillir

jun 2010: 1 3 cornu , 2 3 anciova , 3 2 cedda , 4 2 nsira , 5 2 August , 6 2 août , 7 2 olla , 8 2 cara , 9 2 èvèque , 10 2 libèrtât , 11 2 fagu , 12 2 crema , 13 2 casteddu , 14 2 caminu , 15 2 furesta , 16 2 blusa , 17 2 riparu , 18 2 gazza , 19 2 piriscia , 20 2 uttena , 21 2 manghjà , 22 2 insità , 23 2 incatarrì , 24 2 ira , 25 2 argent

jul 2010: 1 2 arcu , 2 2 ndivinari , 3 1 August

ago 2010: 1 2 accio , 2 2 acchiare , 3 2 accattare , 4 1 comparisce

set 2010: 1 2 dubitari , 2 2 arricampàrisi , 3 2 cuenzo , 4 2 cuculone , 5 2 cucuacia , 6 2 controra , 7 2 comparisce , 8 2 chiummo , 9 2 cazzare

out 2010: 1 2 jiri , 2 2 firmari , 3 1 appanzicàrisi

nov 2010: 1 1 cara

dez 2010: 1 2 sdurrubbari , 2 2 scunchiurutu , 3 1 scunchjurutu

jan 2011: 1 1 tabutu

fev 2011: 1 1 mai sìa

mar 2011: 1 1 papa

abr 2011: 1 1 a vanedda

jun 2011: 1 1 sbarrachiari

jul 2011: 1 1 palummu

ago 2011: 1 1 limaccia

set 2011: 1 1 sgangatello

out 2011: 1 1 violo

nov 2011: 1 1 visu

dez 2011: 1 1 éga

jan 2012: 1 1 musca

fev 2012: 1 1 razzina

mar 2012: 1 1 palummu

mai 2012: 1 1 camarata

jun 2012: 1 2 ترش , 2 2 گل , 3 1 irbicedda

jul 2012: 1 2 teccà , 2 1 tè ccà

ago 2012: 1 1 muffula

set 2012: 1 3 trazzera , 2 2 beni , 3 1 scògghiri

out 2012: 1 1 ebràicu

nov 2012: 1 1 prezzu

dez 2012: 1 1 cuttigghiu

fev 2013: 1 1 e

mar 2013: 1 1 tigri

abr 2013: 1 1 pìcciuli

mai 2013: 1 1 minutulu

jun 2013: 1 1 pasranu

ago 2013: 1 1 Taruni

set 2013: 1 1 sturneddu

out 2013: 1 1 fromâjo

nov 2013: 1 1 conoscente

dez 2013: 1 1 ddagghjusu

jan 2014: 1 1 cunsigghiari

fev 2014: 1 1 brocca

mar 2014: 1 1 trunzu

abr 2014: 1 1 dajuni

mai 2014: 1 1 nzittari

jun 2014: 1 1 Appinnici:Cugnugazzioni/Sicilianu/giuvàri

jul 2014: 1 1 taddariti

ago 2014: 1 1 curanedda mpiriali

set 2014: 1 1 Appinnici:Conjugazzioni/Sicilianu/nzittari

out 2014: 1 1 piccirìddu

nov 2014: 1 1 virrica

dez 2014: 1 1 giometrìa

jan 2015: 1 1 bistinu

fev 2015: 1 1 rizzu

mar 2015: 1 1 cità

abr 2015: 1 1 Wikizziunariu

jun 2015: 1 1 putru

jul 2015: 1 1 รู้จักมักคุ้น

ago 2015: 1 1 cirìmuli

set 2015: 1 1 kiosque

out 2015: 1 1 tatiyart

nov 2015: 1 1 furmaggiu

dez 2015: 1 1 jujusu

jan 2016: 1 1 buona

fev 2016: 1 1 pèdinu

mar 2016: 1 1 minutulu

abr 2016: 1 1 ciriossi

mai 2016: 1 1 vuccirìa

jul 2016: 1 1 scatò

ago 2016: 1 1 spìngula

set 2016: 1 1 pulla

out 2016: 1 1 tozzola

nov 2016: 1 1 testadiminchia

dez 2016: 1 1 tòrciri

jan 2017: 1 1 gona

fev 2017: 1 1 stizza

mar 2017: 1 1 ìnciri

abr 2017: 1 1 carricàri

mai 2017: 1 1 varză

jun 2017: 1 1 nuomi

jul 2017: 1 1 vòmmira

ago 2017: 1 1 atturna

set 2017: 1 1 vanedda

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 12 de outubro 2017 16:00

Dump file scnwiktionary-20171001-stub-meta-history.xml.gz (edits only), size 8.3 Mb as gz -> 64 Mb
Dump processed till Sep 30, 2017, on server stat1005, ready at Wed-04/10/2017-11:44 after 56 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.