Estatísticas da Wikcionário télugo

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2016
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 20160%   0%   -46%      0%
jul 2016+2%   0%   +87%      0%
jun 20160%   0%   -48%      0%
mai 20160%   0%   +76%      0%
abr 20160%   0%   -7%      0%
mar 20160%   0%   +109%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 201667 22107 k37,6 1,4 k      6,5 k
jul 201667131107 k27,6 2,5 k      6,5 k
jun 201666 2 107 k17,5 1,3 k      6,5 k
mai 201666 32107 k47,5 2,6 k      6,5 k
abr 201666 32107 k77,5 1,5 k      6,5 k
mar 201666 32106 k47,5 1,6 k      6,5 k
fev 201666 33106 k57,5 762      6,5 k
jan 201666 53106 k177,5 3,0 k      6,5 k
dez 201566 42106 k87,5 2,5 k      6,5 k
nov 201566 32105 k57,5 1,7 k      6,5 k
out 201566153105 k67,5 2,1 k      6,5 k
set 201565143105 k57,5 35 k      6,5 k
ago 201564 41105 k57,2 4,5 k      6,5 k
jul 201564 22105 k147,2 6,3 k      6,5 k
jun 201564 43104 k187,1 6,9 k      6,5 k
mai 201564 22104 k157,1 1,9 k      6,5 k
abr 201564196103 k617,1 88 k      6,5 k
mar 201563154101 k426,4375139 k121 Mb4,6 M397 k1,6 M3,0 k1,0 k6,5 k
fev 201562143100 k85,1366766119 Mb4,4 M389 k1,6 M2,9 k1,0 k6,5 k
jan 201561 32100 k185,13665,7 k118 Mb4,4 M388 k1,6 M2,9 k1,0 k6,5 k
dez 201461 5399 k5053659,1 k117 Mb4,4 M384 k1,6 M2,9 k1,0 k6,5 k
nov 201461 3298 k3353623,2 k115 Mb4,3 M370 k1,5 M2,9 k1,0 k6,5 k
out 201461 2297 k2653603,4 k113 Mb4,2 M360 k1,5 M2,9 k8276,5 k
set 201461 2296 k5353595,1 k112 Mb4,2 M353 k1,5 M2,8 k8256,5 k
ago 201461 3294 k265,13553,2 k110 Mb4,1 M342 k1,5 M2,8 k8256,5 k
jul 201461 3294 k255,13532,5 k108 Mb4,0 M336 k1,5 M2,8 k8246,5 k
jun 201461 4293 k255,13523,9 k107 Mb4,0 M332 k1,5 M2,8 k8236,5 k
mai 201461 4292 k285,13514,3 k107 Mb3,9 M328 k1,5 M2,8 k8236,5 k
abr 20146115391 k155,13494,6 k105 Mb3,9 M322 k1,5 M2,7 k8196,5 k
mar 20146014291 k315,13485,7 k105 Mb3,9 M317 k1,4 M2,7 k8176,4 k
fev 20145928190 k285,13445,3 k103 Mb3,8 M308 k1,4 M2,7 k8166,4 k
jan 20145714289 k225,13399,3 k102 Mb3,7 M300 k1,4 M2,6 k8126,4 k
dez 201356 4388 k1153389,8 k101 Mb3,7 M291 k1,4 M2,6 k8086,4 k
nov 201356 3388 k114,933713 k100 Mb3,7 M286 k1,4 M2,6 k8066,4 k
out 201356 2188 k44,8335551100 Mb3,7 M275 k1,4 M2,5 k8066,4 k
set 201356 3188 k174,83351,5 k99 Mb3,7 M273 k1,4 M2,5 k8066,4 k
ago 201356 4287 k284,83347,7 k99 Mb3,6 M267 k1,4 M2,3 k8066,4 k
jul 20135624286 k204,73335,2 k97 Mb3,6 M261 k1,4 M2,2 k8056,4 k
jun 20135426286 k304,73295,0 k96 Mb3,5 M253 k1,4 M2,2 k8056,4 k
mai 201352 5485 k464,73274,5 k95 Mb3,5 M242 k1,4 M2,1 k8056,4 k
abr 20135217483 k524,73255,6 k93 Mb3,4 M233 k1,3 M2,1 k8056,4 k
mar 20135126482 k804,73226,5 k91 Mb3,3 M228 k1,3 M1,9 k7526,4 k
fev 20134916379 k1634,83188,1 k88 Mb3,2 M226 k1,3 M1,6 k7516,4 k
jan 20134817375 k182531218 k82 Mb3,0 M219 k1,2 M1,5 k7506,4 k
dez 20124717469 k1335,130010 k75 Mb2,7 M210 k1,1 M5937506,4 k
nov 201246 5465 k1625,329111 k70 Mb2,5 M198 k1,1 M5887496,4 k
out 201246 6460 k2405,627816 k64 Mb2,3 M183 k997 k5777486,4 k
set 201246 5353 k846,125614 k55 Mb1,9 M169 k900 k5757466,3 k
ago 201246 4250 k496,12504,0 k53 Mb1,8 M164 k863 k5677466,3 k
jul 201246 4249 k26,224475151 Mb1,8 M155 k841 k5527466,2 k
jun 201246 5448 k66,22441,5 k51 Mb1,8 M155 k840 k5467466,2 k
mai 20124616448 k116,22434,3 k51 Mb1,8 M154 k837 k5377466,2 k
abr 20124514448 k686,12409,5 k50 Mb1,7 M149 k812 k5037216,2 k
mar 20124415246 k486,22298,0 k46 Mb1,6 M125 k656 k4574356,0 k
fev 201243 7644 k486,222111 k42 Mb1,5 M114 k519 k4503025,8 k
jan 20124336443 k116,22145,3 k40 Mb1,5 M110 k465 k4172975,5 k
dez 20114023343 k526,120318 k40 Mb1,4 M108 k457 k4002875,4 k
nov 201138 1 41 k 5,92082,1 k39 Mb1,4 M106 k427 k3912785,4 k
out 201138 1 41 k 5,92081,1 k39 Mb1,4 M106 k423 k3902785,4 k
set 201138 4 41 k15,820898539 Mb1,4 M106 k421 k3902785,4 k
ago 201138 1141 k55,82082,2 k39 Mb1,4 M106 k420 k3902785,4 k
jul 201138 3141 k15,82071,5 k38 Mb1,4 M105 k417 k3692225,4 k
jun 201138 3141 k45,72056,0 k38 Mb1,4 M104 k415 k3632015,4 k
mai 201138 3 41 k 5,62042,2 k38 Mb1,4 M102 k406 k3611895,4 k
abr 20113812141 k 5,62044,2 k38 Mb1,4 M102 k403 k3611895,4 k
mar 201137 3241 k55,52043,9 k38 Mb1,4 M102 k398 k3601895,4 k
fev 20113714241 k185,42034,3 k37 Mb1,3 M99 k391 k3601895,4 k
jan 20113635340 k155,32015,1 k37 Mb1,3 M92 k380 k3601895,4 k
dez 201033 3240 k255,31986,8 k36 Mb1,3 M87 k369 k3611895,4 k
nov 201033 4439 k325,21925,0 k34 Mb1,2 M80 k353 k3421505,4 k
out 201033 5438 k875,218613 k33 Mb1,2 M73 k341 k26885,4 k
set 20103346335 k65,21818,4 k31 Mb1,1 M55 k315 k19885,3 k
