Estatísticas da Wikcionário sérvio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2016
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2016+3%   0%   -24%      0%
nov 2016+3%   0%   -43%      0%
out 2016+1%   0%   +152%      0%
set 20160%   0%   +3%      0%
ago 20160%   0%   -47%      0%
jul 2016+2%   0%   -57%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201613847 185 k22,1 619      2,2 k
nov 201613445 185 k32,1 817      2,2 k
out 201613011 185 k 2,1 1,4 k      2,2 k
set 2016129 1 185 k 2,1 566      2,2 k
ago 2016129   185 k 2,1 552      2,2 k
jul 201612922 185 k 2,1 1,0 k      2,2 k
jun 2016127   185 k 2,1 2,4 k      2,2 k
mai 2016127 1 185 k512,1 19 k      2,2 k
abr 2016127 2 183 k45852 211 k      2,2 k
mar 201612715 45 k33,4 689      2,2 k
fev 201612611 45 k 3,4 21      2,2 k
jan 201612569 45 k43,4 447      2,2 k
dez 20151191319 45 k33,4 2,2 k      2,2 k
nov 2015106 2 45 k 3,4 845      2,2 k
out 201510625 45 k4383,3 29 k      2,1 k
set 201510413132 k4383,9 18 k      2,1 k
ago 2015103 6 18 k15,6 527      2,1 k
jul 201510314 18 k15,6 3,0 k      2,1 k
jun 2015102915 18 k45,5 465      2,1 k
mai 201593510218 k75,5 737      2,1 k
abr 201588117 18 k75,5 762      2,1 k
mar 201587217 18 k35,552880325 Mb1,4 M35 k86 k1731242,1 k
fev 201585312118 k35,552351925 Mb1,4 M34 k85 k1731242,1 k
jan 201582312 18 k25,551745324 Mb1,3 M33 k85 k1731242,1 k
dez 2014791325218 k55,55151,3 k24 Mb1,3 M33 k85 k1731082,1 k
nov 2014661425117 k75,550585924 Mb1,3 M31 k84 k172792,1 k
out 201452 1 17 k 5,54982223 Mb1,2 M30 k84 k172792,0 k
set 201452   17 k 5,5498523 Mb1,2 M30 k84 k172792,0 k
ago 201452   17 k 5,54984523 Mb1,2 M30 k84 k172792,0 k
jul 201452 4217 k15,54982,3 k23 Mb1,2 M30 k84 k172682,0 k
jun 201452 4217 k 5,450772923 Mb1,2 M28 k84 k171681,5 k
mai 201452 9417 k25,35081,3 k23 Mb1,2 M28 k84 k171681,5 k
abr 201452 9217 k55,350374923 Mb1,2 M26 k84 k171661,4 k
mar 20145229317 k35,34931,2 k22 Mb1,2 M24 k83 k166601,4 k
fev 20145029217 k 5,248671422 Mb1,2 M20 k83 k165601,4 k
jan 201448   17 k 5,248519822 Mb1,2 M19 k83 k165601,4 k
dez 201348 7117 k15,248578822 Mb1,2 M19 k82 k165601,4 k
nov 201348 5 17 k25,148320322 Mb1,2 M19 k81 k152601,4 k
out 20134816117 k45,148040722 Mb1,1 M19 k81 k124591,4 k
set 201347 6117 k55,247550521 Mb1,1 M19 k81 k98591,3 k
ago 201347 1 16 k 5,246815121 Mb1,1 M19 k81 k98591,3 k
jul 201347 2 16 k15,24679621 Mb1,1 M19 k81 k98591,3 k
jun 201347 5116 k15,246639821 Mb1,1 M19 k81 k98591,3 k
mai 201347 3 16 k15,24679121 Mb1,1 M19 k81 k98591,2 k
abr 201347 7116 k35,246643921 Mb1,1 M19 k80 k98591,2 k
mar 20134718216 k45,24631,4 k21 Mb1,1 M18 k80 k98591,2 k
fev 20134667 16 k25,145934120 Mb1,0 M18 k79 k96591,1 k
jan 201340   16 k 5,145688820 Mb1,0 M18 k79 k96591,1 k
dez 20124011 16 k 545622320 Mb1,0 M18 k78 k96591,1 k
nov 201239 1 16 k 545673220 Mb1,0 M18 k78 k96591,1 k
out 201239   16 k 545612020 Mb1,0 M18 k77 k95591,1 k
set 201239   16 k 545618320 Mb1,0 M18 k76 k95591,1 k
ago 201239   16 k 545659520 Mb1,0 M18 k76 k95501,1 k
jul 201239 1 16 k 4,945614120 Mb1,0 M18 k76 k95501,1 k
jun 201239 1 16 k 4,945613120 Mb1,0 M18 k75 k95501,1 k
mai 201239   16 k 4,945628320 Mb1,0 M18 k75 k95501,1 k
abr 201239 2 16 k 4,945632320 Mb1,0 M18 k75 k95501,1 k
mar 201239   16 k 4,945643520 Mb1,0 M18 k75 k95501,1 k
fev 20123911 16 k 4,945645720 Mb1,0 M18 k74 k95501,1 k
jan 201238 1 16 k 4,845677220 Mb1,0 M18 k74 k95501,1 k
dez 201138   16 k 4,84561,4 k20 Mb1,0 M18 k72 k95501,1 k
nov 201138   16 k 4,745617220 Mb1,0 M18 k70 k95501,1 k
out 201138 1 16 k 4,745628220 Mb1,0 M18 k70 k95501,1 k
set 201138 2 16 k14,745618120 Mb1,0 M18 k69 k95501,1 k
ago 20113811 16 k 4,745616620 Mb1,0 M18 k69 k95501,1 k
jul 201137   16 k 4,745615520 Mb1,0 M18 k68 k95501,1 k
jun 20113711 16 k 4,745687020 Mb1,0 M18 k68 k95501,1 k
mai 201136 2 16 k 4,645632720 Mb1,0 M18 k67 k95471,1 k
abr 20113611 16 k 4,645634220 Mb1,0 M18 k66 k95471,1 k
mar 201135 1 16 k 4,645727720 Mb1,0 M18 k66 k95471,0 k
fev 201135   16 k 4,545741220 Mb1,0 M18 k66 k95471,0 k
jan 201135   16 k 4,545724120 Mb1,0 M18 k65 k95471,0 k
dez 201035   16 k 4,545753720 Mb1,0 M18 k65 k95471,0 k
nov 20103523116 k 4,545729220 Mb1,0 M18 k64 k95471,0 k
out 201033 1116 k 4,545754520 Mb1,0 M18 k64 k94471,0 k
set 20103323116 k14,445747920 Mb1,0 M18 k63 k94471,0 k
ago 201031 2116 k 4,445740120 Mb1,0 M18 k63 k94471,0 k
jul 20103113116 k 4,445786420 Mb1,0 M18 k63 k94471,0 k
jun 201030 1116 k 4,346063720 Mb1,0 M18 k62 k94451,0 k
mai 201030 1116 k 4,346063220 Mb1,0 M18 k61 k94451,0 k
abr 201030 1116 k 4,246045220 Mb1,0 M18 k61 k94451,0 k
mar 201030 3116 k 4,246013 k20 Mb1,0 M18 k60 k94451,0 k
fev 201030 2116 k 3,446259821 Mb1,0 M18 k60 k94451,0 k
jan 201030 2116 k 3,346235121 Mb1,0 M17 k59 k94451,0 k
