Estatísticas da Wikcionário sérvio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wiktionary sérvio

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: maio 2018
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mai 2018+1%   0%   +799%      0%
abr 20180%   0%   +109%      0%
mar 20180%   0%   -52%      0%
fev 20180%   0%   -46%      0%
jan 20180%   0%   -68%      0%
dez 20170%   0%   +491%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mai 2018153121213 k22,1 602      2,3 k
abr 2018152 1 213 k 2,1 67      2,3 k
mar 2018152 1 213 k 2,1 32      2,3 k
fev 2018152 1 213 k 2,1 66      2,3 k
jan 2018152 3 213 k 2,1 122      2,3 k
dez 2017152 21213 k 2,1 378      2,3 k
nov 2017152 2 213 k 2,1 64      2,3 k
out 201715225 213 k 2,1 90      2,3 k
set 201715012 213 k 2,1 52      2,3 k
ago 2017149 11213 k122,1 1,6 k      2,3 k
jul 2017149121213 k1342,1 8,5 k      2,3 k
jun 2017148 11209 k5742,1 21 k      2,3 k
mai 2017148281191 k862,2 8,4 k      2,3 k
abr 2017146 11189 k282,2 4,9 k      2,3 k
mar 2017146 21188 k752,2 8,4 k      2,2 k
fev 2017146241185 k242,1 4,5 k      2,2 k
jan 201714411 185 k 2,1 1,2 k      2,2 k
dez 201614358 185 k22,1 619      2,2 k
nov 201613845 185 k32,1 817      2,2 k
out 201613411 185 k 2,1 1,4 k      2,2 k
set 2016133 1 185 k 2,1 566      2,2 k
ago 2016133   185 k 2,1 552      2,2 k
jul 201613322 185 k 2,1 1,0 k      2,2 k
jun 2016131   185 k 2,1 2,4 k      2,2 k
mai 2016131 1 185 k512,1 19 k      2,2 k
abr 2016131 2 183 k45842 211 k      2,2 k
mar 201613115 45 k33,4 689      2,2 k
fev 201613011 45 k 3,4 21      2,2 k
jan 201612969 45 k43,4 447      2,2 k
dez 20151231319145 k33,4 2,2 k      2,2 k
nov 2015110 2 45 k 3,4 845      2,2 k
out 201511025 45 k4383,3 29 k      2,1 k
set 201510813132 k4383,9 18 k      2,1 k
ago 2015107 6 18 k15,6 527      2,1 k
jul 201510714 18 k15,6 3,0 k      2,1 k
jun 2015106915 18 k45,5 465      2,1 k
mai 201597510218 k75,5 737      2,1 k
abr 201592117 18 k75,5 762      2,1 k
mar 201591218 18 k35,552880325 Mb1,4 M35 k86 k1731242,1 k
fev 201589312118 k35,552351925 Mb1,4 M34 k85 k1731242,1 k
jan 201586312 18 k25,551745324 Mb1,3 M33 k85 k1731242,1 k
dez 2014831325218 k55,55151,3 k24 Mb1,3 M33 k85 k1731082,1 k
nov 2014701425117 k75,550585924 Mb1,3 M31 k84 k172792,1 k
out 201456 1 17 k 5,54982223 Mb1,2 M30 k84 k172792,0 k
set 201456   17 k 5,5498523 Mb1,2 M30 k84 k172792,0 k
ago 201456   17 k 5,54984523 Mb1,2 M30 k84 k172792,0 k
jul 201456 4317 k15,54982,3 k23 Mb1,2 M30 k84 k172682,0 k
jun 201456 4317 k 5,450772923 Mb1,2 M28 k84 k171681,5 k
mai 201456 9417 k25,35081,3 k23 Mb1,2 M28 k84 k171681,5 k
abr 201456 9217 k55,350374923 Mb1,2 M26 k84 k171661,4 k
mar 20145629317 k35,34931,2 k22 Mb1,2 M24 k83 k166601,4 k
fev 20145429217 k 5,248671422 Mb1,2 M20 k83 k165601,4 k
jan 201452   17 k 5,248519822 Mb1,2 M19 k83 k165601,4 k
dez 201352 7117 k15,248578822 Mb1,2 M19 k82 k165601,4 k
nov 201352 5 17 k25,148320022 Mb1,2 M19 k81 k152601,4 k
out 20135216117 k45,148040722 Mb1,1 M19 k81 k124591,4 k
set 201351 6117 k55,247550521 Mb1,1 M19 k81 k98591,3 k
ago 201351 1 16 k 5,246815121 Mb1,1 M19 k81 k98591,3 k
jul 201351 2 16 k15,24679621 Mb1,1 M19 k81 k98591,3 k
jun 201351 5116 k15,246639821 Mb1,1 M19 k81 k98591,3 k
mai 201351 3 16 k15,24679121 Mb1,1 M19 k81 k98591,2 k
abr 201351 7216 k35,246643921 Mb1,1 M19 k80 k98591,2 k
mar 20135118216 k45,24631,4 k21 Mb1,1 M18 k80 k98591,2 k
fev 20135067 16 k25,145934120 Mb1,0 M18 k79 k96591,1 k
jan 201344   16 k 5,145688820 Mb1,0 M18 k79 k96591,1 k
dez 20124411 16 k 545622320 Mb1,0 M18 k78 k96591,1 k
nov 201243 1 16 k 545673220 Mb1,0 M18 k78 k96591,1 k
out 201243   16 k 545612020 Mb1,0 M18 k77 k95591,1 k
set 201243   16 k 545618320 Mb1,0 M18 k76 k95591,1 k
ago 201243   16 k 545659520 Mb1,0 M18 k76 k95501,1 k
jul 201243 1 16 k 4,945614120 Mb1,0 M18 k76 k95501,1 k
jun 201243 1 16 k 4,945613120 Mb1,0 M18 k75 k95501,1 k
mai 201243   16 k 4,945628320 Mb1,0 M18 k75 k95501,1 k
abr 201243 2 16 k 4,945632320 Mb1,0 M18 k75 k95501,1 k
mar 201243   16 k 4,945643520 Mb1,0 M18 k75 k95501,1 k
fev 20124311 16 k 4,945645720 Mb1,0 M18 k74 k95501,1 k
jan 201242 1 16 k 4,845677220 Mb1,0 M18 k74 k95501,1 k
dez 201142   16 k 4,84561,4 k20 Mb1,0 M18 k72 k95501,1 k
nov 201142   16 k 4,745617220 Mb1,0 M18 k70 k95501,1 k
out 201142 1 16 k 4,745628220 Mb1,0 M18 k70 k95501,1 k
set 201142 2 16 k14,745618120 Mb1,0 M18 k69 k95501,1 k
ago 20114211 16 k 4,745616620 Mb1,0 M18 k69 k95501,1 k
jul 201141   16 k 4,745615520 Mb1,0 M18 k68 k95501,1 k
jun 20114111 16 k 4,745687020 Mb1,0 M18 k68 k95501,1 k
mai 201140 2 16 k 4,645632720 Mb1,0 M18 k67 k95471,1 k
abr 20114011 16 k 4,645634220 Mb1,0 M18 k66 k95471,1 k
mar 201139 1 16 k 4,645727720 Mb1,0 M18 k66 k95471,0 k
fev 201139   16 k 4,545741220 Mb1,0 M18 k66 k95471,0 k
jan 201139   16 k 4,545724120 Mb1,0 M18 k65 k95471,0 k
dez 20103911 16 k 4,545753720 Mb1,0 M18 k65 k95471,0 k
nov 20103823116 k 4,545729220 Mb1,0 M18 k64 k95471,0 k
out 201036 1116 k 4,545754520 Mb1,0 M18 k64 k94471,0 k
set 20103623116 k14,445747920 Mb1,0 M18 k63 k94471,0 k
ago 201034 2116 k 4,445740120 Mb1,0 M18 k63 k94471,0 k
jul 20103413116 k 4,445786420 Mb1,0 M18 k63 k94471,0 k
jun 201033 1116 k 4,346063720 Mb1,0 M18 k62 k94451,0 k
mai 201033 1116 k 4,346063220 Mb1,0 M18 k61 k94451,0 k