ago 201029 4135 k 51825,2 k31 Mb1,1 M54 k307 k19375,3 k
jul 20102911135 k 4,91825,5 k31 Mb1,1 M54 k302 k19375,3 k
jun 201028 1135 k 4,71824,8 k31 Mb1,1 M54 k297 k19375,3 k
mai 201028 1135 k 4,61824,2 k31 Mb1,1 M54 k292 k19375,3 k
abr 201028 3135 k 4,41822,5 k31 Mb1,1 M54 k288 k19475,3 k
mar 201028 1135 k 4,41822,5 k31 Mb1,1 M54 k286 k19455,3 k
fev 201028 1135 k 4,31812,8 k31 Mb1,1 M54 k283 k19455,3 k
jan 201028 1135 k 4,21814,4 k31 Mb1,1 M54 k281 k19455,3 k
dez 200928 1135 k 4,11815,4 k31 Mb1,1 M54 k276 k19555,3 k
nov 20092812135 k 3,91815,4 k31 Mb1,1 M54 k271 k19655,3 k
out 200927 3235 k13,81815,2 k31 Mb1,1 M54 k266 k19655,3 k
set 200927 2235 k33,61813,5 k30 Mb1,1 M54 k261 k19655,3 k
ago 200927 1135 k 3,61813,9 k30 Mb1,1 M53 k258 k19555,3 k
jul 200927 1135 k 3,41812,1 k30 Mb1,1 M53 k254 k19555,3 k
jun 200927 1135 k 3,41812,4 k30 Mb1,1 M53 k252 k19555,3 k
mai 200927 2135 k 3,31815,5 k30 Mb1,1 M53 k250 k19555,3 k
abr 200927 1135 k 3,21816,3 k30 Mb1,1 M53 k245 k19555,3 k
mar 20092713235 k 318114 k31 Mb1,1 M48 k255 k19575,3 k
fev 200926 1135 k 2,61818,5 k30 Mb1,1 M48 k222 k6375,3 k
jan 20092613135 k32,318180429 Mb1,1 M48 k188 k6375,3 k
dez 200825 1 35 k102,318167829 Mb1,1 M48 k186 k6375,3 k
nov 200825 1 34 k 2,318051429 Mb1,1 M48 k184 k6365,3 k
out 200825 1134 k52,318093829 Mb1,1 M48 k182 k6365,3 k
set 200825 1134 k112,31791,6 k29 Mb1,1 M47 k179 k6365,3 k
ago 200825 1134 k42,317774428 Mb1,1 M44 k173 k6365,3 k
jul 20082512134 k22,217782428 Mb1,1 M43 k171 k6365,3 k
jun 200824 2134 k12,21762,2 k28 Mb1,1 M43 k168 k6365,3 k
mai 20082411 34 k 2,21765,4 k28 Mb1,1 M42 k161 k6345,3 k
abr 200823 3134 k2217662327 Mb1,1 M42 k138 k6345,3 k
mar 200823 3134 k221761,5 k27 Mb1,1 M42 k136 k6345,3 k
fev 20082324134 k21,91762,1 k27 Mb1,1 M41 k132 k6335,3 k
jan 20082113134 k11,91753,8 k27 Mb1,0 M40 k120 k6035,3 k
dez 200720 1134 k171,81752,2 k26 Mb1,0 M40 k82 k6035,3 k
nov 20072012233 k171,71741,6 k25 Mb1,0 M36 k69 k6035,3 k
out 200719 1132 k81,71732,5 k25 Mb1,0 M31 k63 k6025,3 k
set 20071914132 k4171,617218 k24 Mb995 k28 k44 k6025,3 k
ago 20071836320 k5341,817024 k14 Mb590 k19 k27 k6023,2 k
jul 2007153623,2 k283,62183,5 k2,7 Mb99 k14 k5,9 k582280
jun 2007121212,3 k93,52127681,8 Mb63 k7,8 k4,1 k10 140
mai 200711 112,0 k63,52019441,5 Mb52 k7,3 k3,0 k10 134
abr 200711 211,9 k83,41951,3 k1,3 Mb45 k6,7 k2,2 k8 113
mar 2007113611,6 k183,11871,8 k1,0 Mb37 k5,7 k1,2 k8 90
fev 200781211,1 k73184784735 kb25 k3,6 k1,2 k8 45
jan 20077 11854102,81731,0 k564 kb18 k2,4 k3817 33
dez 20067 1153632,6214250414 kb12 k1,5 k1005 17
nov 2006712145252,5213371339 kb9,3 k1,0 k975 10
out 2006613130332,5205323210 kb4,1 k280945 7
set 2006512121332,1278252138 kb1,2 k123833 2
ago 20064   118 1,72201076 kb69280771 1
jul 20064 1 116 1,62241374 kb65674471 1
jun 2006423111431,522011673 kb6417347  1
mai 20062   14 4229 8,7 kb3435747   
abr 20062   14 422998,7 kb3435747   
mar 200621  10 4,727096,5 kb267427   
fev 20061   7 5,415941,8 kb95142   
jan 20061   7 4,915941,8 kb95142   
dez 20051   7 4,315961,8 kb95142   
nov 20051   7 3,4159 1,8 kb95142   
out 20051   7 3,4159 1,8 kb95142   
set 20051   7 3,4159 1,8 kb95142   
ago 20051 1 7 3,4159201,8 kb95142   
jul 20051   1 426 71 31    
jun 200511  1 426471 31    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 201644303637414930 45      128
abr 201644 3727404029 40      128
jan 201643 3322382831 29      128
out 201543303121363531 50      128
jul 201543 5226362932 40      128
abr 201543362411361230 3      128
jan 201544344129362656322616272611928128
out 201441384426342360333217262511930128
jul 201441343627342557343118262711929128
abr 201439273017342660342018262711927128
jan 201441353125331660331517232411927128
out 2013414346353238623351162325111227128
jul 2013401733263126623223162125111625128
abr 2013402423143115623521162325111625128
jan 2013413123193110583418172425121827128
out 201241342014336513916192927142925128
jul 2012404735263453414663233230162924128
abr 201239323411348414618233230152823128
jan 2012391024173528385229253532263231128
out 2011423966483467395358243332263329128
jul 2011414444363457395239223032263433128
abr 2011412751373360425233222933263232128
jan 2011411331173327415324212833263031128
out 2010423434163312435520213034253388128
jul 2010433287633265465730212938243886128
abr 2010434650573158575537202937243787128
jan 2010433177523060545328192936243688128
out 2009433951382651585326192834233688128
jul 2009433976552659595138172632223587128
abr 2009425079532553594923162530203285128