dez 20093012116 k 3,346241021 Mb1,0 M17 k59 k94441,0 k
nov 200929 1116 k 3,346250121 Mb1,0 M17 k58 k94431,0 k
out 200929 1116 k 3,346243321 Mb1,0 M17 k58 k94431,0 k
set 20092913116 k 3,246242321 Mb1,0 M17 k57 k94421,0 k
ago 200928 1116 k 3,246263321 Mb1,0 M17 k57 k94331,0 k
jul 20092813116 k 3,24622,4 k21 Mb1,0 M17 k56 k94331,0 k
jun 200927 2116 k 346438821 Mb1,0 M17 k56 k94321,0 k
mai 20092712116 k 346483221 Mb1,0 M17 k56 k94321,0 k
abr 200926 2116 k 2,94641,1 k21 Mb1,0 M17 k55 k94321,0 k
mar 20092612116 k 2,94632,9 k21 Mb1,0 M17 k54 k94321,0 k
fev 20092523216 k152,74611,8 k21 Mb1,0 M17 k50 k9432997
jan 20092322115 k22,643826819 Mb993 k16 k49 k9434660
dez 200821   15 k 2,643611619 Mb986 k15 k49 k9430658
nov 200821   15 k 2,643611819 Mb986 k15 k49 k9430656
out 200821   15 k 2,643617519 Mb986 k15 k49 k9430656
set 200821 2 15 k 2,643631319 Mb986 k15 k49 k9430656
ago 200821 1 15 k 2,643565319 Mb985 k15 k48 k9430656
jul 200821   15 k 2,643542919 Mb985 k15 k48 k9430656
jun 200821 1 15 k 2,54351,0 k19 Mb985 k15 k47 k9530656
mai 200821 2 15 k 2,54351,2 k19 Mb984 k15 k46 k9530656
abr 200821 1 15 k 2,443514019 Mb984 k15 k44 k9530656
mar 20082111 15 k 2,443517619 Mb984 k15 k44 k9530656
fev 200820 1 15 k 2,443423119 Mb981 k15 k44 k9529656
jan 200820 1 15 k 2,343445619 Mb981 k15 k44 k9529654
dez 200720   15 k 2,343415719 Mb981 k15 k43 k9526654
nov 20072011 15 k 2,34345619 Mb980 k15 k43 k9525653
out 200719   15 k 2,343412919 Mb980 k15 k43 k9525653
set 200719 1 15 k 2,34347719 Mb980 k15 k42 k9525653
ago 200719   15 k 2,34344819 Mb980 k15 k42 k9525653
jul 200719 1 15 k 2,343474519 Mb980 k15 k42 k9525653
jun 200719 1 15 k 2,24344019 Mb980 k15 k42 k9525653
mai 200719   15 k 2,24341,2 k19 Mb980 k15 k42 k9525653
abr 200719 2 15 k 2,243369019 Mb980 k15 k40 k9525653
mar 20071913 15 k 2,143332219 Mb980 k15 k40 k9525653
fev 200718 2 15 k 2,143350519 Mb979 k15 k39 k9525652
jan 200718 1 15 k 2,143375119 Mb978 k15 k39 k9525652
dez 20061812 15 k 24331,2 k19 Mb976 k15 k38 k9525647
nov 200617   15 k 1,943356619 Mb977 k15 k38 k9525646
out 200617 3115 k 1,94331,4 k19 Mb976 k15 k37 k9525646
set 200617   15 k 1,84331,0 k19 Mb976 k15 k36 k9523645
ago 200617 2 15 k 1,743355419 Mb976 k15 k35 k9522644
jul 200617 1115 k1451,74338,7 k19 Mb975 k15 k34 k922644
jun 200617 3111 k2311,64328,6 k14 Mb698 k11 k26 k922583
mai 2006171313,9 k82,35471,0 k8,3 Mb351 k3,5 k18 k923580
abr 2006161213,6 k522,25462,0 k8,0 Mb327 k3,1 k16 k922577
mar 2006152312,1 k402,85191,8 k4,5 Mb187 k2,6 k8,6 k922562
fev 20061316183424,83921,3 k1,2 Mb65 k2,4 k3,4 k119512
jan 20061212 76613,55211971,1 Mb57 k1,4 k2,7 k112138
dez 20051124 73613,45125051022 kb53 k1,3 k2,7 k19136
nov 2005912 718 2,851148974 kb52 k1,1 k2,4 k 5136
out 20058 1 713 2,750851955 kb51 k1,1 k2,3 k 4134
set 20058111713 2,7507426954 kb51 k1,1 k2,3 k 4134
ago 2005722 712 2,1506101944 kb51 k1,1 k2,3 k12134
jul 20055 4 70921,9505132935 kb51 k1,0 k2,2 k12133
jun 2005511 661 1,946233793 kb44 k1,0 k1,6 k11133
mai 2005413 658 1,845765774 kb43 k9941,6 k11132
abr 20053 2165321,8448168747 kb42 k9941,5 k11129
mar 20053 1 584 1,738843565 kb33 k96468711128
fev 20053 21581111,6390463562 kb33 k95366911127
jan 2005323127091,8121451122 kb6,3 k3874311118
dez 20041   5 4,419634,4 kb179175 14
nov 20041   4 4,819343,4 kb177165 14
out 20041   4 3,8260 3,7 kb194145 14
set 20041   4 3,826063,7 kb194145 14
ago 20041   2 4,5444 2,5 kb165115 11
jul 20041   2 4,544422,5 kb165115 11
jun 20041   1 7183 775 5165  1
mai 20041   1 7183 775 5165  1
abr 20041   1 7183 775 5165  1
mar 20041   1 71831775 5165  1
fev 20041   1 6184 734 5164  1
jan 20041   1 6184 734 5164  1
dez 20031   1 61842734 5164  1
nov 20031   1 4126 277 1823   
out 20031   1 41261277 1823   
set 20031   1 31281280 1823   
ago 20031   1 2128 214 182    
jul 20031   1 21281214 182    
jun 200311  1 11521264 25     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 2016252552 29 113 58      133
jul 2016251445 29 111 61      133
abr 201625 46 271111 3      133
jan 201625721 474496 60      133
out 2015271830 45299 9      133
jul 2015282832 695352 57      133
abr 2015313312 693855 67      133
jan 2015321315436945521665475064745756133
out 20144439564668625118103444863745661133
jul 2014433428256651491934444762705468133
abr 2014433120266535551841444766705468133
jan 2014444286496158581985434771705473133
out 2013432624326136581955414770706073133
jul 2013433847515954552094414770686371133
abr 2013423722375948551963404769676369133
jan 2013464582545867541861404868666168133
out 2012463581495564571695404767656167133
jul 2012464763545469541690404667636269133
abr 2012433949525466551674384467636169133
jan 2012443555505364551858374267636170133
