Estatísticas da Wikcionário sérvio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2017
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mar 20170%   +1%+212%  +88%      +3%
fev 2017+1%   0%   +273%      0%
jan 2017+1%   0%   +94%      0%
dez 2016+4%   0%   -24%      0%
nov 2016+3%   0%   -43%      0%
out 2016+1%   0%   +152%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 2017146 21188 k752,2 8,4 k      2,2 k
fev 2017146241185 k242,1 4,5 k      2,2 k
jan 201714411 185 k 2,1 1,2 k      2,2 k
dez 201614358 185 k22,1 619      2,2 k
nov 201613845 185 k32,1 817      2,2 k
out 201613411 185 k 2,1 1,4 k      2,2 k
set 2016133 1 185 k 2,1 566      2,2 k
ago 2016133   185 k 2,1 552      2,2 k
jul 201613322 185 k 2,1 1,0 k      2,2 k
jun 2016131   185 k 2,1 2,4 k      2,2 k
mai 2016131 1 185 k512,1 19 k      2,2 k
abr 2016131 2 183 k45842 211 k      2,2 k
mar 201613115 45 k33,4 689      2,2 k
fev 201613011 45 k 3,4 21      2,2 k
jan 201612969 45 k43,4 447      2,2 k
dez 20151231319145 k33,4 2,2 k      2,2 k
nov 2015110 2 45 k 3,4 845      2,2 k
out 201511025 45 k4383,3 29 k      2,1 k
set 201510813132 k4383,9 18 k      2,1 k
ago 2015107 6 18 k15,6 527      2,1 k
jul 201510714 18 k15,6 3,0 k      2,1 k
jun 2015106915 18 k45,5 465      2,1 k
mai 201597510218 k75,5 737      2,1 k
abr 201592117 18 k75,5 762      2,1 k
mar 201591218 18 k35,552880325 Mb1,4 M35 k86 k1731242,1 k
fev 201589312118 k35,552351925 Mb1,4 M34 k85 k1731242,1 k
jan 201586312 18 k25,551745324 Mb1,3 M33 k85 k1731242,1 k
dez 2014831325218 k55,55151,3 k24 Mb1,3 M33 k85 k1731082,1 k
nov 2014701425117 k75,550585924 Mb1,3 M31 k84 k172792,1 k
out 201456 1 17 k 5,54982223 Mb1,2 M30 k84 k172792,0 k
set 201456   17 k 5,5498523 Mb1,2 M30 k84 k172792,0 k
ago 201456   17 k 5,54984523 Mb1,2 M30 k84 k172792,0 k
jul 201456 4317 k15,54982,3 k23 Mb1,2 M30 k84 k172682,0 k
jun 201456 4317 k 5,450772923 Mb1,2 M28 k84 k171681,5 k
mai 201456 9417 k25,35081,3 k23 Mb1,2 M28 k84 k171681,5 k
abr 201456 9217 k55,350374923 Mb1,2 M26 k84 k171661,4 k
mar 20145629317 k35,34931,2 k22 Mb1,2 M24 k83 k166601,4 k
fev 20145429217 k 5,248671422 Mb1,2 M20 k83 k165601,4 k
jan 201452   17 k 5,248519822 Mb1,2 M19 k83 k165601,4 k
dez 201352 7117 k15,248578822 Mb1,2 M19 k82 k165601,4 k
nov 201352 5 17 k25,148320322 Mb1,2 M19 k81 k152601,4 k
out 20135216117 k45,148040722 Mb1,1 M19 k81 k124591,4 k
set 201351 6117 k55,247550521 Mb1,1 M19 k81 k98591,3 k
ago 201351 1 16 k 5,246815121 Mb1,1 M19 k81 k98591,3 k
jul 201351 2 16 k15,24679621 Mb1,1 M19 k81 k98591,3 k
jun 201351 5116 k15,246639821 Mb1,1 M19 k81 k98591,3 k
mai 201351 3 16 k15,24679121 Mb1,1 M19 k81 k98591,2 k
abr 201351 7216 k35,246643921 Mb1,1 M19 k80 k98591,2 k
mar 20135118216 k45,24631,4 k21 Mb1,1 M18 k80 k98591,2 k
fev 20135067 16 k25,145934120 Mb1,0 M18 k79 k96591,1 k
jan 201344   16 k 5,145688820 Mb1,0 M18 k79 k96591,1 k
dez 20124411 16 k 545622320 Mb1,0 M18 k78 k96591,1 k
nov 201243 1 16 k 545673220 Mb1,0 M18 k78 k96591,1 k
out 201243   16 k 545612020 Mb1,0 M18 k77 k95591,1 k
set 201243   16 k 545618320 Mb1,0 M18 k76 k95591,1 k
ago 201243   16 k 545659520 Mb1,0 M18 k76 k95501,1 k
jul 201243 1 16 k 4,945614120 Mb1,0 M18 k76 k95501,1 k
jun 201243 1 16 k 4,945613120 Mb1,0 M18 k75 k95501,1 k
mai 201243   16 k 4,945628320 Mb1,0 M18 k75 k95501,1 k
abr 201243 2 16 k 4,945632320 Mb1,0 M18 k75 k95501,1 k
mar 201243   16 k 4,945643520 Mb1,0 M18 k75 k95501,1 k
fev 20124311 16 k 4,945645720 Mb1,0 M18 k74 k95501,1 k
jan 201242 1 16 k 4,845677220 Mb1,0 M18 k74 k95501,1 k
dez 201142   16 k 4,84561,4 k20 Mb1,0 M18 k72 k95501,1 k
nov 201142   16 k 4,745617220 Mb1,0 M18 k70 k95501,1 k
out 201142 1 16 k 4,745628220 Mb1,0 M18 k70 k95501,1 k
set 201142 2 16 k14,745618120 Mb1,0 M18 k69 k95501,1 k
ago 20114211 16 k 4,745616620 Mb1,0 M18 k69 k95501,1 k
jul 201141   16 k 4,745615520 Mb1,0 M18 k68 k95501,1 k
jun 20114111 16 k 4,745687020 Mb1,0 M18 k68 k95501,1 k
mai 201140 2 16 k 4,645632720 Mb1,0 M18 k67 k95471,1 k
abr 20114011 16 k 4,645634220 Mb1,0 M18 k66 k95471,1 k
mar 201139 1 16 k 4,645727720 Mb1,0 M18 k66 k95471,0 k
fev 201139   16 k 4,545741220 Mb1,0 M18 k66 k95471,0 k
jan 201139   16 k 4,545724120 Mb1,0 M18 k65 k95471,0 k
dez 20103911 16 k 4,545753720 Mb1,0 M18 k65 k95471,0 k
nov 20103823116 k 4,545729220 Mb1,0 M18 k64 k95471,0 k
out 201036 1116 k 4,545754520 Mb1,0 M18 k64 k94471,0 k
set 20103623116 k14,445747920 Mb1,0 M18 k63 k94471,0 k
ago 201034 2116 k 4,445740120 Mb1,0 M18 k63 k94471,0 k
jul 20103413116 k 4,445786420 Mb1,0 M18 k63 k94471,0 k
jun 201033 1116 k 4,346063720 Mb1,0 M18 k62 k94451,0 k
mai 201033 1116 k 4,346063220 Mb1,0 M18 k61 k94451,0 k
abr 201033 1116 k 4,246045220 Mb1,0 M18 k61 k94451,0 k
mar 201033 3116 k 4,246013 k20 Mb1,0 M18 k60 k94451,0 k
fev 201033 2116 k 3,446259821 Mb1,0 M18 k60 k94451,0 k
jan 201033 2116 k 3,346235121 Mb1,0 M17 k59 k94451,0 k