jan 2009404342342439654844132329214685128
out 2008403658342435654731132328204884127
jul 2008392644342445644744122229204683127
abr 2008404239382248604447122028214383127
jan 2008403539391955614124111825214184127
out 2007393956371831623724111626253689127
jul 2007401721264419362718364334553289126
abr 20074539473348323831364553436156101126
jan 2007514754315724555538556254825096126
out 20065333373562385050496376771024693126
jul 20066439513766524646756692841035493126
abr 2006853854359249424268939980965290126
jan 200689435734874137378010298851094385118
out 2005823249268435323276949284954078110
jul 20057830432588352929741019884962975105
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  25000  100000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  250  1000  5  10  100 
ago 2016422222      222  31         82      11 
jul 2016553221      3321 3          32211   11 
jun 201643222      333  3          4       11 
mai 2016643332      2221 5          2          
abr 20163333321     222  1          11         
mar 2016443332      222                        
fev 20165333332          2211       1          
jan 201696554331    111  3          21      1  
dez 20159544421     2111 51         311     11 
nov 20157332222     1111 4111       3       11 
out 20158555431     2221 2111       2       21 
set 201595443311111 3321 71111      21111   11 
ago 2015944441      2221 1          511     111
jul 20154322222     2221 2111       5       1  
jun 2015125443331    2221 21         111     11 
mai 20158322222     221  1          2       11 
abr 20151110986643111 332  10611    22210555411122 
mar 20151265554432111331  72221   111533321  11 
fev 20156443331     11   92111      81      11 
jan 201573332221    3321 62111      43221   111
dez 2014555443311   2221 21111      52211   11 
nov 201483333221         5211       4          
out 2014522222211        11111      3          
set 2014532222221        31         3          
ago 2014113322222    111  3          832        
jul 201484322211    111  31         2          
jun 2014864322211   111  211        51         
mai 2014644442211   111  2          21         
abr 20141055543221   111  4311       81         
mar 2014944442221   111  411        9322       
fev 201414108521111   111  2111       71         
jan 2014754442221   222  21111      953        
jul 2016553221      3321 3          32211   11 
abr 20163333321     222  1          11         
jan 201696554331    111  3          21      1  
out 20158555431     2221 2111       2       21 
jul 20154322222     2221 2111       5       1  
abr 20151110986643111 332  10611    22210555411122 
jan 201573332221    3321 62111      43221   111
out 2014522222211        11111      3          
jul 201484322211    111  31         2          
abr 20141055543221   111  4311       81         
jan 2014754442221   222  21111      953        
out 20136322211          321        932        
jul 201385433222    1111 4211       6221       
abr 2013137765433    5411 166531111   2287431     
jan 20131187543222   5511 51         115422   11 
out 20121066544433   4421 421        1264431     
jul 2012874332      332  6221       104321      
abr 20121044444321   4422 621        127422      
jan 201213865443     3321 422221     744431  21 
out 20115211       332             4       11 
jul 2011433321      2111 11         63111      
abr 2011852211      2221 21         311        
jan 201110655432     2211 2          931        
out 2010555444322   11   3222       52211      
jul 2010611111111        1          1          
abr 201064321111    21   1          21         
jan 2010421111111   22   2          2111       
out 2009533222111   11   1          421        
jul 200931111111                    3          
abr 2009411111111   32   1          311        
jan 2009633321      111             321        
out 20085111111     111  2          422        
jul 20083222211     111  21         11         
abr 2008643221      111  2          3111       
jan 2008433321      2222 21         1          
out 20075211111     1111 1          1          
jul 200797653222    22   431        54441   1  
abr 200732222111    11   3          11111      
jan 20073111111     11   1          21111      
out 2006433221      1    3          52         
jul 2006211             1          4321       
abr 200641             631        84422   11 
jan 20061              2111       3          
out 2005                          1          
jul 2005                                  1  