out 2011414063485268531782364065595871133
jul 2011424481495069511777363965575771133
abr 2011422558454861551973333865575768133
jan 2011423579504761531971313665555464133
out 2010413580524460551964303363545463133
jul 2010423048564065561961293161525461133
abr 2010424673534058591970293159505062133
jan 2010423254483960651864273059504962133
out 2009423973503755611861272958484561133
jul 2009422749503659601735242953454462133
abr 2009435053473553621549212752444262133
jan 2009422550313345561556202551414161133
out 2008423674433263561355202550384159132
jul 2008413270443159581354192549363857132
abr 2008414156493063551361172345333655132
jan 2008414354512959571157151940323452132
out 200739397450266351964131737302852132
jul 2007374455442558521038121533282555131
abr 200732404147236151948111332282251131
jan 200731475143216549644111328272053131
out 200630383531195346633101028221949131
jul 200625394828166446147825183046131
abr 2006222735272773462271240222647131
jan 2006242836344040373740273343303646123
out 2005263341263336323247242640274157113
jul 2005353019253027292938212237222863108
abr 200543242319262420202317203019226696
jan 200539111614271316161525283445166186
out 200445252916452111115448524548115373
jul 200440192610401855374039353393854
abr 200418785195441413141265819
jan 200416443164331010101064916
out 200314332143221010101064614
jul 20031354313322101091074613
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  100000  1  3  5  10  25  5  10  100  1  3  5  10  25  100  5  10  100 
dez 20161210744   111           942      
nov 201686551   221   1       5     11 
out 201641111   222           1     11 
set 2016411     331           11    11 
ago 2016       222   11      21    11 
jul 201663211   332                 11 
jun 20164      3331          2     11 
mai 201631111   33311 1       311      
abr 2016422     333111        21       
mar 2016106521   331   3       7321  11 
fev 20163211          11      11       
jan 2016119983   111   1       5111  11 
dez 2015272019124   2111  11      248311 11 
nov 201515421    111   1       10111  11 
out 201595521   33321 3       14631  21 
set 201584311111 33221 3       62211 11 
ago 2015138631   221   21      95411 11 
jul 2015126442   2211  1       84431 11 
jun 2015241915133   11            177632 111
mai 2015231610832   11            126542 11 
abr 2015231817107   22    2    2221813963122 
mar 2015272117169   22    4    111177531 11 
fev 20151814121091   11    41      135411 11 
jan 2015211612116   11    32      14542  111
out 201641111   222           1     11 
jul 201663211   332                 11 
abr 2016422     333111        21       
jan 2016119983   111   1       5111  11 
out 201595521   33321 3       14631  21 
jul 2015126442   2211  1       84431 11 
abr 2015231817107   22    2    2221813963122 
jan 2015211612116   11    32      14542  111
out 20143111    1             4211     
jul 201412444422  111           42211    
abr 20141099982   11    1       149973    
jan 201442     221   1       71       
out 2013866661         1       169873    
jul 201332221   11            6331     
abr 20131087731   32    2       118633    
jan 20131      441           3     11 
out 201232     33            71    11 
jul 2012211     111           9     1  
abr 2012222     331   11      4331     
jan 2012311     442           2     21 
out 2011321     331   11      6     11 
jul 201152     111   2       31       
abr 201132111   221   2       62111    
jan 20111      221           6        
out 20105111111        11      6321     
jul 20103332211        2       2222     
abr 20104211111        1       62    11 
jan 20104322111        3       422211   
out 20096311111        21      411      
jul 20094333211  2111  1       5222  1  
abr 200974221111 1     1       421      
jan 2009732111   22    1       4321  11 
out 20082      221   1       422      
jul 20083      332   1       4        
abr 200811111   11    3       6        
jan 2008321     222   2       6        
out 20074      111   1111    3        
jul 2007321     111           221      
abr 20073321    111   1111    2111     
jan 200722111   111   1111    11111    
out 2006633331   111   3111    311      
jul 2006511111   2222  411     62111 11 
abr 200610322111  111   411     5221     
jan 200654222   22    43221   644221   
out 20056211          11               
jul 2005115411   11    1       2        
abr 2005322111         3221    42221    
jan 20055332211        3111    211111   
out 2004                              
jul 20041                             
abr 2004                              
jan 2004                              
out 2003                              
jul 2003                              