dez 20093312116 k 3,346241021 Mb1,0 M17 k59 k94441,0 k
nov 200932 1116 k 3,346250121 Mb1,0 M17 k58 k94431,0 k
out 200932 2116 k 3,346243321 Mb1,0 M17 k58 k94431,0 k
set 20093214116 k 3,246242321 Mb1,0 M17 k57 k94421,0 k
ago 200931 1116 k 3,246263321 Mb1,0 M17 k57 k94331,0 k
jul 20093113116 k 3,24622,4 k21 Mb1,0 M17 k56 k94331,0 k
jun 200930 2116 k 346438821 Mb1,0 M17 k56 k94321,0 k
mai 20093012116 k 346483221 Mb1,0 M17 k56 k94321,0 k
abr 200929 2116 k 2,94641,1 k21 Mb1,0 M17 k55 k94321,0 k
mar 20092913116 k 2,94632,9 k21 Mb1,0 M17 k54 k94321,0 k
fev 20092823216 k152,74611,8 k21 Mb1,0 M17 k50 k9432997
jan 20092612115 k22,643826819 Mb993 k16 k49 k9434660
dez 200825   15 k 2,643611619 Mb986 k15 k49 k9430658
nov 200825   15 k 2,643611819 Mb986 k15 k49 k9430656
out 200825   15 k 2,643617519 Mb986 k15 k49 k9430656
set 20082512 15 k 2,643631319 Mb986 k15 k49 k9430656
ago 200824 1 15 k 2,643565319 Mb985 k15 k48 k9430656
jul 200824   15 k 2,643542919 Mb985 k15 k48 k9430656
jun 200824 1 15 k 2,54351,0 k19 Mb985 k15 k47 k9530656
mai 200824 2 15 k 2,54351,2 k19 Mb984 k15 k46 k9530656
abr 200824 1 15 k 2,443514019 Mb984 k15 k44 k9530656
mar 20082411 15 k 2,443517619 Mb984 k15 k44 k9530656
fev 200823 1 15 k 2,443423119 Mb981 k15 k44 k9529656
jan 200823 1 15 k 2,343445619 Mb981 k15 k44 k9529654
dez 200723 2 15 k 2,343415719 Mb981 k15 k43 k9526654
nov 20072311 15 k 2,34345619 Mb980 k15 k43 k9525653
out 2007221  15 k 2,343412919 Mb980 k15 k43 k9525653
set 200721 1 15 k 2,34347719 Mb980 k15 k42 k9525653
ago 200721   15 k 2,34344819 Mb980 k15 k42 k9525653
jul 200721 1 15 k 2,343474519 Mb980 k15 k42 k9525653
jun 200721 1 15 k 2,24344019 Mb980 k15 k42 k9525653
mai 200721   15 k 2,24341,2 k19 Mb980 k15 k42 k9525653
abr 200721 2 15 k 2,243369019 Mb980 k15 k40 k9525653
mar 20072113 15 k 2,143332219 Mb980 k15 k40 k9525653
fev 200720 2 15 k 2,143350519 Mb979 k15 k39 k9525652
jan 200720 1 15 k 2,143375119 Mb978 k15 k39 k9525652
dez 20062012 15 k 24331,2 k19 Mb976 k15 k38 k9525647
nov 200619   15 k 1,943356619 Mb977 k15 k38 k9525646
out 200619 3215 k 1,94331,4 k19 Mb976 k15 k37 k9525646
set 200619 1 15 k 1,84331,0 k19 Mb976 k15 k36 k9523645
ago 200619 2 15 k 1,743355419 Mb976 k15 k35 k9522644
jul 200619 1115 k1451,74338,7 k19 Mb975 k15 k34 k922644
jun 200619 4111 k2311,64328,6 k14 Mb698 k11 k26 k922583
mai 2006191313,9 k82,35471,0 k8,3 Mb351 k3,5 k18 k923580
abr 200618 213,6 k522,25462,0 k8,0 Mb327 k3,1 k16 k922577
mar 2006183312,1 k402,85191,8 k4,5 Mb187 k2,6 k8,6 k922562
fev 20061517183424,83921,3 k1,2 Mb65 k2,4 k3,4 k119512
jan 20061423 76613,55211971,1 Mb57 k1,4 k2,7 k112138
dez 20051224 73613,45125051022 kb53 k1,3 k2,7 k19136
nov 200510 2 718 2,851148974 kb52 k1,1 k2,4 k 5136
out 200510 1 713 2,750851955 kb51 k1,1 k2,3 k 4134
set 200510111713 2,7507426954 kb51 k1,1 k2,3 k 4134
ago 2005912 712 2,1506101944 kb51 k1,1 k2,3 k12134
jul 2005814 70921,9505132935 kb51 k1,0 k2,2 k12133
jun 2005712 661 1,946233793 kb44 k1,0 k1,6 k11133
mai 2005613 658 1,845765774 kb43 k9941,6 k11132
abr 2005512165321,8448168747 kb42 k9941,5 k11129
mar 20054 2 584 1,738843565 kb33 k96468711128
fev 20054121581111,6390463562 kb33 k95366911127
jan 2005323127091,8121451122 kb6,3 k3874311118
dez 20041   5 4,419634,4 kb179175 14
nov 20041   4 4,819343,4 kb177165 14
out 20041   4 3,8260 3,7 kb194145 14
set 20041   4 3,826063,7 kb194145 14
ago 20041   2 4,5444 2,5 kb165115 11
jul 20041   2 4,544422,5 kb165115 11
jun 20041   1 7183 775 5165  1
mai 20041   1 7183 775 5165  1
abr 20041   1 7183 775 5165  1
mar 20041   1 71831775 5165  1
fev 20041   1 6184 734 5164  1
jan 20041   1 6184 734 5164  1
dez 20031   1 61842734 5164  1
nov 20031   1 4126 277 1823   
out 20031   1 41261277 1823   
set 20031   1 31281280 1823   
ago 20031   1 2128 214 182    
jul 20031   1 21281214 182    
jun 200311  1 11521264 25     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2017243056 29 114 61      140
out 2016252453 29 114 58      140
jul 2016251244 29 112 61      140
abr 201625 45 271112 3      140
jan 201625721 474496 60      140
out 2015271830 45299 9      140
jul 2015272531 695353 57      140
abr 2015313112 693855 67      140
jan 2015311315436944521665475064745756140
out 20144239574768625118103444863745661140
jul 2014423227186651491934444762705468140
abr 2014423120236535551841444766705468140
jan 2014424289496159581985434771705473140
out 2013422324316136591955414770706073140
jul 2013423847515952552094414770686371140
abr 2013413622235948551963404769676369140
jan 2013444582545867541861404868666168140
out 2012443782495564561695404767656167140
jul 2012425262545470541691404667636269140
abr 2012413949525466551674384467636169140
jan 2012403555505364551858374267636170140
out 2011394264495268531782364065595871140
jul 2011394482495069511777363965575771140
abr 2011392458454861551973333865575768140