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1255100.0%592,597100.0%
310942.7%592,378100.0%
106625.9%592,14999.9%
324517.6%591,81399.9%
1002811.0%590,78999.7%
316207.8%589,38099.5%
1000114.3%583,87598.5%
316293.5%580,69198.0%
1000083.1%575,19997.1%
3162331.2%466,63678.7%
10000031.2%466,63678.7%

 

4 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
BhaskaranaiduUC2 0111,8201097671abr 12, 2012160140,43333506-
NrgullapalliUC7 011,38618091jan 19, 20149542,8785231
CommonsDelinkerUC24 01702121mai 13, 20073397----
ChaduvariUC26 01372157-ago 05, 200540438-38-

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
JVRKPRASADUC1247,256set 20, 20102171nov 20, 2015284
InterwicketUC3107,560jan 29, 20092770nov 08, 20102122
MalafayaUC431,090abr 24, 20102320set 03, 2015362
Rajasekhar1961UC530,673jul 03, 20073346nov 18, 2015286
T.sujathaUC624,693set 21, 20063631ago 20, 20131106
PalagiriUC810,721abr 14, 20121599jun 10, 20131177
Info-farmerUC95,492fev 04, 2015573abr 04, 2015514
GokulellankiUC101,729fev 06, 2015571mai 20, 2016102
IkotobaityUC111,455dez 19, 20111716dez 20, 20111715
DvnsarmaUC12898jan 15, 20112054set 17, 20121443
Rajasekhar1962UC13881jan 17, 20121687fev 17, 20121656
బుడుగోయ్UC14842jan 21, 20112048mar 30, 20111980
సుండ్రుUC15773jan 21, 20083144out 22, 20092504
MpradeepUC16495abr 24, 20063781abr 18, 20083056
శశికాంత్UC17468set 22, 20102169mar 16, 20111994
JambolikUC18430dez 05, 20121364jul 11, 201650
AngajalaARSUC19386jan 18, 20121686fev 10, 20121663
Kolipaka.raghuramUC20332jan 25, 20121679mar 31, 20121613
Chavakiran~tewiktionaryUC21252mar 28, 20063808set 13, 20111813
విశ్వనాధ్.బి.కె.UC22225nov 10, 20073216jan 07, 20092792