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1353100.0%39,489100.0%
319455.0%39,22499.3%
1014139.9%38,91998.6%
327822.1%37,76495.6%
1003710.5%35,63590.2%
316164.5%32,04581.1%
1000102.8%29,08273.6%
316210.3%13,57934.4%
1000010.3%13,57934.4%

 

12 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Mickey MystiqueUC3 02,63058252fev 15, 20131414197-171-
Marija TrnjanacUC41...757544dez 09, 201621181822
JovanaJ.UC43...7272--dez 09, 2016211414--
CommonsDelinkerUC50-261118-set 02, 20073407----
Tijana.bojicUC58...464622dez 09, 201621202011
Suncica955UC88...272766dez 09, 20162188--
Ida1041UC149...8866dez 09, 20162166--
JustvanjaUC165...6633dez 09, 20162122--
DARIO SEVERIUC166...66--dez 28, 20162----
Alexandra219UC193...4411dez 09, 20162122--
Milan VojnovicUC224...3311dez 09, 20162111--
Ketrin.995UC268...22--dez 12, 20161811--

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC113,579jan 27, 20092894nov 08, 20102244
Bubbah63UC22,979fev 15, 20131414set 20, 2015467
KasterUC41,679jan 27, 20054355nov 15, 20121506
KadzoUC51,540jan 11, 20092910abr 03, 20092828
Crveni BaronUC61,522nov 19, 20054059jul 25, 20063811
Milos trifunovicUC71,496set 08, 2015479mar 31, 2016274
Linos MimiUC81,466fev 15, 20131414jul 11, 2014903
DungodungUC91,099mai 11, 20054251out 26, 2015431
The Milica TomovicUC101,092fev 15, 20131414jul 14, 2014900
GolijaUC11436jan 19, 20054363ago 14, 20054156
ImperatorkAUC12415fev 18, 20131411out 10, 2015447
SrBotUC13414set 09, 20054130out 04, 20054105
SashatoUC14396dez 19, 20054029dez 19, 20054029
MilicaStajicUC15385nov 11, 2014780ago 04, 2015514
Taychy2110UC16315dez 14, 20131112dez 28, 2014733
FunakoshiUC17273out 02, 20131185mai 21, 2015589
NatalijaUC18263nov 07, 2014784mar 20, 2015651
PoletanicaUC19241fev 15, 20131414set 28, 20131189
Саша СтефановићUC20235dez 24, 20054024jan 12, 20092909
ItjustkindofhappenedUC21226nov 06, 2014785abr 30, 2015610

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 5.113 edições foram feitas por usuários anônimos, de um total de 392.409 edições ( 1e %)
  


21 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
IglbotUC1269,712set 04, 2015483mai 02, 2016242165,776-
СлоботUC214,670jul 14, 20092726mar 26, 20102471--
CrveniBaronBotUC313,761mar 04, 20063954jul 23, 2006381311,259-
RobotGMwiktUC413,721jul 21, 20054180jun 06, 20083129--
HydrizBotUC511,126jul 01, 2015548nov 26, 20163442-
Luckas-botUC64,967mar 03, 20092859jan 27, 20141068--
KamikazeBotUC74,524dez 17, 20102205mar 07, 20131394--
UT-interwiki-BotUC84,202jun 12, 2016201dez 31, 2016-493
JAnDbotUC93,027jun 10, 20121664set 25, 20169634-
VolkovBotUC102,574ago 20, 20073420abr 05, 20131365--
YS-BotUC111,666set 07, 20121575out 18, 2015439--
SpaceBirdyBotUC121,324jun 23, 20083112dez 30, 20092557--
BodhisattvaBotUC131,216fev 02, 20083254ago 19, 20083055--
AvocatoBotUC14843out 27, 20111891ago 28, 20131220--
MonoBotUC15217jan 17, 20083270jun 14, 20083121--
Makecat-botUC1684nov 10, 20121511abr 05, 20131365--
FelixBotUC1762dez 16, 20054032jun 14, 20063852--
CarsracBotUC1844dez 22, 20121469mai 21, 20131319--
AibotUC197mai 13, 20083153jun 13, 20083122--
GetoBot~srwiktionaryUC202fev 08, 20063978fev 08, 20063978--
EscarbotUC211set 02, 20063772set 02, 20063772--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Ogg
dez 2016187 k61498457022927712      4
nov 2016187 k61297457022927712      4
out 2016187 k61197457022927712      4
set 2016187 k61197457022927712      4
ago 2016187 k61197457022927712      4
jul 2016187 k61097457022927712      4
jun 2016187 k61097457022927712      4
mai 2016187 k61097457022927712      4
abr 2016185 k60995456992927712      4
mar 201648 k60895456992927712      4
fev 201648 k60895456922927712      4
jan 201648 k60895456922927712      4
dez 201547 k60895456902927512      4
nov 201547 k60495456892927412      4
out 201547 k59694456892927412      4
set 201534 k59593456742927412      4
ago 201521 k59593456742927412      4
jul 201520 k59493456632927412      4
jun 201520 k59393456552927312      4
mai 201520 k59193456552923312      4
abr 201520 k59193356542923312      3
mar 201520 k58993356542923312     6033
fev 201520 k58893356542923312     4753
jan 201520 k58393356542923312     3873
dez 201420 k57893356542923312     9933
nov 201419 k57888356392923012     7433
out 201419 k57662355982921912     153
set 201419 k57662355982921912     23
ago 201419 k57262355982921912     53
jul 201419 k56862355982921912     20693
jun 201419 k56862355982921912     5953
mai 201419 k56862 55932821912     1321 
abr 201418 k56862 55922221912     683 
mar 201418 k56561 55862221912     1118 
fev 201418 k56361 55852221912     647 
jan 201418 k55761 55852221912     9 
dez 201318 k55261 55852221912     313 
nov 201318 k55260 55732221912     200 
out 201318 k54754 55582121912     392 
set 201318 k53651 55542121912     406 
ago 201318 k51849 55502121912     13 
jul 201318 k51549 55502121812     59 
jun 201318 k51249 55502121812     360 
mai 201318 k51049 55502121812     58 
abr 201318 k50949 55322121812     385 
mar 201317 k49749 55312121812     660 
fev 201317 k48147 55092021012     180 
jan 201317 k47646 55012020812     1 
dez 201217 k47446 55012020812     14 
nov 201217 k46941 54802020412     10 
out 201217 k46941 54802020412     7 
set 201217 k46441 54802020412     4 
ago 201217 k46141 54802020412       
jul 201217 k45841 54802020412     8 
jun 201217 k45141 54802020412     11 
mai 201217 k44441 54802020412     3 
abr 201217 k44141 54792020412     10 
mar 201217 k43041 54782020412     6 
fev 201217 k42741 54782020312     24 
jan 201217 k42141 54782020312     7 
dez 201117 k41741 54782020312       
nov 201117 k41241 54782020312     2 
out 201117 k40141 54772020312     10 
set 201117 k39541 54772020312     48 
ago 201117 k39041 54772019912     16 
jul 201117 k38641 54732019712     11 
jun 201117 k37941 54732019712     18 
mai 201117 k37541 54732019712     15 
abr 201117 k36941 54712019712     73 
mar 201117 k36441 54702018012     10 
fev 201117 k36341 54682018012     3 
jan 201117 k35841 54672018012     4 
dez 201017 k35241 54672018012     29 
nov 201017 k34641 54672018012     283 
out 201017 k34240 54662017912     539 
set 201017 k33940 54652017912     477 
ago 201017 k33240 54652017612     379 
jul 201017 k31740 54652017612     853 
jun 201017 k31140 54592017612     630 
mai 201017 k30040 54592017612     625 
abr 201017 k29840 54592017612     445 
mar 201017 k29440 54592017612     641 
fev 201017 k29039 54552017612     581 
jan 201017 k28637 54472014910     347 
dez 200917 k25030 54372014110     396 
nov 200917 k24630 54372014110     495 
out 200917 k24530 54372014110     427 
set 200917 k24229 54372013910     423 
ago 200917 k23629 54362013910     632 
jul 200917 k23529 54362013910     533 
jun 200917 k22929 54122013510     384 
mai 200917 k22629 54112013510     822 
abr 200917 k22427 54112013510     1034 
mar 200917 k21527 54112013410     2876 
fev 200917 k21127 54112013410     1756 
jan 200916 k20527 54102013310     128 
dez 200816 k20427 5410201339     5 
nov 200816 k20427 5410201339     1 
out 200816 k19327 5410201339     4 
set 200816 k18327 5410201339     20 
ago 200816 k18127 5403201339     17 
jul 200816 k17627 5403201339     4 
jun 200816 k17427 5403201339     18 
mai 200816 k17126 5403201339     19 
abr 200816 k16426 5403201339     64 
mar 200816 k15926 5403201339     36 
fev 200816 k15526 5401201339     11 
jan 200816 k15426 5400201339     14 
dez 200716 k15026 5400201339     14 
nov 200716 k14726 5400201329     12 
out 200716 k14526 5400201329     6 
set 200716 k14226 5400201329     10 
ago 200716 k14026 5399201319     2 
jul 200716 k13826 5399201319     9 
jun 200716 k13826 5394201319     7 
mai 200716 k13626 5389201319     3 
abr 200716 k13626 5389201319     22 
mar 200716 k13626 5389201309     81 
fev 200716 k13025 538420859     65 
jan 200716 k12719 534220739     74 
dez 200616 k12718 533220719     78 
nov 200616 k12617 533120699     4 
out 200616 k12317 533120699     432 
set 200616 k11717 533120699     28 
ago 200616 k10816 532920639     21 
jul 200616 k10215 532520619     294 
jun 200611 k9715 532020609     169 
mai 20064,4 k8515 531820599     311 
abr 20064,2 k7913 530420529     566 
mar 20062,6 k7213 530320518     239 
fev 20061,3 k6413 528820508     1110 
jan 20068945712 522017454     142 
dez 20058622412 513115364     91 
nov 20058441611 41198224     30 
out 20058371410 41098184     25 
set 20058371410 41098184     408 
ago 20058361410 41078184     47 
jul 20058321210 41078184     106 
jun 20057841110 41078184     25 
mai 2005780119 31068184     51 
abr 2005772109 31068174     152 
mar 200570254 31021104     39 
fev 200569854 399194     461 
jan 200537844 39616      451 
dez 2004933 3           
nov 2004833 1           
out 20048 2 1           
set 20048 1 1           
ago 20043 1 1           
jul 20043   1           
jun 20042   1           
mai 20042   1           
abr 20042   1           
mar 20042   1           
fev 20042   1           
jan 20042   1           
dez 20032   1           
nov 20031               
out 20031               
set 20031               
ago 20031               
jul 20031               
jun 20031               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2003: 1 1 MTA