abr 201033 1116 k 4,246045220 Mb1,0 M18 k61 k94451,0 k
mar 201033 3116 k 4,246013 k20 Mb1,0 M18 k60 k94451,0 k
fev 201033 2116 k 3,446259821 Mb1,0 M18 k60 k94451,0 k
jan 201033 2116 k 3,346235121 Mb1,0 M17 k59 k94451,0 k
dez 20093312116 k 3,346241021 Mb1,0 M17 k59 k94441,0 k
nov 200932 1116 k 3,346250121 Mb1,0 M17 k58 k94431,0 k
out 200932 2116 k 3,346243321 Mb1,0 M17 k58 k94431,0 k
set 20093214116 k 3,246242321 Mb1,0 M17 k57 k94421,0 k
ago 200931 1116 k 3,246263321 Mb1,0 M17 k57 k94331,0 k
jul 20093113116 k 3,24622,4 k21 Mb1,0 M17 k56 k94331,0 k
jun 200930 2116 k 346438821 Mb1,0 M17 k56 k94321,0 k
mai 20093012116 k 346483121 Mb1,0 M17 k56 k94321,0 k
abr 200929 2116 k 2,94641,1 k21 Mb1,0 M17 k55 k94321,0 k
mar 20092913116 k 2,94632,9 k21 Mb1,0 M17 k54 k94321,0 k
fev 20092823216 k152,74611,8 k21 Mb1,0 M17 k50 k9432997
jan 20092612115 k22,643826819 Mb993 k16 k49 k9434660
dez 200825   15 k 2,643611619 Mb986 k15 k49 k9430658
nov 200825   15 k 2,643611819 Mb986 k15 k49 k9430656
out 200825   15 k 2,643617519 Mb986 k15 k49 k9430656
set 20082512 15 k 2,643631319 Mb986 k15 k49 k9430656
ago 200824 1 15 k 2,643565319 Mb985 k15 k48 k9430656
jul 200824   15 k 2,643542919 Mb985 k15 k48 k9430656
jun 200824 1 15 k 2,54351,0 k19 Mb985 k15 k47 k9530656
mai 200824 2 15 k 2,54351,2 k19 Mb984 k15 k46 k9530656
abr 200824 1 15 k 2,443514019 Mb984 k15 k44 k9530656
mar 20082411 15 k 2,443517619 Mb984 k15 k44 k9530656
fev 200823 1 15 k 2,443423119 Mb981 k15 k44 k9529656
jan 200823 1 15 k 2,343445619 Mb981 k15 k44 k9529654
dez 200723 2 15 k 2,343415719 Mb981 k15 k43 k9526654
nov 20072311 15 k 2,34345619 Mb980 k15 k43 k9525653
out 2007221  15 k 2,343412919 Mb980 k15 k43 k9525653
set 200721 1 15 k 2,34347719 Mb980 k15 k42 k9525653
ago 200721   15 k 2,34344819 Mb980 k15 k42 k9525653
jul 200721 1 15 k 2,343474519 Mb980 k15 k42 k9525653
jun 200721 1 15 k 2,24344019 Mb980 k15 k42 k9525653
mai 200721   15 k 2,24341,2 k19 Mb980 k15 k42 k9525653
abr 200721 2 15 k 2,243369019 Mb980 k15 k40 k9525653
mar 20072113 15 k 2,143332219 Mb980 k15 k40 k9525653
fev 200720 2 15 k 2,143350519 Mb979 k15 k39 k9525652
jan 200720 1 15 k 2,143375119 Mb978 k15 k39 k9525652
dez 20062012 15 k 24331,2 k19 Mb976 k15 k38 k9525647
nov 200619   15 k 1,943356619 Mb977 k15 k38 k9525646
out 200619 3215 k 1,94331,4 k19 Mb976 k15 k37 k9525646
set 200619 1 15 k 1,84331,0 k19 Mb976 k15 k36 k9523645
ago 200619 2 15 k 1,743355419 Mb976 k15 k35 k9522644
jul 200619 1115 k1451,74338,7 k19 Mb975 k15 k34 k922644
jun 200619 4111 k2311,64328,6 k14 Mb698 k11 k26 k922583
mai 2006191313,9 k82,35471,0 k8,3 Mb351 k3,5 k18 k923580
abr 200618 213,6 k522,25462,0 k8,0 Mb327 k3,1 k16 k922577
mar 2006183312,1 k402,85191,8 k4,5 Mb187 k2,6 k8,6 k922562
fev 20061517183424,83921,3 k1,2 Mb65 k2,4 k3,4 k119512
jan 20061423 76613,55211971,1 Mb57 k1,4 k2,7 k112138
dez 20051224 73613,45125051022 kb53 k1,3 k2,7 k19136
nov 200510 2 718 2,851148974 kb52 k1,1 k2,4 k 5136
out 200510 1 713 2,750851955 kb51 k1,1 k2,3 k 4134
set 200510111713 2,7507426954 kb51 k1,1 k2,3 k 4134
ago 2005912 712 2,1506101944 kb51 k1,1 k2,3 k12134
jul 2005814 70921,9505132935 kb51 k1,0 k2,2 k12133
jun 2005712 661 1,946233793 kb44 k1,0 k1,6 k11133
mai 2005613 658 1,845765774 kb43 k9941,6 k11132
abr 2005512165321,8448168747 kb42 k9941,5 k11129
mar 20054 2 584 1,738843565 kb33 k96468711128
fev 20054121581111,6390463562 kb33 k95366911127
jan 2005323127091,8121451122 kb6,3 k3874311118
dez 20041   5 4,419634,4 kb179175 14
nov 20041   4 4,819343,4 kb177165 14
out 20041   4 3,8260 3,7 kb194145 14
set 20041   4 3,826063,7 kb194145 14
ago 20041   2 4,5444 2,5 kb165115 11
jul 20041   2 4,544422,5 kb165115 11
jun 20041   1 7183 775 5165  1
mai 20041   1 7183 775 5165  1
abr 20041   1 7183 775 5165  1
mar 20041   1 71831775 5165  1
fev 20041   1 6184 734 5164  1
jan 20041   1 6184 734 5164  1
dez 20031   1 61842734 5164  1
nov 20031   1 4126 277 1823   
out 20031   1 41261277 1823   
set 20031   1 31281280 1823   
ago 20031   1 2128 214 182    
jul 20031   1 21281214 182    
jun 200311  1 11521264 25     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201824 59 28 114 55      147
jan 201824 38 28 114 52      147
out 2017242029 28 113 51      147
jul 201724314737276114 12      147
abr 201724 58343019113 54      147
jan 2017243258 29 113 61      147
out 2016252657 29 113 58      147
jul 2016251447 29 111 61      147
abr 201625 47 271111 3      147
jan 201625721 474497 60      147
out 2015271831 45298 9      147
jul 2015272933 695352 57      147
abr 2015313812 693854 67      147
jan 2015311415436945511665475064745756147
out 20144240574669625018103444863745662147
jul 2014423429196654481934444762705469147
abr 2014423120276436541841444766705470147
jan 2014424289496159561985434771705475147
out 2013422924336137581955414770706075147
jul 2013423947515954552094414770686373147
abr 2013423623265948541963404769676371147
jan 2013444582545867531861404868666170147
out 2012453682495564561695404767656169147
jul 2012435267545470531691404667636271147
abr 2012413951525466541674384467636171147
jan 2012423560505364541858374267636172147
out 2011404268495268531782364065595873147
jul 2011404483495070501777363965575773147
abr 2011402960454861541973333865575770147
jan 2011413581504661521971313665555466147
out 2010413784554460541964303363545465147