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 5.484 edições foram feitas por usuários anônimos, de um total de 808.670 edições ( 0e %)
  


22 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC169,814set 13, 20121447jul 10, 201651--
Luckas-botUC250,405mar 03, 20092737jan 27, 2014946--
MpradeepbotUC336,335jul 12, 20073337set 12, 2007327527,468-
VolkovBotUC414,183ago 20, 20073298abr 18, 20131230--
KamikazeBotUC512,080dez 03, 20111732mar 07, 20131272--
RobotGMwiktUC66,272ago 21, 20063662jun 06, 20083007--
AvocatoBotUC75,962out 27, 20111769ago 09, 20131117--
YS-BotUC85,960set 05, 20121455out 19, 2015316--
JAnDbotUC92,752jun 26, 20121526ago 31, 2016---
MonoBotUC102,584dez 25, 20073171jun 14, 20082999--
UT-interwiki-BotUC112,545jun 27, 201664ago 31, 2016---
SpaceBirdyBotUC12489fev 02, 20092766mai 12, 20092667--
Bot-JagwarUC13386dez 30, 20111705jun 06, 20121546--
VyzbotUC14304dez 19, 20082811dez 19, 20082811303-
CarsracBotUC15248dez 02, 20092463mai 29, 20131189--
Makecat-botUC16174nov 10, 20121389abr 05, 20131243--
MalafayaBotUC1727set 03, 2015362set 03, 2015362--
タチコマ robotUC1824jul 02, 20131155jul 02, 20131155--
QualiaBotUC192jul 20, 20082963ago 19, 20082933--
ArjunaraocbotUC202mai 04, 20121579mai 04, 20121579--
BucetaBotUC211set 08, 20102183set 08, 20102183--
OctraBotUC221jul 02, 201659jul 02, 201659--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgOggPngSvg
ago 2016113 k5935981,3 k1161,3 k15707       101,2 k43439
jul 2016113 k5925981,3 k1161,3 k15707       101,2 k43439
jun 2016113 k5925981,3 k1161,3 k15707       101,2 k43439
mai 2016113 k5915981,3 k1161,3 k15707       101,2 k43439
abr 2016113 k5905981,3 k1161,3 k15705       101,2 k43439
mar 2016113 k5895981,3 k1161,3 k15705       101,2 k43439
fev 2016113 k5895981,3 k1161,3 k15705       101,2 k43439
jan 2016113 k5895981,3 k1161,3 k15705       101,2 k43439
dez 2015112 k5895981,3 k1161,3 k15705       101,2 k43439
nov 2015112 k5855981,3 k1161,3 k15704       101,2 k43439
out 2015112 k5845981,3 k1161,3 k15704       101,2 k43439
set 2015111 k5845981,3 k1161,3 k15704       101,2 k43439
ago 2015111 k5845981,3 k1161,3 k15704       101,2 k43439
jul 2015111 k5845981,3 k1161,3 k15702       101,2 k43439
jun 2015111 k5835981,3 k1161,3 k15702       101,2 k43439
mai 2015110 k5835981,3 k1161,3 k15702       101,2 k43439
abr 2015110 k5825981,3 k1161,3 k15702       101,2 k43439
mar 2015108 k5715971,3 k1161,3 k15698      139170101,2 k43439
fev 2015107 k5645951,3 k1161,2 k15686      667101,2 k43439
jan 2015106 k5595951,3 k1161,2 k15686      1762101,2 k43439
dez 2014106 k5575951,3 k1161,1 k15685      5588101,2 k43439
nov 2014104 k5575921,3 k1151,1 k14679      3208101,2 k43439
out 2014103 k5545921,3 k1151,1 k14679      3366101,2 k43439
set 2014102 k5535921,3 k1151,1 k14679      5114101,2 k43439
ago 2014101 k5495921,3 k1151,1 k14679      2789101,2 k43439
jul 2014100 k5435921,3 k1151,1 k14679      2106101,2 k43439
jun 201499 k5435921,3 k1151,1 k14679      3599101,2 k43439
mai 201499 k5385921,3 k1151,1 k14679      4175101,2 k43439
abr 201498 k5385921,3 k1151,1 k14679      4340101,2 k43439
mar 201497 k5335921,3 k1151,1 k14677      5198101,2 k43439
fev 201496 k5295921,3 k1151,1 k14674      4325101,2 k43439
jan 201495 k5235921,3 k1151,1 k14674      8218101,2 k43439
dez 201395 k5135921,3 k1151,1 k14673      7975101,2 k43439
nov 201394 k5135801,3 k1151,0 k13654      12713101,2 k43439
out 201394 k5095631,3 k11595010640      508101,2 k43439
set 201394 k5045631,3 k11595010640      1415101,2 k43439
ago 201393 k4935631,2 k11595010640      2511101,2 k43439
jul 201393 k4895631,2 k11595010638      2379101,1 k43439
jun 201392 k4865631,2 k11595010636      2240101,1 k43439
mai 201391 k4845611,2 k11594710632      2545101,1 k43439
abr 201390 k4825541,2 k11594710632      3998101,1 k43439
mar 201388 k4705231,2 k1159439622      4586101,1 k43339
fev 201386 k4615231,2 k1079439622      6513101,1 k43339
jan 201381 k4555001,1 k1079439613      9893101,0 k43339
dez 201275 k4514611,1 k1079419611      67991096343339
nov 201271 k4454149161079239598      87331082943339