jan 2011403581504761531971313665555464140
out 2010413680504460551964303363545463140
jul 2010412749544066561961293161525461140
abr 2010424876494058591970293159505062140
jan 2010423354453961651864273059504962140
out 2009414059493756611861272958484561140
jul 2009402748483659601735242953454462140
abr 2009395153453553621549212752444262140
jan 2009403650293344561556202551414161140
out 2008403675433263561355202550384159139
jul 2008413273463159581354192549363857139
abr 2008394257493064551362172345333655139
jan 2008384353512959561157151940323452139
out 200735277650266350964131737302852139
jul 2007334554442559521038121533282556138
abr 200730394147236151948111332282252138
jan 200726495246216648644111328272054138
out 200625403422195346633101028221950138
jul 200623414927166446147825182946138
abr 2006213832252773462271240222648138
jan 2006211726344040373740273343303649130
out 2005243339263336323247242640274160118
jul 2005242118253027292938212237222865113
abr 2005281822172624202023172030192267100
jan 200539111614271316161525283445166288
out 200446263016462111115550544748115475
jul 200439192610411855374140363393855
abr 200418785195441413141265819
jan 200416443164331010101064916
out 200314332143221010101064614
jul 20031354313322101091074613
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  100000  1  3  5  10  25  5  10  100  1  3  5  10  25  100  250  5  10  100 
mar 20176221111112221  31      4111111   
fev 201765443111 2221  21      86422  1  
jan 20176211    2211          321       
dez 20161210844   111           942       
nov 201686551   221   1       5      11 
out 201641111   222           1      11 
set 2016411     331           11     11 
ago 2016       222   11      21     11 
jul 201663211   332                  11 
jun 20164      3331          2      11 
mai 201631111   33311 1       311       
abr 2016422     333111        21        
mar 2016106521   331   3       7321   11 
fev 20163211          11      11        
jan 2016119983   111   1       5111   11 
dez 20152720191241   2111  11      248311  11 
nov 2015154211   111   1       10111   11 
out 201595531   33321 3       14631   21 
set 201584311111 33221 3       62211  11 
ago 2015138632   221   21      95411  11 
jul 2015126442   2211  1       84431  11 
jun 2015241915133   11            177632  111
mai 2015231610832   22            126542  11 
abr 2015231817107   22    2    22218139631 22 
mar 2015272118169   22    4    111177531  11 
fev 20151814121091   11    41      135411  11 
jan 2015211612116   11    32      14542   111
jan 20176211    2211          321       
out 201641111   222           1      11 
jul 201663211   332                  11 
abr 2016422     333111        21        
jan 2016119983   111   1       5111   11 
out 201595531   33321 3       14631   21 
jul 2015126442   2211  1       84431  11 
abr 2015231817107   22    2    22218139631 22 
jan 2015211612116   11    32      14542   111
out 20143111    1             4211      
jul 201412444433  211           42211     
abr 20141099982   11    1       149973     
jan 201442     221   1       71        
out 2013866661         1       169873     
jul 201332221   11            6331      
abr 20131087732   32    2       118633     
jan 20131      441           3      11 
out 201232     33            71     11 
jul 2012211     111           9      1  
abr 2012222     331   11      4331      
jan 2012311     442           2      21 
out 2011321     331   11      6      11 
jul 201152     111   2       31        
abr 201132111   221   2       62111     
jan 20113      221           6         
out 20105111111        11      6321      
jul 20103332211        2       2222      
abr 20104211111        1       62     11 
jan 20104322111        3       422211    
out 20096321111        21      411       
jul 20094333211  2111  1       5222   1  
abr 200974221111 1     1       421       
jan 2009732111   22    1       4321   11 
out 20082      221   1       422       
jul 20083      332   1       4         
abr 200811111   11    3       6         
jan 2008321     222   2       6         
out 20074      111   1111    3         
jul 2007321     111           221       
abr 20074321    111   1111    2111      
jan 200722111   111   1111    11111     
out 2006633332   111   3111    311       
jul 20065111111  2222  411     62111  11 
abr 200611322111  111   411     5221      
jan 2006105333   22    43221   644221    
out 20058211          11                
jul 2005126411   11    1       2         
abr 2005622111         3221    42221     
jan 20055432211        3111    211111    
out 2004                               
jul 20041                              
abr 2004                               
jan 2004                               
out 2003                               
jul 2003                               