jul 2010413652624067551961293161525463147
abr 2010424881584058581970293159505064147
jan 2010423359533961661864273059504964147
out 2009424163543756611861272958484563147
jul 2009403250563659601735242953454464147
abr 2009415255553553621549212752444264147
jan 2009414554353344571556202551414163147
out 2008413675433263561355202550384161146
jul 2008413273463159581355192549363859146
abr 2008404259493064551362172345333657146
jan 2008394359512959571157151940323454146
out 200736337650266352964131737302854146
jul 2007354558442559521038121533282558145
abr 200731404847236150948111332282254145
jan 200727506046216649644111328272055145
out 200625403725195246633101028221951145
jul 200624415431166446147825183048145
abr 2006213937292773462271240222650145
jan 2006221830344040373740273343303750137
out 2005243442263336323247242640274161121
jul 2005242619243027292938212237222867116
abr 2005301924192624202023172030192270103
jan 200539111615271316161525283446166590
out 200452273116472111115651544749115676
jul 200443192610411855394140363393955
abr 200419785195441413141265819
jan 200416443164331010101064916
out 200314332143221010101064614
jul 20031354313322101091074613
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  100000  1  3  5  10  25  5  10  100  1  3  5  10  25  100  250  1000  2500  5  10  100 
mai 20186222211                 3221111     
abr 20185111                   2           
mar 20186111                   5           
fev 201872111          1       511         
jan 201874311                  33          
dez 20176222211         3       6321        
nov 201772211                  1111        
out 201765521                  11          
set 20173221           1       3           
ago 201771111111        322     52211111    
jul 2017832111111               211111111211
jun 20174111111111      21      93321111    
mai 201715108331111       2       521111   1  
abr 2017711111111 222   1       821111   11 
mar 2017622111111 2221  31      4111111     
fev 201765443111  2221  21      86422    1  
jan 20176211     2211          321         
dez 20161210844    111           942         
nov 201686551    221   1       5        11 
out 201641111    222           1        11 
set 2016411      331           11       11 
ago 2016        222   11      21       11 
jul 201663211    332                    11 
jun 20164       3331          2        11 
mai 201631111    33311 1       211         
abr 2016422      333111        2           
mar 2016106521    331   3       7321     11 
fev 20163211           11      11          
jan 2016119983    111   1       5111     11 
abr 20185111                   2           
jan 201874311                  33          
out 201765521                  11          
jul 2017832111111               211111111211
abr 2017711111111 222   1       821111   11 
jan 20176211     2211          321         
out 201641111    222           1        11 
jul 201663211    332                    11 
abr 2016422      333111        2           
jan 2016119983    111   1       5111     11 
out 201595531    33321 3       14631     21 
jul 2015126442    2211  1       84431    11 
abr 2015231817107    22    2    22218139631   22 
jan 2015211612116    11    32      14542     111
out 20143111     1             4211        
jul 201412444433   211           42211       
abr 20141099982    11    1       149973       
jan 201442      221   1       71          
out 2013866661          1       169873       
jul 201332221    11            6331        
abr 20131087732    32    2       118633       
jan 20131       441           3        11 
out 201232      33            71       11 
jul 2012211      111           9        1  
abr 2012222      331   11      4331        
jan 2012311      442           2        21 
out 2011321      331   11      6        11 
jul 201152      111   1       31          
abr 201132111    221   2       62111       
jan 20113       221           6           
out 20105111111         11      6321        
jul 20103332211         2       2222        
abr 20104211111         1       62       11 
jan 20104322111         3       422211      
out 20096321111         21      411         
jul 20094333211   2111  1       5222     1  
abr 200974221111  1     1       421         
jan 2009732111    22    1       4321     11 
out 20082       221   1       422         
jul 20083       332   1       4           
abr 200811111    11    3       6           
jan 2008321      222   2       6           
out 20074       111   1111    3           
jul 2007321      111           221         
abr 20074321     111   1111    2111        
jan 200722111    111   1111    11111       
out 2006633332    111   3111    311         
jul 20065111111   2222  411     62111    11 
abr 200611322111   111   411     5221        
jan 2006105333    22    43221   644221      
out 20058211           11                  
jul 2005126411    11    1       2           
abr 2005622111          3221    42221       
jan 20055432211         3111    211111      
out 2004                                  
jul 20041                                 
abr 2004                                  
jan 2004                                  
out 2003                                  
jul 2003                                  