out 201266 k4453798541077899579      135701076743339
set 201259 k4403738191077379544      53391073243339
ago 201256 k4323588181077349541      31621073143339
jul 201255 k4273357601077349537      3411067343339
jun 201255 k4232797601077349535      7101067343339
mai 201254 k4122537571077269533      17301067043339
abr 201254 k4051947511077149524      60901066443339
mar 201252 k3951447481076919512      45851066143339
fev 201250 k3941447481076899477      53261066143339
jan 201249 k3871067471073843351      18981066043339
dez 201148 k321797401073253347      2141865823239
nov 201147 k314787401073223344      45865823239
out 201147 k303787401073213344      21865823239
set 201147 k299787401073213344      119865823239
ago 201146 k295787391073213342      1389865723239
jul 201146 k291787331073093319      276865123239
jun 201146 k283777321073003315      455865113239
mai 201146 k280777271072973307      95864713139
abr 201146 k275777261072973307      151864613139
mar 201146 k269777261072973306      464864613139
fev 201146 k267777261072973306      829864613139
jan 201145 k259777101072973306      897863013139
dez 201045 k255777041072953306      2234862413139
nov 201044 k254663231071603270      49463315 5 
out 201043 k23866149106144379      13359 146 3 
set 201041 k23765116106143378      8412 113 3 
ago 201040 k22962115105139378      5184 112 3 
jul 201040 k21262115105139378      5483 112 3 
jun 201040 k21162115105139378      4805 112 3 
mai 201040 k19962115105139378      4147 112 3 
abr 201040 k19762115105139378      2469 112 3 
mar 201040 k19362115105139378      2497 112 3 
fev 201040 k19062115105139378      2800 112 3 
jan 201040 k18862115105139378      4332 112 3 
dez 200940 k17462115105139378      5289 112 3 
nov 200940 k17362115105139378      5371 112 3 
out 200940 k17262115105139378      5218 112 3 
set 200940 k16862115105139376      3488 112 3 
ago 200940 k16262115105139364      3847 112 3 
jul 200940 k16262115105139364      2069 112 3 
jun 200940 k16062115105139364      2367 112 3 
mai 200940 k15962115105138364      5469 112 3 
abr 200940 k15862115105138364      6244 112 3 
mar 200940 k15162115105136364      14135 112 3 
fev 200940 k14761115105136364      7907 112 3 
jan 200940 k14161115105136364      153 112 3 
dez 200840 k14061115105136364      12 112 3 
nov 200840 k14061115105135364      8 112 3 
out 200840 k12861115105135364      592 112 3 
set 200840 k11661115105135364      1204 112 3 
ago 200839 k11661112105135363      550 109 3 
jul 200839 k11461111105135363      346 108 3 
jun 200839 k11361111105134363      139 108 3 
mai 200839 k10860110105134363      81 107 3 
abr 200839 k10860110105134363      162 107 3 
mar 200839 k10760110105131363      225 107 3 
fev 200839 k10260110104124258      328 107 3 
jan 200839 k975982104123256      233 79 3 
dez 200739 k945982104123256      1290 79 3 
nov 200738 k765982104123256      1169 79 3 
out 200738 k735981104123256      619 79 2 
set 200737 k735981104123256      2259 79 2 
ago 200723 k675881104119253      2913 79 2 
jul 20073,5 k585781104107242      3265 79 2 
jun 20072,4 k55537910310021      741 77 2 
mai 20072,2 k55537910210021      765 77 2 
abr 20072,0 k54537910210021      1133 77 2 
mar 20071,7 k54537910210021      1738 77 2 
fev 20071,1 k5253781019421      693 77 1 
jan 20078875053781019421      811 77 1 
dez 20065534953551019421      231 54 1 
nov 20064624953301019421      355 29 1 
out 2006310485211019421      288   1 
set 200621544521101922           1 
ago 200611943271101912           1 
jul 20061174227 101912             
jun 20061154124 101882             
mai 2006144124 101882             
abr 2006142924 101882             
mar 2006102120 101881             
fev 200671115 101851             
jan 200671115 101851             
dez 20057915 101841             
nov 20057513 99841             
out 20057511 99841             
set 20057510 9984              
ago 20057510 9784              
jul 2005121 9775              
jun 2005121 9775              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2005: 1 2 మొదటి పేజీ , 2 1 శరీరావయవాలు