set 2003: 1 1 MTA

dez 2003: 1 1 Аборигини

jul 2004: 1 1 Главна страна

set 2004: 1 1 Аверзија

nov 2004: 1 1 Аверзија

dez 2004: 1 1 Абак

jan 2005: 1 2 агора , 2 2 агонија , 3 2 агониста , 4 1 дифамија

fev 2005: 1 2 инструментализам , 2 1 ајгир

mar 2005: 1 1 аграрски

abr 2005: 1 2 Дисимилација , 2 2 Аранђел , 3 2 Авакум , 4 2 Горан , 5 2 среда , 6 1 дисјункција

mai 2005: 1 3 Виконт , 2 2 Виа факти , 3 1 дисјункција

jun 2005: 1 2 изотерма , 2 2 Капо , 3 1 интелигенција

jul 2005: 1 2 троугао , 2 2 столица , 3 1 ложа

ago 2005: 1 2 интелигенција , 2 2 Инкубатор , 3 2 јун , 4 1 дискант

set 2005: 1 3 агора , 2 2 Абукушу , 3 2 абаџија , 4 2 Андрија , 5 1 дифамија

out 2005: 1 2 инсигније , 2 1 дисоцијација

nov 2005: 1 2 беснило , 2 1 Инјектор

dez 2005: 1 3 Главна страна , 2 2 светлети , 3 2 Ваљево , 4 2 Broken/Градови у Црној Гори , 5 1 дисјункција

jan 2006: 1 3 нож , 2 3 авион , 3 2 Релација , 4 2 затварач , 5 2 nóż , 6 2 вечера , 7 2 господ , 8 2 живот , 9 1 терзија

fev 2006: 1 4 Државе Европе/Енглески , 2 4 duae , 3 3 државе Европе/Азербејџански , 4 3 државе Европе/Албански , 5 3 meisie , 6 3 eins , 7 3 fast , 8 3 immer , 9 3 Öl , 10 3 Brot , 11 3 Butterbrot , 12 3 octo , 13 3 septem , 14 3 quinque , 15 3 quattuor , 16 3 tria , 17 3 tres , 18 2 државе Европе/Пољски , 19 1 адресанат

mar 2006: 1 3 Тренутни догађаји , 2 3 Бог , 3 3 Главна страна , 4 2 Капо , 5 2 аберација , 6 2 stupid , 7 2 један , 8 2 Боривој , 9 2 Авакум , 10 1 дисјункција

abr 2006: 1 2 дисоцијација , 2 2 Birne , 3 2 глава

mai 2006: 1 2 агониста , 2 2 безграничан , 3 2 бескорисност , 4 1 агонија

jun 2006: 1 2 дистрикт , 2 2 испорука , 3 2 Георгије , 4 1 дисоцијација

jul 2006: 1 2 интелигенција , 2 2 безболан

ago 2006: 1 2 агора , 2 2 Дисимилација

set 2006: 1 1 интервал

out 2006: 1 2 лежарина , 2 2 ave , 3 1 Ležarina

nov 2006: 1 1 Златибор

dez 2006: 1 3 талац , 2 3 престолонаследниковница , 3 2 март

jan 2007: 1 2 столица , 2 1 др.

fev 2007: 1 2 инсомнија , 2 1 фиг.