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1372100.0%46,933100.0%
319853.2%46,64599.4%
1014539.0%46,34198.7%
328121.8%45,16496.2%
1003810.2%42,94591.5%
316174.6%39,35583.9%
1000113.0%36,39277.5%
316220.5%20,88844.5%
1000010.3%13,57928.9%

 

6 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Asinis632UC2+77,3096,142530474fev 14, 2017443,0152,341279273
Mickey MystiqueUC4-12,63118302fev 15, 20131504197-179-
BD2412UC107+51813-jan 09, 2015811--1-
LukaBNUC182...55--mar 26, 2017411--
Kristina.skipinaUC278...22--mar 28, 2017211--
MilojevicmilovanUC371...11--mar 28, 2017211--

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC113,579jan 27, 20092984nov 08, 20102334
Bubbah63UC32,979fev 15, 20131504set 20, 2015557
KasterUC51,679jan 27, 20054445nov 15, 20121596
KadzoUC61,540jan 11, 20093000abr 03, 20092918
Crveni BaronUC71,522nov 19, 20054149jul 25, 20063901
Milos trifunovicUC81,496set 08, 2015569mar 31, 2016364
Linos MimiUC91,466fev 15, 20131504jul 11, 2014993
DungodungUC101,099mai 11, 20054341out 26, 2015521
The Milica TomovicUC111,092fev 15, 20131504jul 14, 2014990
GolijaUC12436jan 19, 20054453ago 14, 20054246
ImperatorkAUC13415fev 18, 20131501out 10, 2015537
SrBotUC14414set 09, 20054220out 04, 20054195
SashatoUC15396dez 19, 20054119set 12, 20063852
MilicaStajicUC16385nov 11, 2014870ago 04, 2015604
Taychy2110UC17315dez 14, 20131202dez 28, 2014823
FunakoshiUC18273out 02, 20131275mai 21, 2015679
NatalijaUC19263nov 07, 2014874mar 20, 2015741
PoletanicaUC20241fev 15, 20131504set 28, 20131279
Саша СтефановићUC21235dez 24, 20054114jan 12, 20092999
ItjustkindofhappenedUC22226nov 06, 2014875abr 30, 2015700

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 5.134 edições foram feitas por usuários anônimos, de um total de 406.526 edições ( 1e %)
  


23 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
IglbotUC1269,711set 04, 2015573mai 02, 2016332165,666-
СлоботUC214,670jul 14, 20092816mar 26, 20102561--
CrveniBaronBotUC313,761mar 04, 20064044jul 23, 2006390311,259-
RobotGMwiktUC413,721jul 21, 20054270jun 06, 20083219--
HydrizBotUC512,429jul 01, 2015638mar 31, 2017-823
UT-interwiki-BotUC69,567jun 12, 2016291mar 30, 2017-11019
Luckas-botUC74,967mar 03, 20092949jan 27, 20141158--
KamikazeBotUC84,524dez 17, 20102295mar 07, 20131484--
JAnDbotUC93,026jun 10, 20121754set 25, 201618636-
VolkovBotUC102,574ago 20, 20073510abr 05, 20131455--
YS-BotUC111,666set 07, 20121665out 18, 2015529--
SpaceBirdyBotUC121,324jun 23, 20083202dez 30, 20092647--
BodhisattvaBotUC131,216fev 02, 20083344ago 19, 20083145--
AvocatoBotUC14843out 27, 20111981ago 28, 20131310--
MonoBotUC15217jan 17, 20083360jun 14, 20083211--
Makecat-botUC1684nov 10, 20121601abr 05, 20131455--
FelixBotUC1762dez 16, 20054122jun 14, 20063942--
CarsracBotUC1844dez 22, 20121559mai 21, 20131409--
タチコマ robotUC1932dez 06, 20111941jan 01, 2016454--
JackBotUC2011ago 10, 20102424ago 10, 20102424--
AibotUC217mai 13, 20083243jun 13, 20083212--
GetoBot~srwiktionaryUC222fev 08, 20064068fev 08, 20064068--
EscarbotUC231set 02, 20063862set 02, 20063862--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Ogg
mar 2017190 k612111497162953312      4
fev 2017188 k61298497042928611      4
jan 2017187 k60998447012927911      4
dez 2016187 k60898447012927711      4
nov 2016187 k60697447012927711      4
out 2016187 k60597447012927711      4
set 2016187 k60597447012927711      4
ago 2016187 k60597447012927711      4
jul 2016187 k60497447012927711      4
jun 2016187 k60497447012927711      4
mai 2016187 k60497447012927711      4
abr 2016185 k60395446982927711      4
mar 201648 k60295446982927711      4
fev 201648 k60295446912927711      4
jan 201648 k60295446912927711      4
dez 201547 k60295446892927511      4
nov 201547 k59895446882927411      4
out 201547 k59094446882927411      4
set 201534 k58993446732927411      4
ago 201521 k58993446732927411      4
jul 201520 k58893446622927411      4
jun 201520 k58793446542927311      4
mai 201520 k58593446542923311      4
abr 201520 k58593346532923311      3
mar 201520 k58393346532923311     6033
fev 201520 k58293346532923311     4753
jan 201520 k57793346532923311     3873
dez 201420 k57293346532923311     9933
nov 201419 k57288346382923011     7433
out 201419 k57062345972921911     153
set 201419 k57062345972921911     23
ago 201419 k56662345972921911     53
jul 201419 k56262345972921911     20693
jun 201419 k56262345972921911     5953
mai 201419 k56262 45922821911     1321 
abr 201418 k56262 45912221911     683 
mar 201418 k55961 45852221911     1118 
fev 201418 k55761 45842221911     647 
jan 201418 k55161 45842221911     9 
dez 201318 k54661 45842221911     313 
nov 201318 k54660 45722221911     200 
out 201318 k54154 45572121911     392 
set 201318 k53051 45532121911     406 
ago 201318 k51249 45492121911     13 
jul 201318 k50949 45492121811     59 
jun 201318 k50649 45492121811     360 
mai 201318 k50449 45492121811     58 
abr 201318 k50349 45312121811     385 
mar 201317 k49249 45302121811     660 
fev 201317 k47647 45082021011     180 
jan 201317 k47146 45002020811     1 
dez 201217 k46946 45002020811     14 
nov 201217 k46441 44802020411     10 
out 201217 k46441 44802020411     7 
set 201217 k45941 44802020411     4 
ago 201217 k45641 44802020411       
jul 201217 k45341 44802020411     8 
jun 201217 k44641 44802020411     11 
mai 201217 k43941 44802020411     3 
abr 201217 k43641 44792020411     10 
mar 201217 k42541 44782020411     6 
fev 201217 k42241 44782020311     24 
jan 201217 k41641 44782020311     7 
dez 201117 k41241 44782020311       
nov 201117 k40741 44782020311     2 
out 201117 k39641 44772020311     10 
set 201117 k39041 44772020311     48 
ago 201117 k38541 44772019911     16 
jul 201117 k38141 44732019711     11 
jun 201117 k37441 44732019711     18 
mai 201117 k37041 44732019711     15 
abr 201117 k36441 44712019711     73 
mar 201117 k35941 44702018011     10 
fev 201117 k35841 44682018011     3 
jan 201117 k35341 44672018011     4 
dez 201017 k34741 44672018011     29 
nov 201017 k34141 44672018011     283 
out 201017 k33740 44662017911     539 
set 201017 k33440 44652017911     477 
ago 201017 k32740 44652017611     379 
jul 201017 k31240 44652017611     853 
jun 201017 k30640 44592017611     630 
mai 201017 k29840 44592017611     625 
abr 201017 k29640 44592017611     445 
mar 201017 k29240 44592017611     641 
fev 201017 k28839 44552017611     581 
jan 201017 k28437 4447201499     347 
dez 200917 k25030 4437201419     396 
nov 200917 k24630 4437201419     495 
out 200917 k24530 4437201419     427 
set 200917 k24229 4437201399     423 
ago 200917 k23629 4436201399     632 
jul 200917 k23529 4436201399     533 
jun 200917 k22929 4412201359     384 
mai 200917 k22629 4411201359     822 
abr 200917 k22427 4411201359     1034 
mar 200917 k21527 4411201349     2876 
fev 200917 k21127 4411201349     1756 
jan 200916 k20527 4410201339     128 
dez 200816 k20427 4410201338     5 
nov 200816 k20427 4410201338     1 
out 200816 k19327 4410201338     4 
set 200816 k18327 4410201338     20 
ago 200816 k18127 4403201338     17 
jul 200816 k17627 4403201338     4 
jun 200816 k17427 4403201338     18 
mai 200816 k17126 4403201338     19 
abr 200816 k16426 4403201338     64 
mar 200816 k15926 4403201338     36 
fev 200816 k15526 4401201338     11 
jan 200816 k15426 4400201338     14 
dez 200716 k15026 4400201338     14 
nov 200716 k14726 4400201328     12 
out 200716 k14526 4400201328     6 
set 200716 k14226 4400201328     10 
ago 200716 k14026 4399201318     2 
jul 200716 k13826 4399201318     9 
jun 200716 k13826 4394201318     7 
mai 200716 k13626 4389201318     3 
abr 200716 k13626 4389201318     22 
mar 200716 k13626 4389201308     81 
fev 200716 k13025 438420858     65 
jan 200716 k12719 434220738     74 
dez 200616 k12718 433220718     78 
nov 200616 k12617 433120698     4 
out 200616 k12317 433120698     432 
set 200616 k11717 433120698     28 
ago 200616 k10816 432920638     21 
jul 200616 k10215 432520618     294 
jun 200611 k9715 432020608     169 
mai 20064,4 k8515 431820598     311 
abr 20064,2 k7913 430420528     566 
mar 20062,6 k7213 430320517     239 
fev 20061,3 k6413 428820507     1110 
jan 20068945712 422017454     142 
dez 20058622412 413115364     91 
nov 20058441611 41198224     30 
out 20058371410 41098184     25 
set 20058371410 41098184     408 
ago 20058361410 41078184     47 
jul 20058321210 41078184     106 
jun 20057841110 41078184     25 
mai 2005780119 31068184     51 
abr 2005772109 31068174     152 
mar 200570254 31021104     39 
fev 200569854 399194     461 
jan 200537844 39616      451 
dez 2004933 3           
nov 2004833 1           
out 20048 2 1           
set 20048 1 1           
ago 20043 1 1           
jul 20043   1           
jun 20042   1           
mai 20042   1           
abr 20042   1           
mar 20042   1           
fev 20042   1           
jan 20042   1           
dez 20032   1           
nov 20031               
out 20031               
set 20031               
ago 20031               
jul 20031               
jun 20031               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2003: 1 1 MTA