dez 2005: 1 1 మొదటి పేజీ

jan 2006: 1 1 మొదటి పేజీ

fev 2006: 1 1 attract

mar 2006: 1 2 మొదటి పేజీ , 2 1 విదళించు

abr 2006: 1 2 mother , 2 1 mère

jun 2006: 1 2 బకాల్ , 2 2 బకాయ , 3 2 బకవైరి , 4 2 బంధము , 5 2 బంగారుకొండ , 6 1 బానిస

jul 2006: 1 2 అమ్మ , 2 1 మచ్చుకి

ago 2006: 1 1 అన్నము

set 2006: 1 2 బాబాయి , 2 2 బందుగుడు , 3 2 బందిఖానా , 4 2 బందా , 5 2 బంతి , 6 2 బండి , 7 2 బంగారుతీగలు , 8 2 బంగారము , 9 2 బంకోలు , 10 2 బంకమన్ను , 11 2 చాకిరి , 12 1 ఔషధము

out 2006: 1 3 బట్టతల , 2 2 క్షణము , 3 2 అరటిపండు , 4 2 బట్టమేక , 5 2 ఐకమత్యము , 6 2 ఐరావతము , 7 2 ఊకదంపుడు , 8 2 ఊరు , 9 2 ఉడుత , 10 2 ఉమ , 11 2 ఇంపు , 12 2 ఇల్లు , 13 1 kind

nov 2006: 1 2 ఊతము , 2 2 ఊపు , 3 2 ఉగ్రము , 4 2 ఉపయోగము , 5 2 ఉదయము , 6 2 అహింస , 7 2 అర్ధము , 8 2 అంతము , 9 2 అంతరము , 10 1 Raice flaks

dez 2006: 1 1 మూత్రపిండాలు

jan 2007: 1 3 టెంకాయచెట్టు , 2 2 వేపచెట్టు , 3 1 చందనము

fev 2007: 1 2 అపరాధము , 2 1 Cumin

mar 2007: 1 2 ఉర్వి , 2 2 మను , 3 2 మనస్తాపము , 4 2 మనస్కారము , 5 2 మనస్కరించు , 6 2 మనసు , 7 2 మనసిజుడు , 8 2 మనసరి , 9 1 ఆత్మ

abr 2007: 1 2 Daughter , 2 2 కోడలు , 3 2 కొడుకు , 4 2 అల్లుడు , 5 2 కూతురు , 6 2 బావమరిది , 7 1 కళాకారుడు

mai 2007: 1 2 కర్ణము , 2 2 ఆశ , 3 1 Joint

jun 2007: 1 2 వారసత్వము , 2 2 అబద్ధము , 3 2 అపహరణ , 4 2 అంధత్వము , 5 2 భోజనం , 6 1 బ్రమ

jul 2007: 1 3 వరుడు , 2 3 రక్తము , 3 3 ఆమ్లజని , 4 3 attraction , 5 3 alimony , 6 3 వెన్నెల , 7 3 మరదలు , 8 3 అన్న , 9 3 ఉడుము , 10 2 పరాభవము , 11 2 పంజరము , 12 2 దానిమ్మ , 13 2 సిరా , 14 2 లోతు , 15 2 లెక్క , 16 2 రుచి , 17 2 నగ , 18 2 నెమలి , 19 2 తోకచుక్క , 20 2 తోక , 21 2 తేనీరు , 22 2 తేయాకు , 23 2 పత్ని , 24 2 వివాహము , 25 2 రోగము

ago 2007: 1 3 వీర్యం , 2 3 , 3 3 ఉదరము , 4 2 కార్ముకము , 5 2 twist , 6 2 cape , 7 2 cleaver , 8 2 clerk , 9 2 clerical , 10 2 cleverness , 11 2 clever , 12 2 couch , 13 2 dislocated , 14 2 effectually , 15 2 గోపురము , 16 2 చెంచా , 17 2 entail , 18 2 పొద్దుతిరుగుడు , 19 2 hand , 20 2 harbour , 21 2 harem , 22 2 how , 23 2 huff , 24 2 spiritual , 25 2 iota