mar 2007: 1 2 Марко , 2 1 убрендити

abr 2007: 1 2 библиотека , 2 1 авилисантан

mai 2007: 1 1 абнорман

jun 2007: 1 1 indiferentnost

jul 2007: 1 1 Domicil

ago 2007: 1 1 Београд

set 2007: 1 2 Сотер , 2 2 аритметика

out 2007: 1 2 примаријус

nov 2007: 1 2 transparentnost

dez 2007: 1 2 мајстор , 2 2 ушур , 3 1 Мајстор

jan 2008: 1 2 Recesija

fev 2008: 1 3 ректор , 2 1 Ректор

mar 2008: 1 2 Рјечник архаизама

abr 2008: 1 1 Рјечник архаизама

mai 2008: 1 1 Рјечник архаизама

jun 2008: 1 1 Рјечник архаизама

jul 2008: 1 1 Рјечник архаизама

ago 2008: 1 1 Рјечник архаизама

set 2008: 1 1 Рјечник архаизама

out 2008: 1 1 diskinezije

nov 2008: 1 1 Рјечник архаизама

dez 2008: 1 1 Визионар

jan 2009: 1 2 волшебница , 2 2 жрец , 3 2 Мухамед , 4 2 свештеник , 5 1 фалетарица

fev 2009: 1 2 ст. , 2 2 абе , 3 2 двор , 4 2 абракадабра , 5 2 абака , 6 2 Авлија , 7 2 абдицирати , 8 2 universe , 9 2 имам , 10 2 вулкан , 11 1 аблујирати

mar 2009: 1 2 logistika , 2 2 абревијатура , 3 2 им. , 4 2 ж. , 5 2 абортус , 6 2 abnormalan

abr 2009: 1 3 аперцепција , 2 2 Словенија , 3 2 хаван

mai 2009: 1 2 експлоратер , 2 2 Amato , 3 2 Amando , 4 2 Abdieso , 5 2 губа , 6 1 Blaziran

jun 2009: 1 2 Acacio , 2 1 neko

jul 2009: 1 2 џивџан , 2 2 мачка , 3 2 бабине , 4 2 адмирал , 5 1 ахенија

ago 2009: 1 3 биотоп

set 2009: 1 3 морфем , 2 2 носилац

out 2009: 1 2 hakeri , 2 2 адреса

nov 2009: 1 1 морфема

dez 2009: 1 2 ορίστε , 2 1 egzegeza

jan 2010: 1 2 Рјечник архаизама , 2 1 војн.

fev 2010: 1 3 laberint , 2 3 милијарда , 3 2 јул , 4 2 судбина , 5 2 Рјечник архаизама , 6 2 Александра , 7 2 абулија , 8 1 септембар

mar 2010: 1 2 пијаца , 2 2 Naissus , 3 1 Yi+Ze

abr 2010: 1 2 црна , 2 2 кушати , 3 2 Meyer

mai 2010: 1 1 септембар

jun 2010: 1 2 један , 2 1 зидухија

jul 2010: 1 2 биол. , 2 2 ентузијазам , 3 2 в. , 4 2 January

ago 2010: 1 3 Нови Сад , 2 1 Словенија

set 2010: 1 2 Врање , 2 2 TCP , 3 2 CDP , 4 2 RIP , 5 2 EIGRP , 6 1 лажица

out 2010: 1 2 Hassan , 2 1 Варцарка

nov 2010: 1 2 Hassan , 2 2 среда , 3 1 nůž

dez 2010: 1 2 Кина , 2 1 Фјорд

jan 2011: 1 1 Насловна страна

fev 2011: 1 1 Бијоград

mar 2011: 1 1 тахилалија

abr 2011: 1 1 јелен

mai 2011: 1 2 Сребрница , 2 1 Сребреница

jun 2011: 1 2 Београд , 2 1 φαΐ

jul 2011: 1 2 dvanaest

ago 2011: 1 1 שלום

set 2011: 1 1 Ευγενία

out 2011: 1 1 битва

nov 2011: 1 1 Рјечник архаизама

jan 2012: 1 2 Вампир

fev 2012: 1 1 Централна Африка

mar 2012: 1 1 marijana

abr 2012: 1 1 курија

mai 2012: 1 1 Конавли

jun 2012: 1 1 Стрешељ

jul 2012: 1 1 аламан

set 2012: 1 1 Šarlin

out 2012: 1 1 аб

nov 2012: 1 2 Босна и Херцеговина , 2 1 абажур

dez 2012: 1 1 Додатак:Unicode/Арапски

jan 2013: 1 1 пророк

fev 2013: 1 3 نَهْرٌ , 2 3 سَلامٌ , 3 2 مَضِيقُ بَحْرِيٍّ , 4 2 شَعَرٌ , 5 2 حَاجِبٌ , 6 2 لِحْيَةٌ , 7 2 وَجْهٌ , 8 2 أَنْفٌ , 9 2 نِمْرٌ , 10 2 فَمٌ , 11 2 أُذُنٌ , 12 2 لِسَانٌ , 13 1 وادِي

mar 2013: 1 4 أَثَرٌ , 2 3 رِيحٌ , 3 3 أَسَدٌ , 4 3 غَزالَةٌ , 5 3 كَلْبٌ , 6 3 فِيلٌ , 7 3 جَبْهَةٌ , 8 3 عَظَمٌ , 9 3 فَمٌ , 10 3 أُذُنٌ , 11 3 مَسْرَحٌ , 12 3 ثَقَافَةٌ , 13 3 سَلامٌ , 14 3 إِنْسَانٌ , 15 2 شَرْقٌ , 16 2 نَسْرٌ , 17 2 هِلالٌ , 18 2 قَمَرٌ , 19 2 شَمْسٌ , 20 2 ثَدْيٌ , 21 2 صَدْرٌ , 22 2 رِجْلٌ , 23 2 ذِرَاعٌ , 24 1 مُطْرِبٌ

abr 2013: 1 3 صَفٌّ , 2 3 نَشِيدٌ , 3 3 ذَهَبٌ , 4 3 شَرْقٌ , 5 2 إِقْلِيمٌ , 6 2 بَرْجَلٌ , 7 2 عَالَمٌ , 8 2 قُفّازٌ , 9 2 كَنيِسَةٌ , 10 2 مِحْفَظَةٌ , 11 2 لُغَةٌ , 12 2 بَيْتٌ , 13 2 شِهابٌ , 14 2 أَلماسٌ , 15 2 فَحْمٌ , 16 2 زُمُرُّدٌ , 17 2 قُطْبٌ , 18 2 جُغْرافِيا , 19 2 سَهْلٌ , 20 2 مَمْلَكَةٌ , 21 1 قَمِيصٌ