set 2003: 1 1 MTA

dez 2003: 1 1 Аборигини

jul 2004: 1 1 Главна страна

set 2004: 1 1 Аверзија

nov 2004: 1 1 Аверзија

dez 2004: 1 1 Абак

jan 2005: 1 2 агора , 2 2 агонија , 3 2 агониста , 4 1 дифамија

fev 2005: 1 2 инструментализам , 2 1 ајгир

mar 2005: 1 1 аграрски

abr 2005: 1 2 Дисимилација , 2 2 Аранђел , 3 2 Авакум , 4 2 Горан , 5 2 среда , 6 1 дисјункција

mai 2005: 1 3 Виконт , 2 2 Виа факти , 3 1 дисјункција

jun 2005: 1 2 изотерма , 2 2 Капо , 3 1 интелигенција

jul 2005: 1 2 троугао , 2 2 столица , 3 1 ложа

ago 2005: 1 2 интелигенција , 2 2 Инкубатор , 3 2 јун , 4 1 дискант

set 2005: 1 3 агора , 2 2 Абукушу , 3 2 абаџија , 4 2 Андрија , 5 1 дифамија

out 2005: 1 2 инсигније , 2 1 дисоцијација

nov 2005: 1 2 беснило , 2 1 Инјектор

dez 2005: 1 3 Главна страна , 2 2 светлети , 3 2 Ваљево , 4 2 Broken/Градови у Црној Гори , 5 1 дисјункција

jan 2006: 1 3 нож , 2 3 авион , 3 2 Релација , 4 2 затварач , 5 2 nóż , 6 2 вечера , 7 2 господ , 8 2 живот , 9 1 терзија

fev 2006: 1 4 Државе Европе/Енглески , 2 4 duae , 3 3 државе Европе/Азербејџански , 4 3 државе Европе/Албански , 5 3 meisie , 6 3 eins , 7 3 fast , 8 3 immer , 9 3 Öl , 10 3 Brot , 11 3 Butterbrot , 12 3 octo , 13 3 septem , 14 3 quinque , 15 3 quattuor , 16 3 tria , 17 3 tres , 18 2 државе Европе/Пољски , 19 1 адресанат

mar 2006: 1 3 Тренутни догађаји , 2 3 Бог , 3 3 Главна страна , 4 2 Капо , 5 2 аберација , 6 2 stupid , 7 2 један , 8 2 Боривој , 9 2 Авакум , 10 1 дисјункција

abr 2006: 1 2 дисоцијација , 2 2 Birne , 3 2 глава

mai 2006: 1 2 агониста , 2 2 безграничан , 3 2 бескорисност , 4 1 агонија

jun 2006: 1 2 дистрикт , 2 2 испорука , 3 2 Георгије , 4 1 дисоцијација

jul 2006: 1 2 интелигенција , 2 2 безболан

ago 2006: 1 2 агора , 2 2 Дисимилација

set 2006: 1 1 интервал

out 2006: 1 2 лежарина , 2 2 ave , 3 1 Ležarina

nov 2006: 1 1 Златибор

dez 2006: 1 3 талац , 2 3 престолонаследниковница , 3 2 март

jan 2007: 1 2 столица , 2 1 др.

fev 2007: 1 2 инсомнија , 2 1 фиг.