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1421100.0%91,649100.0%
321250.4%91,32099.6%
1015236.1%90,96799.3%
328520.2%89,74497.9%
100399.3%87,34395.3%
316174.0%83,65391.3%
1000112.6%80,69088.0%
316220.5%65,17571.1%
1000020.5%65,17571.1%
3162310.2%51,59656.3%

 

5 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Asinis632UC1 051,5964998,356260fev 14, 201747028,281715,832192
AcamicamacaracaUC41+1148374137jan 01, 20181491141
B dashUC418...11--mai 09, 201821----
Немања 93UC419...11--mai 09, 201821----
TajnesaolinaUC420...11--mai 25, 20185----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC213,579jan 27, 20093410nov 08, 20102760
Bubbah63UC32,979fev 15, 20131930set 20, 2015983
Mickey MystiqueUC42,640fev 15, 20131930out 23, 2017219
KasterUC51,681jan 27, 20054871abr 21, 2017404
KadzoUC61,540jan 11, 20093426abr 03, 20093344
Crveni BaronUC71,522nov 19, 20054575jul 25, 20064327
Milos trifunovicUC81,496set 08, 2015995mar 31, 2016790
Linos MimiUC91,466fev 15, 20131930jul 11, 20141419
DungodungUC101,099mai 11, 20054767out 26, 2015947
The Milica TomovicUC111,092fev 15, 20131930jul 14, 20141416
GolijaUC12436jan 19, 20054879ago 14, 20054672
ImperatorkAUC13415fev 18, 20131927out 10, 2015963
SrBotUC14414set 09, 20054646out 04, 20054621
SashatoUC15396dez 19, 20054545set 12, 20064278
MilicaStajicUC16385nov 11, 20141296ago 04, 20151030
Taychy2110UC17315dez 14, 20131628dez 28, 20141249
FunakoshiUC18273out 02, 20131701mai 21, 20151105
NatalijaUC19263nov 07, 20141300mar 20, 20151167
PoletanicaUC20241fev 15, 20131930set 28, 20131705
Саша СтефановићUC21235dez 24, 20054540jan 12, 20093425

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 5.521 edições foram feitas por usuários anônimos, de um total de 452.502 edições ( 1e %)
  


24 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
IglbotUC1269,712set 04, 2015999mai 02, 2016758165,900-
СлоботUC214,669jul 14, 20093242mar 26, 20102987--
CrveniBaronBotUC313,761mar 04, 20064470jul 23, 2006432911,258-
RobotGMwiktUC413,721jul 21, 20054696jun 06, 20083645--
HydrizBotUC512,840jul 01, 20151064abr 23, 2017402--
UT-interwiki-BotUC610,024jun 12, 2016717abr 15, 2017410--
Luckas-botUC74,967mar 03, 20093375jan 27, 20141584--
KamikazeBotUC84,524dez 17, 20102721mar 07, 20131910--
JAnDbotUC93,027jun 10, 20122180set 25, 2016612--
VolkovBotUC102,574ago 20, 20073936abr 05, 20131881--
YS-BotUC111,666set 07, 20122091out 18, 2015955--
SpaceBirdyBotUC121,324jun 23, 20083628dez 30, 20093073--
BodhisattvaBotUC131,216fev 02, 20083770ago 19, 20083571--
AvocatoBotUC14843out 27, 20112407ago 28, 20131736--
MonoBotUC15217jan 17, 20083786jun 14, 20083637--
Makecat-botUC1684nov 10, 20122027abr 05, 20131881--
FelixBotUC1762dez 16, 20054548jun 14, 20064368--
CarsracBotUC1844dez 22, 20121985mai 21, 20131835--
タチコマ robotUC1932dez 06, 20112367jan 01, 2016880--
JackBotUC2011ago 10, 20102850ago 10, 20102850--
AibotUC217mai 13, 20083669jun 13, 20083638--
OctraBotUC224abr 20, 2017405abr 24, 2017401--
GetoBot~srwiktionaryUC232fev 08, 20064494fev 08, 20064494--
EscarbotUC241set 02, 20064288set 02, 20064288--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Ogg
mai 2018215 k6101154111,9 k294,9 k12      4
abr 2018215 k6101134111,9 k294,7 k12      4
mar 2018215 k6101134111,9 k294,7 k12      4
fev 2018215 k6101134111,9 k294,7 k12      4
jan 2018215 k6081134111,9 k294,7 k12      4
dez 2017215 k6081134111,9 k294,7 k12      4
nov 2017215 k6051114111,9 k294,7 k12      4
out 2017215 k6051114111,9 k294,7 k12      4
set 2017215 k6051114111,9 k294,7 k12      4
ago 2017215 k6041114111,9 k294,7 k12      4
jul 2017215 k604111491,6 k293,6 k12      4
jun 2017211 k604111491,0 k291,1 k12      4
mai 2017194 k603111497392969412      4
abr 2017191 k603111497192967512      4
mar 2017190 k603111497152953112      4
fev 2017188 k60398497032928411      4
jan 2017187 k60098447002927711      4
dez 2016187 k59998447002927511      4
nov 2016187 k59797447002927511      4
out 2016187 k59697447002927511      4
set 2016187 k59697447002927511      4
ago 2016187 k59697447002927511      4
jul 2016187 k59597447002927511      4
jun 2016187 k59597447002927511      4
mai 2016187 k59597447002927511      4
abr 2016185 k59595446972927511      4
mar 201648 k59495446972927511      4
fev 201648 k59495446902927511      4
jan 201648 k59495446902927511      4
dez 201547 k59495446882927311      4
nov 201547 k59095446872927211      4
out 201547 k58294446872927211      4
set 201534 k58193446722927211      4
ago 201521 k58193446722927211      4
jul 201520 k58093446612927211      4
jun 201520 k57993446532927111      4
mai 201520 k57793446532923111      4
abr 201520 k57793346522923111      3
mar 201520 k57593346522923111     6033
fev 201520 k57493346522923111     4753
jan 201520 k56993346522923111     3873
dez 201420 k56493346522923111     9933
nov 201419 k56488346372922811     7433
out 201419 k56362345962921711     153
set 201419 k56362345962921711     23
ago 201419 k56062345962921711     53
jul 201419 k55762345962921711     20693
jun 201419 k55762345962921711     5953
mai 201419 k55762 45912821711     1321 
abr 201418 k55762 45902221711     683 
mar 201418 k55461 45842221711     1118 
fev 201418 k55261 45832221711     647 
jan 201418 k54661 45832221711     9 
dez 201318 k54161 45832221711     313 
nov 201318 k54160 45712221711     197 
out 201318 k53654 45562121711     392 
set 201318 k52551 45522121711     406 
ago 201318 k50749 45482121711     13 
jul 201318 k50449 45482121611     59 
jun 201318 k50149 45482121611     360 
mai 201318 k49949 45482121611     58 
abr 201318 k49849 45302121611     385 
mar 201317 k48749 45292121611     660 
fev 201317 k47147 45072020811     180 
jan 201317 k46646 44992020611     1 
dez 201217 k46446 44992020611     14 
nov 201217 k45941 44792020211     10 
out 201217 k45941 44792020211     7 
set 201217 k45441 44792020211     4 
ago 201217 k45141 44792020211       
jul 201217 k44841 44792020211     8 
jun 201217 k44141 44792020211     11 
mai 201217 k43441 44792020211     3 
abr 201217 k43141 44782020211     10 
mar 201217 k42041 44772020211     6 
fev 201217 k41741 44772020111     24 
jan 201217 k41141 44772020111     7 
dez 201117 k40741 44772020111       
nov 201117 k40241 44772020111     2 
out 201117 k39241 44762020111     10 
set 201117 k38641 44762020111     48 
ago 201117 k38141 44762019711     16 
jul 201117 k37741 44722019511     11 
jun 201117 k37041 44722019511     18 
mai 201117 k36641 44722019511     15 
abr 201117 k36141 44702019511     73 
mar 201117 k35641 44692017811     10 
fev 201117 k35541 44672017811     3 
jan 201117 k35041 44662017811     4 
dez 201017 k34441 44662017811     29 
nov 201017 k33841 44662017811     283 
out 201017 k33440 44652017711     539 
set 201017 k33140 44642017711     477 
ago 201017 k32540 44642017411     379 
jul 201017 k31140 44642017411     853 
jun 201017 k30540 44582017411     630 
mai 201017 k29740 44582017411     625 
abr 201017 k29540 44582017411     445 
mar 201017 k29140 44582017411     641 
fev 201017 k28739 44542017411     581 
jan 201017 k28337 4446201479     347 
dez 200917 k24930 4436201399     396 
nov 200917 k24530 4436201399     495 
out 200917 k24430 4436201399     427 
set 200917 k24129 4436201379     423 
ago 200917 k23529 4435201379     632 
jul 200917 k23429 4435201379     533 
jun 200917 k22829 4411201339     384 
mai 200917 k22529 4410201339     821 
abr 200917 k22327 4410201339     1034 
mar 200917 k21427 4410201329     2876 
fev 200917 k21027 4410201329     1756 
jan 200916 k20427 4409201319     128 
dez 200816 k20327 4409201318     5 
nov 200816 k20327 4409201318     1 
out 200816 k19227 4409201318     4 
set 200816 k18227 4409201318     20 
ago 200816 k18027 4402201318     17 
jul 200816 k17527 4402201318     4 
jun 200816 k17327 4402201318     18 
mai 200816 k17026 4402201318     19 
abr 200816 k16326 4402201318     64 
mar 200816 k15826 4402201318     36 
fev 200816 k15426 4400201318     11 
jan 200816 k15326 4399201318     14 
dez 200716 k14926 4399201318     14 
nov 200716 k14626 4399201308     12 
out 200716 k14426 4399201308     6 
set 200716 k14126 4399201308     10 
ago 200716 k13926 4398201298     2 
jul 200716 k13726 4398201298     9 
jun 200716 k13726 4393201298     7 
mai 200716 k13526 4388201298     3 
abr 200716 k13526 4388201298     22 
mar 200716 k13526 4388201288     81 
fev 200716 k12925 438320838     65 
jan 200716 k12619 434120718     74 
dez 200616 k12618 433120698     78 
nov 200616 k12517 433020688     4 
out 200616 k12217 433020688     432 
set 200616 k11617 433020688     28 
ago 200616 k10816 432820628     21 
jul 200616 k10215 432420608     294 
jun 200611 k9715 431920598     169 
mai 20064,4 k8515 431720588     311 
abr 20064,2 k7913 430420518     566 
mar 20062,6 k7213 430320507     239 
fev 20061,3 k6413 428820497     1110 
jan 20069045712 422017444     142 
dez 20058722412 413115354     91 
nov 20058541611 41198214     30 
out 20058471410 41098174     25 
set 20058471410 41098174     408 
ago 20058461410 41078174     47 
jul 20058421210 41078174     106 
jun 20057941110 41078174     25 
mai 2005790119 31068174     51 
abr 2005782109 31068164     152 
mar 200571254 31021104     39 
fev 200570854 399194     461 
jan 200538844 39616      451 
dez 2004933 3           
nov 2004833 1           
out 20048 2 1           
set 20048 1 1           
ago 20043 1 1           
jul 20043   1           
jun 20042   1           
mai 20042   1           
abr 20042   1           
mar 20042   1           
fev 20042   1           
jan 20042   1           
dez 20032   1           
nov 20031               
out 20031               
set 20031               
ago 20031               
jul 20031               
jun 20031               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2003: 1 1 MTA