mai 2013: 1 2 كَتَبَ , 2 2 بُرْجٌ , 3 1 نَشِيطٌ

jun 2013: 1 2 بِدَايَةٌ , 2 2 وِكالَةٌ , 3 2 صَنْدُوقٌ , 4 2 شَرِكَةٌ , 5 2 هاتِفٌ , 6 2 حَضَارَةٌ , 7 2 مُحَاضَرَةٌ , 8 2 رَفٌّ , 9 2 وِزارَةٌ , 10 2 مَحْكَمَةٌ , 11 2 فِهْرِسٌ , 12 2 تِلمِيذٌ , 13 2 مَعْدِنٌ , 14 2 مُطْرِبٌ , 15 2 مَكْتَبٌ , 16 1 مَطْعَمٌ

jul 2013: 1 1 وَطَنٌ

ago 2013: 1 1 إِمْبَرَاطُورٌ

set 2013: 1 3 عَظِيمٌ , 2 3 ضَعِفٌ , 3 2 عَمِيقٌ , 4 2 عِمْلاقٌ , 5 2 حزين , 6 2 بَعيدٌ , 7 2 مُتَعَالٍ , 8 2 عَقْلانِيٌّ , 9 2 رَقِيقٌ , 10 2 عَادِلٌ , 11 2 كَسولٌ , 12 2 حَكِيمٌ , 13 1 حَزِينٌ

out 2013: 1 2 ضِفَّةٌ , 2 2 تَجْديدٌ , 3 2 إِيِجابِيٌ , 4 2 تاجِرٌ , 5 2 صَامِتٌ , 6 2 مَسافَةٌ , 7 2 شاعِرٌ , 8 1 وَقُورٌ

nov 2013: 1 2 مِينَاءُ , 2 2 رَقْصَةٌ , 3 1 طَاوِلَةٌ

dez 2013: 1 3 حافَةٌ , 2 2 جانِبٌ , 3 2 جامِعٌ , 4 2 دِينٌ , 5 2 جَنَّةٌ , 6 2 جُمْلَةٌ , 7 2 جَمالٌ , 8 2 جَدْوَلٌ , 9 2 جِدارٌ , 10 2 جارٌ , 11 2 تَمْرِينٌ , 12 2 جِدِّيٌّ , 13 2 تَقْويمٌ , 14 2 تَحْريرٌ , 15 2 تاريخٌ , 16 2 بَنْكٌ , 17 2 بابٌ , 18 2 حِذَاءٌ , 19 2 بَدْلَةٌ , 20 2 تِلمِيذٌ , 21 1 днсонирати

jan 2014: 1 1 حَجْمٌ

fev 2014: 1 3 سورٌ , 2 3 إِنْحِطاطٌ , 3 3 أُمَّةٌ , 4 3 أَهْلٌ , 5 3 إِجْتِمَاعٌ , 6 3 شاعِرٌ , 7 3 مُتَعاطِفٌ , 8 3 أَمْنٌ , 9 3 إِقتِصادٌ , 10 3 إِذَاعَةٌ , 11 3 أَدَبٌ , 12 2 سَلُّمٌ , 13 2 سيجارَةٌ , 14 2 بَطِيخَةٌ , 15 2 حَفْلَةٌ , 16 2 صورَةٌ , 17 2 سُؤالٌ , 18 2 شارِعٌ , 19 2 وَقُورٌ , 20 2 مُسْتَقِرٌّ , 21 2 خَاصٌّ , 22 2 شَيْخٌ , 23 2 رَئِيسٌ , 24 2 بَارِدٌ , 25 2 مُتَأَلِّقٌ

mar 2014: 1 3 لَفْظٌ , 2 3 غُرْفَةٌ , 3 3 صَلاةٌ , 4 3 صَديقٌ , 5 3 أَحْمَرُ , 6 3 جاهِلٌ , 7 3 نَارٌ , 8 2 عَمَلَ , 9 2 صَدَرَ , 10 2 بَلِدَ , 11 2 خَضِلَ , 12 2 سَلَخَ , 13 2 جَمُلَ , 14 2 رَسَمَ , 15 2 غَلَقَ , 16 2 نَظَرَ , 17 2 سَمِعَ , 18 2 فَتَحَ , 19 2 غَيْمٌ , 20 2 سَكَنَ , 21 2 جَلَبَ , 22 2 دَرَسَ , 23 2 لَوْنٌ , 24 2 قَرْنٌ , 25 2 سَلُّمٌ

abr 2014: 1 3 هَجَمَ , 2 2 رَحِمَ , 3 2 ي , 4 2 قَوْمٌ , 5 2 ذَبَحَ , 6 2 تَجَرَ , 7 2 حَذِقَ , 8 2 عَهِدَ , 9 2 مَزَقَ , 10 2 غَلَبَ , 11 2 شَرَعَ , 12 2 خَمَرَ , 13 2 دارٌ , 14 2 صَبَرَ , 15 2 شَغَلَ , 16 2 عَمَلَ , 17 2 صَلَحَ , 18 2 بَلِدَ , 19 2 خَضِلَ , 20 2 حَمَلَ , 21 2 جَمَعَ , 22 2 صَرَفَ , 23 2 خَرَجَ , 24 2 دَخَلَ , 25 2 شَرِبَ

mai 2014: 1 6 أَخْبَرَ , 2 4 شَرِكَ , 3 4 جَمُلَ , 4 4 حَصَدَ , 5 4 حَشَدَ , 6 4 حَسَبَ , 7 4 بَحَثَ , 8 4 حَرَمَ , 9 4 كَسَرَ , 10 4 سَجَدَ , 11 4 عَرَضَ , 12 4 نَظَرَ , 13 4 صَرَفَ , 14 4 بَلَغَ , 15 4 نَشَرَ , 16 4 نَهَضَ , 17 4 كَتَبَ , 18 3 ثَبَتَ , 19 3 بَسَطَ , 20 3 جَدَلَ , 21 3 نَتيجَةٌ , 22 3 سَرَدَ , 23 3 بَذَلَ , 24 3 حَصَلَ , 25 3 نَقَلَ

jun 2014: 1 3 حَيَوانٌ , 2 3 كَتَبَ , 3 2 إِلْزِمْ شُغُلَك , 4 2 رَوْحٌ , 5 2 الله , 6 2 حَياةٌ , 7 2 حائطٌ , 8 2 شَغَلَ , 9 2 سَلُّمٌ , 10 2 جارٌ , 11 2 إِنْحِطاطٌ , 12 2 إِمْتِحانٌ , 13 2 إِمْرَأَةٌ , 14 2 فَخورٌ , 15 1 نبي