mar 2007: 1 2 Марко , 2 1 убрендити

abr 2007: 1 2 библиотека , 2 1 авилисантан

mai 2007: 1 1 абнорман

jun 2007: 1 1 indiferentnost

jul 2007: 1 1 Domicil

ago 2007: 1 1 Београд

set 2007: 1 2 Сотер , 2 2 аритметика

out 2007: 1 2 примаријус

nov 2007: 1 2 transparentnost

dez 2007: 1 2 мајстор , 2 2 ушур , 3 1 Мајстор

jan 2008: 1 2 Recesija

fev 2008: 1 3 ректор , 2 1 Ректор

mar 2008: 1 2 Рјечник архаизама

abr 2008: 1 1 Рјечник архаизама

mai 2008: 1 1 Рјечник архаизама

jun 2008: 1 1 Рјечник архаизама

jul 2008: 1 1 Рјечник архаизама

ago 2008: 1 1 Рјечник архаизама

set 2008: 1 1 Рјечник архаизама

out 2008: 1 1 diskinezije

nov 2008: 1 1 Рјечник архаизама

dez 2008: 1 1 Визионар

jan 2009: 1 2 волшебница , 2 2 жрец , 3 2 Мухамед , 4 2 свештеник , 5 1 фалетарица

fev 2009: 1 2 ст. , 2 2 абе , 3 2 двор , 4 2 абракадабра , 5 2 абака , 6 2 Авлија , 7 2 абдицирати , 8 2 universe , 9 2 имам , 10 2 вулкан , 11 1 аблујирати

mar 2009: 1 2 logistika , 2 2 абревијатура , 3 2 им. , 4 2 ж. , 5 2 абортус , 6 2 abnormalan

abr 2009: 1 3 аперцепција , 2 2 Словенија , 3 2 хаван

mai 2009: 1 2 експлоратер , 2 2 Amato , 3 2 Amando , 4 2 Abdieso , 5 2 губа , 6 1 Blaziran

jun 2009: 1 2 Acacio , 2 1 neko

jul 2009: 1 2 џивџан , 2 2 мачка , 3 2 бабине , 4 2 адмирал , 5 1 ахенија

ago 2009: 1 3 биотоп

set 2009: 1 3 морфем , 2 2 носилац

out 2009: 1 2 hakeri , 2 2 адреса

nov 2009: 1 1 морфема

dez 2009: 1 2 ορίστε , 2 1 egzegeza

jan 2010: 1 2 Рјечник архаизама , 2 1 војн.

fev 2010: 1 3 laberint , 2 3 милијарда , 3 2 јул , 4 2 судбина , 5 2 Рјечник архаизама , 6 2 Александра , 7 2 абулија , 8 1 септембар

mar 2010: 1 2 пијаца , 2 2 Naissus , 3 1 Yi+Ze

abr 2010: 1 2 црна , 2 2 кушати , 3 2 Meyer

mai 2010: 1 1 септембар

jun 2010: 1 2 један , 2 1 зидухија

jul 2010: 1 2 биол. , 2 2 ентузијазам , 3 2 в. , 4 2 January

ago 2010: 1 3 Нови Сад , 2 1 Словенија

set 2010: 1 2 Врање , 2 2 TCP , 3 2 CDP , 4 2 RIP , 5 2 EIGRP , 6 1 лажица

out 2010: 1 2 Hassan , 2 1 Варцарка

nov 2010: 1 2 Hassan , 2 2 среда , 3 1 nůž

dez 2010: 1 2 Кина , 2 1 Фјорд

jan 2011: 1 1 Насловна страна

fev 2011: 1 1 Бијоград

mar 2011: 1 1 тахилалија

abr 2011: 1 1 јелен

mai 2011: 1 2 Сребрница , 2 1 Сребреница

jun 2011: 1 2 Београд , 2 1 φαΐ

jul 2011: 1 2 dvanaest

ago 2011: 1 1 שלום

set 2011: 1 1 Ευγενία

out 2011: 1 1 битва

nov 2011: 1 1 Рјечник архаизама

jan 2012: 1 2 Вампир

fev 2012: 1 1 Централна Африка

mar 2012: 1 1 marijana

abr 2012: 1 1 курија

mai 2012: 1 1 Конавли

jun 2012: 1 1 Стрешељ

jul 2012: 1 1 аламан

set 2012: 1 1 Šarlin

out 2012: 1 1 аб

nov 2012: 1 2 Босна и Херцеговина , 2 1 абажур

dez 2012: 1 1 Додатак:Unicode/Арапски

jan 2013: 1 1 пророк

fev 2013: 1 3 نَهْرٌ , 2 3 سَلامٌ , 3 2 مَضِيقُ بَحْرِيٍّ , 4 2 شَعَرٌ , 5 2 حَاجِبٌ , 6 2 لِحْيَةٌ , 7 2 وَجْهٌ , 8 2 أَنْفٌ , 9 2 نِمْرٌ , 10 2 فَمٌ , 11 2 أُذُنٌ , 12 2 لِسَانٌ , 13 1 وادِي

mar 2013: 1 4 أَثَرٌ , 2 3 رِيحٌ , 3 3 أَسَدٌ , 4 3 غَزالَةٌ , 5 3 كَلْبٌ , 6 3 فِيلٌ , 7 3 جَبْهَةٌ , 8 3 عَظَمٌ , 9 3 فَمٌ , 10 3 أُذُنٌ , 11 3 مَسْرَحٌ , 12 3 ثَقَافَةٌ , 13 3 سَلامٌ , 14 3 إِنْسَانٌ , 15 2 شَرْقٌ , 16 2 نَسْرٌ , 17 2 هِلالٌ , 18 2 قَمَرٌ , 19 2 شَمْسٌ , 20 2 ثَدْيٌ , 21 2 صَدْرٌ , 22 2 رِجْلٌ , 23 2 ذِرَاعٌ , 24 1 مُطْرِبٌ

abr 2013: 1 3 صَفٌّ , 2 3 نَشِيدٌ , 3 3 ذَهَبٌ , 4 3 شَرْقٌ , 5 2 إِقْلِيمٌ , 6 2 بَرْجَلٌ , 7 2 عَالَمٌ , 8 2 قُفّازٌ , 9 2 كَنيِسَةٌ , 10 2 مِحْفَظَةٌ , 11 2 لُغَةٌ , 12 2 بَيْتٌ , 13 2 شِهابٌ , 14 2 أَلماسٌ , 15 2 فَحْمٌ , 16 2 زُمُرُّدٌ , 17 2 قُطْبٌ , 18 2 جُغْرافِيا , 19 2 سَهْلٌ , 20 2 مَمْلَكَةٌ , 21 1 قَمِيصٌ