set 2003: 1 1 MTA

dez 2003: 1 1 Аборигини

jul 2004: 1 1 Главна страна

set 2004: 1 1 Аверзија

nov 2004: 1 1 Аверзија

dez 2004: 1 1 Абак

jan 2005: 1 2 агора , 2 2 агонија , 3 2 агониста , 4 1 дифамија

fev 2005: 1 2 инструментализам , 2 1 ајгир

mar 2005: 1 1 аграрски

abr 2005: 1 2 Дисимилација , 2 2 Аранђел , 3 2 Авакум , 4 2 Горан , 5 2 среда , 6 1 дисјункција

mai 2005: 1 3 Виконт , 2 2 Виа факти , 3 1 дисјункција

jun 2005: 1 2 изотерма , 2 2 Капо , 3 1 интелигенција

jul 2005: 1 2 троугао , 2 2 столица , 3 1 ложа

ago 2005: 1 2 интелигенција , 2 2 Инкубатор , 3 2 јун , 4 1 дискант

set 2005: 1 3 агора , 2 2 Абукушу , 3 2 абаџија , 4 2 Андрија , 5 1 дифамија

out 2005: 1 2 инсигније , 2 1 дисоцијација

nov 2005: 1 2 беснило , 2 1 Инјектор

dez 2005: 1 3 Главна страна , 2 2 светлети , 3 2 Ваљево , 4 2 Broken/Градови у Црној Гори , 5 1 дисјункција

jan 2006: 1 3 нож , 2 3 авион , 3 2 Релација , 4 2 затварач , 5 2 nóż , 6 2 вечера , 7 2 господ , 8 2 живот , 9 1 терзија

fev 2006: 1 4 Државе Европе/Енглески , 2 4 duae , 3 3 државе Европе/Азербејџански , 4 3 државе Европе/Албански , 5 3 meisie , 6 3 eins , 7 3 fast , 8 3 immer , 9 3 Öl , 10 3 Brot , 11 3 Butterbrot , 12 3 octo , 13 3 septem , 14 3 quinque , 15 3 quattuor , 16 3 tria , 17 3 tres , 18 2 државе Европе/Пољски , 19 1 адресанат

mar 2006: 1 3 Тренутни догађаји , 2 3 Бог , 3 3 Главна страна , 4 2 Капо , 5 2 аберација , 6 2 stupid , 7 2 један , 8 2 Боривој , 9 2 Авакум , 10 1 дисјункција

abr 2006: 1 2 дисоцијација , 2 2 Birne , 3 2 глава

mai 2006: 1 2 агониста , 2 2 безграничан , 3 2 бескорисност , 4 1 агонија

jun 2006: 1 2 дистрикт , 2 2 испорука , 3 2 Георгије , 4 1 дисоцијација

jul 2006: 1 2 интелигенција , 2 2 безболан

ago 2006: 1 2 агора , 2 2 Дисимилација

set 2006: 1 1 интервал

out 2006: 1 2 лежарина , 2 2 ave , 3 1 Ležarina

nov 2006: 1 1 Златибор

dez 2006: 1 3 талац , 2 3 престолонаследниковница , 3 2 март

jan 2007: 1 2 столица , 2 1 др.

fev 2007: 1 2 инсомнија , 2 1 фиг.