jul 2014: 1 3 شَهْرٌ , 2 3 خَفَتَ , 3 3 جِهَةٌ , 4 3 وَقَفَ , 5 3 عَصْرِيٌّ , 6 3 فَحَصَ , 7 3 نَهَضَ , 8 3 نَافِذَةٌ , 9 3 شَعْبِيٌّ , 10 3 شَديدٌ , 11 3 تِلْقَائِيٌّ , 12 3 شَاعِرِيٌّ , 13 3 نَاقِدٌ , 14 3 بَارِدٌ , 15 3 مُتَأَلِّقٌ , 16 3 مُتَهَوِّسٌ , 17 3 سَاخِرٌ , 18 3 أُمَّةٌ , 19 3 مَوْضُوعِيٌّ , 20 3 مُتَوَتَّرٌ , 21 3 ذَوَّاقٌ , 22 3 عَصَبِيٌّ , 23 3 أَصْفَرُ , 24 3 أَسْوَدُ , 25 3 أَزْرَقُ

ago 2014: 1 1 Ogos

set 2014: 1 1 Оџаци

out 2014: 1 1 إِسْمٌ

nov 2014: 1 4 ord , 2 4 bord , 3 4 huvud , 4 3 mann , 5 3 dricka , 6 3 ansikte , 7 3 dörr , 8 3 bror , 9 3 مُتَرْجِمٌ , 10 3 قَهْوَةٌ , 11 3 äpple , 12 3 vatten , 13 3 fågel , 14 3 rum , 15 3 hus , 16 3 fråga , 17 3 hund , 18 2 مُدَّةٌ , 19 2 دَائِرَةٌ , 20 2 أُسْبُوعٌ , 21 2 dum , 22 2 kvinne , 23 2 kone , 24 2 søster , 25 2 gutt

dez 2014: 1 4 läsa , 2 3 ulica , 3 3 leva , 4 3 bröd , 5 3 sol , 6 3 fönster , 7 2 výborný , 8 2 česať , 9 2 أَرْمَلَةٌ , 10 2 byť , 11 2 modrý , 12 2 dobrý , 13 2 d´akovať , 14 2 dom , 15 2 dážď , 16 2 slovensko , 17 2 إِخْلَاصٌ , 18 2 súčasný , 19 2 око , 20 2 hrdina , 21 2 môcť , 22 2 bažant , 23 2 stroj , 24 2 حِكَايَةٌ , 25 2 آخِرَةٌ

jan 2015: 1 2 arbeid , 2 2 forfatter , 3 2 Slovenka , 4 2 slovák , 5 2 slovenčina , 6 2 izba , 7 2 počítač , 8 2 pivnica , 9 2 nedeľa , 10 1 щастя

fev 2015: 1 2 море , 2 1 сорочка

mar 2015: 1 2 حَالَةٌ , 2 2 شَخْصٌ , 3 2 حَبِيسٌ , 4 2 حِفْظٌ , 5 2 بَكِيمٌ , 6 2 بَيْضَةٌ , 7 2 مَحْفُوظٌ , 8 2 ثَابِتٌ , 9 2 ظُفْرٌ , 10 2 حَاسِدٌ , 11 2 plånbok , 12 2 sked , 13 2 förälder , 14 2 heta , 15 2 bokstav , 16 2 بَاسِلٌ

abr 2015: 1 3 سَعِيدٌ , 2 3 حَنَّانٌ , 3 3 تَاجٌ , 4 2 klänning , 5 2 järn , 6 2 nyckelpiga , 7 2 kylskåp , 8 2 handduk , 9 2 vinbär , 10 2 blåbär , 11 2 حَقِيقَةٌ , 12 2 مَرِيضٌ , 13 2 غَلِيظٌ , 14 2 خَالِصٌ , 15 2 مُمْتِعٌ , 16 2 حَرَمٌ , 17 2 تَحْلِيلٌ , 18 2 ظُفْرٌ , 19 2 حَاسِدٌ , 20 2 بَأْسٌ , 21 2 تَيْسٌ , 22 2 تَزَوُّجٌ , 23 2 ألَمٌ , 24 2 رَجْعٌ , 25 2 أَكْلٌ

mai 2015: 1 2 , 2 2 , 3 2 , 4 2 , 5 2 , 6 2 , 7 2 并且 , 8 2 表达 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 , 16 1

jun 2015: 1 2 إِشْتَجَرَ , 2 2 أَخَذَ , 3 2 أَجِلَ , 4 1 إِكْتَشَفَ

jul 2015: 1 2 بَادَ , 2 2 تَأَخَّرَ , 3 1 أَفْسَدَ

ago 2015: 1 1 حَسِبَ

set 2015: 1 2 видовчица , 2 2 дивља паприка , 3 2 кајсија , 4 2 и , 5 1 шобот

out 2015: 1 2 وَجَدَ , 2 1 είμαι

nov 2015: 1 2 مُرُورٌ , 2 2 صَوْتٌ , 3 1 مدة

dez 2015: 1 3 robota , 2 2 طَابِقٌ , 3 2 مُرْسِلٌ , 4 2 tučný , 5 2 robotnícky , 6 2 literárny , 7 2 celý , 8 2 مُخْتَلِفٌ , 9 2 іграшка , 10 2 обіцянка , 11 2 أُسْطُورَةٌ , 12 2 سَمَكَةٌ , 13 2 طَبَقٌ , 14 2 خَيْمَةٌ , 15 2 hosť , 16 2 bystrý , 17 2 pochod , 18 2 bylina , 19 1 马其顿

jan 2016: 1 2 Божанствено

fev 2016: 1 1 вінок

mar 2016: 1 1 حَبَّةٌ

abr 2016: 1 1 صَبْغَةٌ

mai 2016: 1 1 šumska crvenrepka

jun 2016: 1 1 zeru

jul 2016: 1 2 студент , 2 1 озеро

set 2016: 1 1 државе Европе/Енглески

out 2016: 1 2 сумний , 2 1 відповідь

nov 2016: 1 1 乐不思蜀

dez 2016: 1 2 chlap , 2 2 轰轰烈烈 , 3 2 postel' , 4 2 全力以赴 , 5 1 眼高手低

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 12 de janeiro 2017 23:51

Dump file srwiktionary-20170101-stub-meta-history.xml.gz (edits only), size 21 Mb as gz -> 189 Mb
Dump processed till Dec 31, 2016, on server stat1002, ready at Sun-01/01/2017-14:14 after 3 min, 10 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.