mai 2013: 1 2 كَتَبَ , 2 2 بُرْجٌ , 3 1 نَشِيطٌ

jun 2013: 1 2 بِدَايَةٌ , 2 2 وِكالَةٌ , 3 2 صَنْدُوقٌ , 4 2 شَرِكَةٌ , 5 2 هاتِفٌ , 6 2 حَضَارَةٌ , 7 2 مُحَاضَرَةٌ , 8 2 رَفٌّ , 9 2 وِزارَةٌ , 10 2 مَحْكَمَةٌ , 11 2 فِهْرِسٌ , 12 2 تِلمِيذٌ , 13 2 مَعْدِنٌ , 14 2 مُطْرِبٌ , 15 2 مَكْتَبٌ , 16 1 مَطْعَمٌ

jul 2013: 1 1 وَطَنٌ

ago 2013: 1 1 إِمْبَرَاطُورٌ

set 2013: 1 3 عَظِيمٌ , 2 3 ضَعِفٌ , 3 2 عَمِيقٌ , 4 2 عِمْلاقٌ , 5 2 حزين , 6 2 بَعيدٌ , 7 2 مُتَعَالٍ , 8 2 عَقْلانِيٌّ , 9 2 رَقِيقٌ , 10 2 عَادِلٌ , 11 2 كَسولٌ , 12 2 حَكِيمٌ , 13 1 حَزِينٌ

out 2013: 1 2 ضِفَّةٌ , 2 2 تَجْديدٌ , 3 2 إِيِجابِيٌ , 4 2 تاجِرٌ , 5 2 صَامِتٌ , 6 2 مَسافَةٌ , 7 2 شاعِرٌ , 8 1 وَقُورٌ

nov 2013: 1 2 مِينَاءُ , 2 2 رَقْصَةٌ , 3 1 طَاوِلَةٌ

dez 2013: 1 3 حافَةٌ , 2 2 جانِبٌ , 3 2 جامِعٌ , 4 2 دِينٌ , 5 2 جَنَّةٌ , 6 2 جُمْلَةٌ , 7 2 جَمالٌ , 8 2 جَدْوَلٌ , 9 2 جِدارٌ , 10 2 جارٌ , 11 2 تَمْرِينٌ , 12 2 جِدِّيٌّ , 13 2 تَقْويمٌ , 14 2 تَحْريرٌ , 15 2 تاريخٌ , 16 2 بَنْكٌ , 17 2 بابٌ , 18 2 حِذَاءٌ , 19 2 بَدْلَةٌ , 20 2 تِلمِيذٌ , 21 1 днсонирати

jan 2014: 1 1 حَجْمٌ

fev 2014: 1 3 سورٌ , 2 3 إِنْحِطاطٌ , 3 3 أُمَّةٌ , 4 3 أَهْلٌ , 5 3 إِجْتِمَاعٌ , 6 3 شاعِرٌ , 7 3 مُتَعاطِفٌ , 8 3 أَمْنٌ , 9 3 إِقتِصادٌ , 10 3 إِذَاعَةٌ , 11 3 أَدَبٌ , 12 2 سَلُّمٌ , 13 2 سيجارَةٌ , 14 2 بَطِيخَةٌ , 15 2 حَفْلَةٌ , 16 2 صورَةٌ , 17 2 سُؤالٌ , 18 2 شارِعٌ , 19 2 وَقُورٌ , 20 2 مُسْتَقِرٌّ , 21 2 خَاصٌّ , 22 2 شَيْخٌ , 23 2 رَئِيسٌ , 24 2 بَارِدٌ , 25 2 مُتَأَلِّقٌ

mar 2014: 1 3 لَفْظٌ , 2 3 غُرْفَةٌ , 3 3 صَلاةٌ , 4 3 صَديقٌ , 5 3 أَحْمَرُ , 6 3 جاهِلٌ , 7 3 نَارٌ , 8 2 عَمَلَ , 9 2 صَدَرَ , 10 2 بَلِدَ , 11 2 خَضِلَ , 12 2 سَلَخَ , 13 2 جَمُلَ , 14 2 رَسَمَ , 15 2 غَلَقَ , 16 2 نَظَرَ , 17 2 سَمِعَ , 18 2 فَتَحَ , 19 2 غَيْمٌ , 20 2 سَكَنَ , 21 2 جَلَبَ , 22 2 دَرَسَ , 23 2 لَوْنٌ , 24 2 قَرْنٌ , 25 2 سَلُّمٌ

abr 2014: 1 3 هَجَمَ , 2 2 رَحِمَ , 3 2 ي , 4 2 قَوْمٌ , 5 2 ذَبَحَ , 6 2 تَجَرَ , 7 2 حَذِقَ , 8 2 عَهِدَ , 9 2 مَزَقَ , 10 2 غَلَبَ , 11 2 شَرَعَ , 12 2 خَمَرَ , 13 2 دارٌ , 14 2 صَبَرَ , 15 2 شَغَلَ , 16 2 عَمَلَ , 17 2 صَلَحَ , 18 2 بَلِدَ , 19 2 خَضِلَ , 20 2 حَمَلَ , 21 2 جَمَعَ , 22 2 صَرَفَ , 23 2 خَرَجَ , 24 2 دَخَلَ , 25 2 شَرِبَ

mai 2014: 1 6 أَخْبَرَ , 2 4 شَرِكَ , 3 4 جَمُلَ , 4 4 حَصَدَ , 5 4 حَشَدَ , 6 4 حَسَبَ , 7 4 بَحَثَ , 8 4 حَرَمَ , 9 4 كَسَرَ , 10 4 سَجَدَ , 11 4 عَرَضَ , 12 4 نَظَرَ , 13 4 صَرَفَ , 14 4 بَلَغَ , 15 4 نَشَرَ , 16 4 نَهَضَ , 17 4 كَتَبَ , 18 3 ثَبَتَ , 19 3 بَسَطَ , 20 3 جَدَلَ , 21 3 نَتيجَةٌ , 22 3 سَرَدَ , 23 3 بَذَلَ , 24 3 حَصَلَ , 25 3 نَقَلَ

jun 2014: 1 3 حَيَوانٌ , 2 3 كَتَبَ , 3 2 إِلْزِمْ شُغُلَك , 4 2 رَوْحٌ , 5 2 الله , 6 2 حَياةٌ , 7 2 حائطٌ , 8 2 شَغَلَ , 9 2 سَلُّمٌ , 10 2 جارٌ , 11 2 إِنْحِطاطٌ , 12 2 إِمْتِحانٌ , 13 2 إِمْرَأَةٌ , 14 2 فَخورٌ , 15 1 نبي