mar 2007: 1 2 Марко , 2 1 убрендити

abr 2007: 1 2 библиотека , 2 1 авилисантан

mai 2007: 1 1 абнорман

jun 2007: 1 1 indiferentnost

jul 2007: 1 1 Domicil

ago 2007: 1 1 Београд

set 2007: 1 2 Сотер , 2 2 аритметика

out 2007: 1 2 примаријус

nov 2007: 1 2 transparentnost

dez 2007: 1 2 мајстор , 2 2 ушур , 3 1 Мајстор

jan 2008: 1 2 Recesija

fev 2008: 1 3 ректор , 2 1 Ректор

mar 2008: 1 2 Рјечник архаизама

abr 2008: 1 1 Рјечник архаизама

mai 2008: 1 1 Рјечник архаизама

jun 2008: 1 1 Рјечник архаизама

jul 2008: 1 1 Рјечник архаизама

ago 2008: 1 1 Рјечник архаизама

set 2008: 1 1 Рјечник архаизама

out 2008: 1 1 diskinezije

nov 2008: 1 1 Рјечник архаизама

dez 2008: 1 1 Визионар

jan 2009: 1 2 волшебница , 2 2 жрец , 3 2 Мухамед , 4 2 свештеник , 5 1 фалетарица

fev 2009: 1 2 ст. , 2 2 абе , 3 2 двор , 4 2 абракадабра , 5 2 абака , 6 2 Авлија , 7 2 абдицирати , 8 2 universe , 9 2 имам , 10 2 вулкан , 11 1 аблујирати

mar 2009: 1 2 logistika , 2 2 абревијатура , 3 2 им. , 4 2 ж. , 5 2 абортус , 6 2 abnormalan

abr 2009: 1 3 аперцепција , 2 2 Словенија , 3 2 хаван

mai 2009: 1 2 експлоратер , 2 2 Amato , 3 2 Amando , 4 2 Abdieso , 5 2 губа , 6 1 жена

jun 2009: 1 2 Acacio , 2 1 neko

jul 2009: 1 2 џивџан , 2 2 мачка , 3 2 бабине , 4 2 адмирал , 5 1 ахенија

ago 2009: 1 3 биотоп

set 2009: 1 3 морфем , 2 2 носилац

out 2009: 1 2 hakeri , 2 2 адреса

nov 2009: 1 1 морфема

dez 2009: 1 2 ορίστε , 2 1 egzegeza

jan 2010: 1 2 Рјечник архаизама , 2 1 војн.

fev 2010: 1 3 laberint , 2 3 милијарда , 3 2 јул , 4 2 судбина , 5 2 Рјечник архаизама , 6 2 Александра , 7 2 абулија , 8 1 септембар

mar 2010: 1 2 пијаца , 2 2 Naissus , 3 1 Yi+Ze

abr 2010: 1 2 црна , 2 2 кушати , 3 2 Meyer

mai 2010: 1 1 септембар

jun 2010: 1 2 један , 2 1 зидухија

jul 2010: 1 2 биол. , 2 2 ентузијазам , 3 2 в. , 4 2 January

ago 2010: 1 3 Нови Сад , 2 1 Словенија

set 2010: 1 2 Врање , 2 2 TCP , 3 2 CDP , 4 2 RIP , 5 2 EIGRP , 6 1 лажица

out 2010: 1 2 Hassan , 2 1 Варцарка

nov 2010: 1 2 Hassan , 2 2 среда , 3 1 nůž

dez 2010: 1 2 Кина , 2 1 Фјорд

jan 2011: 1 1 Насловна страна

fev 2011: 1 1 Бијоград

mar 2011: 1 1 тахилалија

abr 2011: 1 1 јелен

mai 2011: 1 2 Сребрница , 2 1 Сребреница

jun 2011: 1 2 Београд , 2 1 φαΐ

jul 2011: 1 2 dvanaest

ago 2011: 1 1 שלום

set 2011: 1 1 Ευγενία

out 2011: 1 1 битва

nov 2011: 1 1 Рјечник архаизама

jan 2012: 1 2 Вампир

fev 2012: 1 1 Централна Африка

mar 2012: 1 1 marijana

abr 2012: 1 1 курија

mai 2012: 1 1 Конавли

jun 2012: 1 1 Стрешељ

jul 2012: 1 1 аламан

set 2012: 1 1 Šarlin

out 2012: 1 1 аб

nov 2012: 1 2 Босна и Херцеговина , 2 1 абажур

dez 2012: 1 1 Додатак:Unicode/Арапски

jan 2013: 1 1 пророк

fev 2013: 1 3 نَهْرٌ , 2 3 سَلامٌ , 3 2 مَضِيقُ بَحْرِيٍّ , 4 2 شَعَرٌ , 5 2 حَاجِبٌ , 6 2 لِحْيَةٌ , 7 2 وَجْهٌ , 8 2 أَنْفٌ , 9 2 نِمْرٌ , 10 2 فَمٌ , 11 2 أُذُنٌ , 12 2 لِسَانٌ , 13 1 وادِي

mar 2013: 1 4 أَثَرٌ , 2 3 رِيحٌ , 3 3 أَسَدٌ , 4 3 غَزالَةٌ , 5 3 كَلْبٌ , 6 3 فِيلٌ , 7 3 جَبْهَةٌ , 8 3 عَظَمٌ , 9 3 فَمٌ , 10 3 أُذُنٌ , 11 3 مَسْرَحٌ , 12 3 ثَقَافَةٌ , 13 3 سَلامٌ , 14 3 إِنْسَانٌ , 15 2 شَرْقٌ , 16 2 نَسْرٌ , 17 2 هِلالٌ , 18 2 قَمَرٌ , 19 2 شَمْسٌ , 20 2 ثَدْيٌ , 21 2 صَدْرٌ , 22 2 رِجْلٌ , 23 2 ذِرَاعٌ , 24 1 مُطْرِبٌ

abr 2013: 1 3 صَفٌّ , 2 3 نَشِيدٌ , 3 3 ذَهَبٌ , 4 3 شَرْقٌ , 5 2 إِقْلِيمٌ , 6 2 بَرْجَلٌ , 7 2 عَالَمٌ , 8 2 قُفّازٌ , 9 2 كَنيِسَةٌ , 10 2 مِحْفَظَةٌ , 11 2 لُغَةٌ , 12 2 بَيْتٌ , 13 2 شِهابٌ , 14 2 أَلماسٌ , 15 2 فَحْمٌ , 16 2 زُمُرُّدٌ , 17 2 قُطْبٌ , 18 2 جُغْرافِيا , 19 2 سَهْلٌ , 20 2 مَمْلَكَةٌ , 21 1 قَمِيصٌ

mai 2013: 1 2 كَتَبَ , 2 2 بُرْجٌ , 3 1 نَشِيطٌ

jun 2013: 1 2 بِدَايَةٌ , 2 2 وِكالَةٌ , 3 2 صَنْدُوقٌ , 4 2 شَرِكَةٌ , 5 2 هاتِفٌ , 6 2 حَضَارَةٌ , 7 2 مُحَاضَرَةٌ , 8 2 رَفٌّ , 9 2 وِزارَةٌ , 10 2 مَحْكَمَةٌ , 11 2 فِهْرِسٌ , 12 2 تِلمِيذٌ , 13 2 مَعْدِنٌ , 14 2 مُطْرِبٌ , 15 2 مَكْتَبٌ , 16 1 مَطْعَمٌ

jul 2013: 1 1 وَطَنٌ

ago 2013: 1 1 إِمْبَرَاطُورٌ

set 2013: 1 3 عَظِيمٌ , 2 3 ضَعِفٌ , 3 2 عَمِيقٌ , 4 2 عِمْلاقٌ , 5 2 حزين , 6 2 بَعيدٌ , 7 2 مُتَعَالٍ , 8 2 عَقْلانِيٌّ , 9 2 رَقِيقٌ , 10 2 عَادِلٌ , 11 2 كَسولٌ , 12 2 حَكِيمٌ , 13 1 حَزِينٌ

out 2013: 1 2 ضِفَّةٌ , 2 2 تَجْديدٌ , 3 2 إِيِجابِيٌ , 4 2 تاجِرٌ , 5 2 صَامِتٌ , 6 2 مَسافَةٌ , 7 2 شاعِرٌ , 8 1 وَقُورٌ

nov 2013: 1 2 مِينَاءُ , 2 2 رَقْصَةٌ , 3 1 طَاوِلَةٌ

dez 2013: 1 3 حافَةٌ , 2 2 جانِبٌ , 3 2 جامِعٌ , 4 2 دِينٌ , 5 2 جَنَّةٌ , 6 2 جُمْلَةٌ , 7 2 جَمالٌ , 8 2 جَدْوَلٌ , 9 2 جِدارٌ , 10 2 جارٌ , 11 2 تَمْرِينٌ , 12 2 جِدِّيٌّ , 13 2 تَقْويمٌ , 14 2 تَحْريرٌ , 15 2 تاريخٌ , 16 2 بَنْكٌ , 17 2 بابٌ , 18 2 حِذَاءٌ , 19 2 بَدْلَةٌ , 20 2 تِلمِيذٌ , 21 1 днсонирати

jan 2014: 1 1 حَجْمٌ

fev 2014: 1 3 سورٌ , 2 3 إِنْحِطاطٌ , 3 3 أُمَّةٌ , 4 3 أَهْلٌ , 5 3 إِجْتِمَاعٌ , 6 3 شاعِرٌ , 7 3 مُتَعاطِفٌ , 8 3 أَمْنٌ , 9 3 إِقتِصادٌ , 10 3 إِذَاعَةٌ , 11 3 أَدَبٌ , 12 2 سَلُّمٌ , 13 2 سيجارَةٌ , 14 2 بَطِيخَةٌ , 15 2 حَفْلَةٌ , 16 2 صورَةٌ , 17 2 سُؤالٌ , 18 2 شارِعٌ , 19 2 وَقُورٌ , 20 2 مُسْتَقِرٌّ , 21 2 خَاصٌّ , 22 2 شَيْخٌ , 23 2 رَئِيسٌ , 24 2 بَارِدٌ , 25 2 مُتَأَلِّقٌ

mar 2014: 1 3 لَفْظٌ , 2 3 غُرْفَةٌ , 3 3 صَلاةٌ , 4 3 صَديقٌ , 5 3 أَحْمَرُ , 6 3 جاهِلٌ , 7 3 نَارٌ , 8 2 عَمَلَ , 9 2 صَدَرَ , 10 2 بَلِدَ , 11 2 خَضِلَ , 12 2 سَلَخَ , 13 2 جَمُلَ , 14 2 رَسَمَ , 15 2 غَلَقَ , 16 2 نَظَرَ , 17 2 سَمِعَ , 18 2 فَتَحَ , 19 2 غَيْمٌ , 20 2 سَكَنَ , 21 2 جَلَبَ , 22 2 دَرَسَ , 23 2 لَوْنٌ , 24 2 قَرْنٌ , 25 2 سَلُّمٌ

abr 2014: 1 3 هَجَمَ , 2 2 رَحِمَ , 3 2 ي , 4 2 قَوْمٌ , 5 2 ذَبَحَ , 6 2 تَجَرَ , 7 2 حَذِقَ , 8 2 عَهِدَ , 9 2 مَزَقَ , 10 2 غَلَبَ , 11 2 شَرَعَ , 12 2 خَمَرَ , 13 2 دارٌ , 14 2 صَبَرَ , 15 2 شَغَلَ , 16 2 عَمَلَ , 17 2 صَلَحَ , 18 2 بَلِدَ , 19 2 خَضِلَ , 20 2 حَمَلَ , 21 2 جَمَعَ , 22 2 صَرَفَ , 23 2 خَرَجَ , 24 2 دَخَلَ , 25 2 شَرِبَ

mai 2014: 1 6 أَخْبَرَ , 2 4 شَرِكَ , 3 4 جَمُلَ , 4 4 حَصَدَ , 5 4 حَشَدَ , 6 4 حَسَبَ , 7 4 بَحَثَ , 8 4 حَرَمَ , 9 4 كَسَرَ , 10 4 سَجَدَ , 11 4 عَرَضَ , 12 4 نَظَرَ , 13 4 صَرَفَ , 14 4 بَلَغَ , 15 4 نَشَرَ , 16 4 نَهَضَ , 17 4 كَتَبَ , 18 3 ثَبَتَ , 19 3 بَسَطَ , 20 3 جَدَلَ , 21 3 نَتيجَةٌ , 22 3 سَرَدَ , 23 3 بَذَلَ , 24 3 حَصَلَ , 25 3 نَقَلَ

jun 2014: 1 3 حَيَوانٌ , 2 3 كَتَبَ , 3 2 إِلْزِمْ شُغُلَك , 4 2 رَوْحٌ , 5 2 الله , 6 2 حَياةٌ , 7 2 حائطٌ , 8 2 شَغَلَ , 9 2 سَلُّمٌ , 10 2 جارٌ , 11 2 إِنْحِطاطٌ , 12 2 إِمْتِحانٌ , 13 2 إِمْرَأَةٌ , 14 2 فَخورٌ , 15 1 نبي

jul 2014: 1 3 شَهْرٌ , 2 3 خَفَتَ , 3 3 جِهَةٌ , 4 3 وَقَفَ , 5 3 عَصْرِيٌّ , 6 3 فَحَصَ , 7 3 نَهَضَ , 8 3 نَافِذَةٌ , 9 3 شَعْبِيٌّ , 10 3 شَديدٌ , 11 3 تِلْقَائِيٌّ , 12 3 شَاعِرِيٌّ , 13 3 نَاقِدٌ , 14 3 بَارِدٌ , 15 3 مُتَأَلِّقٌ , 16 3 مُتَهَوِّسٌ , 17 3 سَاخِرٌ , 18 3 أُمَّةٌ , 19 3 مَوْضُوعِيٌّ , 20 3 مُتَوَتَّرٌ , 21 3 ذَوَّاقٌ , 22 3 عَصَبِيٌّ , 23 3 أَصْفَرُ , 24 3 أَسْوَدُ , 25 3 أَزْرَقُ