jul 2014: 1 3 شَهْرٌ , 2 3 خَفَتَ , 3 3 جِهَةٌ , 4 3 وَقَفَ , 5 3 عَصْرِيٌّ , 6 3 فَحَصَ , 7 3 نَهَضَ , 8 3 نَافِذَةٌ , 9 3 شَعْبِيٌّ , 10 3 شَديدٌ , 11 3 تِلْقَائِيٌّ , 12 3 شَاعِرِيٌّ , 13 3 نَاقِدٌ , 14 3 بَارِدٌ , 15 3 مُتَأَلِّقٌ , 16 3 مُتَهَوِّسٌ , 17 3 سَاخِرٌ , 18 3 أُمَّةٌ , 19 3 مَوْضُوعِيٌّ , 20 3 مُتَوَتَّرٌ , 21 3 ذَوَّاقٌ , 22 3 عَصَبِيٌّ , 23 3 أَصْفَرُ , 24 3 أَسْوَدُ , 25 3 أَزْرَقُ

ago 2014: 1 1 Ogos

set 2014: 1 1 Оџаци

out 2014: 1 1 إِسْمٌ

nov 2014: 1 4 ord , 2 4 bord , 3 4 huvud , 4 3 mann , 5 3 dricka , 6 3 ansikte , 7 3 dörr , 8 3 bror , 9 3 مُتَرْجِمٌ , 10 3 قَهْوَةٌ , 11 3 äpple , 12 3 vatten , 13 3 fågel , 14 3 rum , 15 3 hus , 16 3 fråga , 17 3 hund , 18 2 مُدَّةٌ , 19 2 دَائِرَةٌ , 20 2 أُسْبُوعٌ , 21 2 dum , 22 2 kvinne , 23 2 kone , 24 2 søster , 25 2 gutt

dez 2014: 1 4 läsa , 2 3 ulica , 3 3 leva , 4 3 bröd , 5 3 sol , 6 3 fönster , 7 2 výborný , 8 2 česať , 9 2 أَرْمَلَةٌ , 10 2 byť , 11 2 modrý , 12 2 dobrý , 13 2 d´akovať , 14 2 dom , 15 2 dážď , 16 2 slovensko , 17 2 إِخْلَاصٌ , 18 2 súčasný , 19 2 око , 20 2 hrdina , 21 2 môcť , 22 2 bažant , 23 2 stroj , 24 2 حِكَايَةٌ , 25 2 آخِرَةٌ

jan 2015: 1 2 arbeid , 2 2 forfatter , 3 2 Slovenka , 4 2 slovák , 5 2 slovenčina , 6 2 izba , 7 2 počítač , 8 2 pivnica , 9 2 nedeľa , 10 1 щастя

fev 2015: 1 2 море , 2 1 сорочка

mar 2015: 1 2 حَالَةٌ , 2 2 شَخْصٌ , 3 2 حَبِيسٌ , 4 2 حِفْظٌ , 5 2 بَكِيمٌ , 6 2 بَيْضَةٌ , 7 2 مَحْفُوظٌ , 8 2 ثَابِتٌ , 9 2 ظُفْرٌ , 10 2 حَاسِدٌ , 11 2 plånbok , 12 2 sked , 13 2 förälder , 14 2 heta , 15 2 bokstav , 16 2 بَاسِلٌ

abr 2015: 1 3 سَعِيدٌ , 2 3 حَنَّانٌ , 3 3 تَاجٌ , 4 2 klänning , 5 2 järn , 6 2 nyckelpiga , 7 2 kylskåp , 8 2 handduk , 9 2 vinbär , 10 2 blåbär , 11 2 حَقِيقَةٌ , 12 2 مَرِيضٌ , 13 2 غَلِيظٌ , 14 2 خَالِصٌ , 15 2 مُمْتِعٌ , 16 2 حَرَمٌ , 17 2 تَحْلِيلٌ , 18 2 ظُفْرٌ , 19 2 حَاسِدٌ , 20 2 بَأْسٌ , 21 2 تَيْسٌ , 22 2 تَزَوُّجٌ , 23 2 ألَمٌ , 24 2 رَجْعٌ , 25 2 أَكْلٌ

mai 2015: 1 2 , 2 2 , 3 2 , 4 2 , 5 2 , 6 2 , 7 2 并且 , 8 2 表达 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 , 16 1

jun 2015: 1 2 إِشْتَجَرَ , 2 2 أَخَذَ , 3 2 أَجِلَ , 4 1 إِكْتَشَفَ

jul 2015: 1 2 بَادَ , 2 2 تَأَخَّرَ , 3 1 أَفْسَدَ

ago 2015: 1 1 حَسِبَ

set 2015: 1 2 видовчица , 2 2 дивља паприка , 3 2 кајсија , 4 2 и , 5 1 шобот

out 2015: 1 2 وَجَدَ , 2 1 είμαι

nov 2015: 1 2 مُرُورٌ , 2 2 صَوْتٌ , 3 1 مدة

dez 2015: 1 3 robota , 2 2 طَابِقٌ , 3 2 مُرْسِلٌ , 4 2 tučný , 5 2 robotnícky , 6 2 literárny , 7 2 celý , 8 2 مُخْتَلِفٌ , 9 2 іграшка , 10 2 обіцянка , 11 2 أُسْطُورَةٌ , 12 2 سَمَكَةٌ , 13 2 طَبَقٌ , 14 2 خَيْمَةٌ , 15 2 hosť , 16 2 bystrý , 17 2 pochod , 18 2 bylina , 19 1 马其顿

jan 2016: 1 2 Божанствено

fev 2016: 1 1 вінок

mar 2016: 1 1 حَبَّةٌ

abr 2016: 1 1 صَبْغَةٌ

mai 2016: 1 1 šumska crvenrepka

jun 2016: 1 1 zeru

jul 2016: 1 2 студент , 2 1 озеро

set 2016: 1 1 државе Европе/Енглески

out 2016: 1 2 сумний , 2 1 відповідь

nov 2016: 1 1 乐不思蜀

dez 2016: 1 2 chlap , 2 2 轰轰烈烈 , 3 2 postel' , 4 2 全力以赴 , 5 1 眼高手低

jan 2017: 1 1 ľúbiť

fev 2017: 1 2 jiāng , 2 2 hovoriť , 3 1 誡命

mar 2017: 1 2 , 2 2 ти , 3 1

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 24 de abril 2017 13:30

Dump file srwiktionary-20170401-stub-meta-history.xml.gz (edits only), size 22 Mb as gz -> 196 Mb
Dump processed till Mar 31, 2017, on server stat1002, ready at Sun-09/04/2017-05:12 after 3 min, 23 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.