ago 2014: 1 1 Ogos

set 2014: 1 1 Оџаци

out 2014: 1 1 إِسْمٌ

nov 2014: 1 4 ord , 2 4 bord , 3 4 huvud , 4 3 mann , 5 3 dricka , 6 3 ansikte , 7 3 dörr , 8 3 bror , 9 3 مُتَرْجِمٌ , 10 3 قَهْوَةٌ , 11 3 äpple , 12 3 vatten , 13 3 fågel , 14 3 rum , 15 3 hus , 16 3 fråga , 17 3 hund , 18 2 مُدَّةٌ , 19 2 دَائِرَةٌ , 20 2 أُسْبُوعٌ , 21 2 dum , 22 2 kvinne , 23 2 kone , 24 2 søster , 25 2 gutt

dez 2014: 1 4 läsa , 2 3 ulica , 3 3 leva , 4 3 bröd , 5 3 sol , 6 3 fönster , 7 2 výborný , 8 2 česať , 9 2 أَرْمَلَةٌ , 10 2 byť , 11 2 modrý , 12 2 dobrý , 13 2 d´akovať , 14 2 dom , 15 2 dážď , 16 2 slovensko , 17 2 إِخْلَاصٌ , 18 2 súčasný , 19 2 око , 20 2 hrdina , 21 2 môcť , 22 2 bažant , 23 2 stroj , 24 2 حِكَايَةٌ , 25 2 آخِرَةٌ

jan 2015: 1 2 arbeid , 2 2 forfatter , 3 2 Slovenka , 4 2 slovák , 5 2 slovenčina , 6 2 izba , 7 2 počítač , 8 2 pivnica , 9 2 nedeľa , 10 1 щастя

fev 2015: 1 2 море , 2 1 сорочка

mar 2015: 1 2 حَالَةٌ , 2 2 شَخْصٌ , 3 2 حَبِيسٌ , 4 2 حِفْظٌ , 5 2 بَكِيمٌ , 6 2 بَيْضَةٌ , 7 2 مَحْفُوظٌ , 8 2 ثَابِتٌ , 9 2 ظُفْرٌ , 10 2 حَاسِدٌ , 11 2 plånbok , 12 2 sked , 13 2 förälder , 14 2 heta , 15 2 bokstav , 16 2 بَاسِلٌ

abr 2015: 1 3 سَعِيدٌ , 2 3 حَنَّانٌ , 3 3 تَاجٌ , 4 2 klänning , 5 2 järn , 6 2 nyckelpiga , 7 2 kylskåp , 8 2 handduk , 9 2 vinbär , 10 2 blåbär , 11 2 حَقِيقَةٌ , 12 2 مَرِيضٌ , 13 2 غَلِيظٌ , 14 2 خَالِصٌ , 15 2 مُمْتِعٌ , 16 2 حَرَمٌ , 17 2 تَحْلِيلٌ , 18 2 ظُفْرٌ , 19 2 حَاسِدٌ , 20 2 بَأْسٌ , 21 2 تَيْسٌ , 22 2 تَزَوُّجٌ , 23 2 ألَمٌ , 24 2 رَجْعٌ , 25 2 أَكْلٌ

mai 2015: 1 2 , 2 2 , 3 2 , 4 2 , 5 2 , 6 2 , 7 2 并且 , 8 2 表达 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 , 16 1

jun 2015: 1 2 إِشْتَجَرَ , 2 2 أَخَذَ , 3 2 أَجِلَ , 4 1 إِكْتَشَفَ

jul 2015: 1 2 بَادَ , 2 2 تَأَخَّرَ , 3 1 أَفْسَدَ

ago 2015: 1 1 حَسِبَ

set 2015: 1 2 видовчица , 2 2 дивља паприка , 3 2 кајсија , 4 2 и , 5 1 шобот

out 2015: 1 2 وَجَدَ , 2 1 είμαι

nov 2015: 1 2 مُرُورٌ , 2 2 صَوْتٌ , 3 1 مدة

dez 2015: 1 3 robota , 2 2 طَابِقٌ , 3 2 مُرْسِلٌ , 4 2 tučný , 5 2 robotnícky , 6 2 literárny , 7 2 celý , 8 2 مُخْتَلِفٌ , 9 2 іграшка , 10 2 обіцянка , 11 2 أُسْطُورَةٌ , 12 2 سَمَكَةٌ , 13 2 طَبَقٌ , 14 2 خَيْمَةٌ , 15 2 hosť , 16 2 bystrý , 17 2 pochod , 18 2 bylina , 19 1 马其顿

jan 2016: 1 2 Божанствено

fev 2016: 1 1 вінок

mar 2016: 1 1 حَبَّةٌ

abr 2016: 1 1 صَبْغَةٌ

mai 2016: 1 1 šumska crvenrepka

jun 2016: 1 1 zeru

jul 2016: 1 2 студент , 2 1 озеро

set 2016: 1 1 државе Европе/Енглески

out 2016: 1 2 сумний , 2 1 відповідь

nov 2016: 1 1 乐不思蜀

dez 2016: 1 2 chlap , 2 2 轰轰烈烈 , 3 2 postel' , 4 2 全力以赴 , 5 1 眼高手低

jan 2017: 1 1 ľúbiť

fev 2017: 1 2 jiāng , 2 2 hovoriť , 3 1 誡命

mar 2017: 1 2 , 2 2 ти , 3 1

abr 2017: 1 2 Новак , 2 2 , 3 1 除去

mai 2017: 1 2 klokke , 2 2 ting , 3 2 kjøtt , 4 2 brød , 5 2 kake , 6 2 datter , 7 2 trikk , 8 2 kopp , 9 2 far , 10 2 barn , 11 1 來人

jun 2017: 1 2 nemaran , 2 2 hladnokrvan , 3 2 агора , 4 1 његове

jul 2017: 1 2 запарложен , 2 2 krokodil , 3 1 Милоша

ago 2017: 1 2 , 2 2 пехар , 3 1 путовао

set 2017: 1 1 múdry

out 2017: 1 2 гроші , 2 2 дочка , 3 1 егоизам

nov 2017: 1 3 , 2 2 ніж , 3 2 гора

dez 2017: 1 2 , 2 1 昏迷

jan 2018: 1 2 ich , 2 1 Индекс:Кинески пинјин/н

fev 2018: 1 2 Aleksa Papic

mar 2018: 1 2 Herostratizam , 2 2 čamovina

abr 2018: 1 1 транскрипција

mai 2018: 1 2 Африка , 2 2 хиљаду , 3 2 квадрат , 4 2 Азија , 5 2 Нови Сад , 6 2 Авакум , 7 2 Европа , 8 1 српски говор у Бочару (Банат)

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 9 de junho 2018 11:48

Dump file srwiktionary-20180601-stub-meta-history.xml.gz (edits only), size 24 Mb as gz -> 223 Mb
Dump processed till May 31, 2018, on server stat1005, ready at Sat-02/06/2018-06:47 after 2 min, 39 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.