set 2007: 1 2 పరమండలము , 2 2 పుట్టినదినము , 3 2 మరమరాలు , 4 2 whelk , 5 2 జ్యేష్ఠ , 6 2 saint , 7 2 potter , 8 2 part , 9 2 లిప్త , 10 2 వితత , 11 2 stool , 12 2 food , 13 2 oil , 14 2 line , 15 2 చిరుతపులి , 16 2 జ్ఞానము , 17 2 ఆచారము , 18 2 అంగారకుడు , 19 2 cloth , 20 2 భూమి , 21 2 ఈగ , 22 1 చిన్నగా

out 2007: 1 2 నారాయణుడు , 2 1 రాజదూత

nov 2007: 1 2 పెండ్లి , 2 2 ప్రసంగము , 3 2 ఈక కలము , 4 2 దస్తా , 5 2 చెల్లింపు , 6 2 పద్యం , 7 2 గుణింతము , 8 2 బోధన , 9 2 రమణీయము , 10 2 ఉచితం , 11 2 అభ్యాసము , 12 2 గంట , 13 1 గోతము

dez 2007: 1 2 విష్ణుమూర్తి , 2 2 గొడుగు , 3 1 గిరాకి

jan 2008: 1 2 యోగ్యత , 2 2 అండ , 3 1 బరిసె

fev 2008: 1 2 సీసము , 2 2 ఉల్లిగడ్డ , 3 2 అంధవిశ్వాసము , 4 2 ఇత్తడి , 5 2 మంత్రి , 6 2 కొండ , 7 2 ఆవాలు , 8 2 ఊరు , 9 1 ముద్దాయి

mar 2008: 1 2 train , 2 2 fraction , 3 1 nitrogen

abr 2008: 1 2 protocol , 2 2 magnet , 3 1 మాగాణి

mai 2008: 1 1 అడవి గన్నేరు

jun 2008: 1 1 స్వతంత్రము

jul 2008: 1 2 సిగ్గుమాలిన , 2 2 తురక , 3 2 తవుడు , 4 2 బెత్తము , 5 2 సాలె , 6 2 అందము , 7 2 అమ్మ

ago 2008: 1 2 ధూమ శకటము , 2 1 ఎన్నిక

set 2008: 1 2 విస్తరి , 2 1 మరక

out 2008: 1 2 తూనీగ , 2 1 అనూరుడు

nov 2008: 1 1 లింగము

dez 2008: 1 3 chose , 2 1 తిరుపతి యాస, భాష, పదాలు

jan 2009: 1 1 apses

fev 2009: 1 2 Improvisation , 2 1 africa

mar 2009: 1 3 పాట , 2 2 orthodox , 3 2 ముద్దు , 4 2 మడుగు , 5 2 తనయ , 6 2 నిఘంటువు , 7 2 గొడ్డలి , 8 2 తోడేలు , 9 2 గంట , 10 2 ప్రకటన , 11 2 అంగుళము , 12 2 దువ్వెన , 13 2 దేవుడు , 14 2 మణికట్టు , 15 2 గుండె , 16 2 ఆవు

abr 2009: 1 1 Flyover

mai 2009: 1 2 o' clock , 2 1 కలహభోజనుడు

jun 2009: 1 1 coup d’etat

jul 2009: 1 2 Minerva , 2 2 monday , 3 1 minerva

ago 2009: 1 2 Feedback , 2 1 Expandable

set 2009: 1 3 శనివారము , 2 2 బంగాళాదుంప , 3 2 డిసెంబర్ , 4 2 నవంబర్ , 5 2 సెప్టెంబర్ , 6 2 ఆగష్టు , 7 2 జులై , 8 1 పింగళ

out 2009: 1 2 వరి , 2 2 లోటా , 3 1 అప్రమేయ

nov 2009: 1 2 spine , 2 2 వెన్నుపాము , 3 2 నాభి , 4 2 బొడ్డు , 5 1 ద్వైతం

dez 2009: 1 2 amala

jan 2010: 1 1 వంశీ

fev 2010: 1 2 zoo , 2 1 aye

mar 2010: 1 2 o' clock , 2 1 zoo

abr 2010: 1 2 anklets , 2 2 అల్లాహ్ , 3 2 awesome , 4 2 Subtrahend

mai 2010: 1 2 end , 2 1 సుమారు

jun 2010: 1 2 unitarian , 2 2 solution , 3 1 algebraic

jul 2010: 1 2 వృథా , 2 2 milk

ago 2010: 1 3 vert , 2 3 dried , 3 2 suicide bomber , 4 2 toothless , 5 2 publisher , 6 2 over-roasted , 7 2 community , 8 2 fleshiness , 9 2 January

set 2010: 1 3 abnormal , 2 3 quadruped , 3 3 abate , 4 3 abject , 5 3 accent , 6 3 abdicate , 7 2 మధువు , 8 2 శెలవు , 9 2 ఏడాది , 10 2 put off , 11 2 in vain , 12 2 put out , 13 2 in time , 14 2 to and fro , 15 2 set down , 16 2 set out , 17 2 set in , 18 2 in search of , 19 2 go for a walk , 20 2 at home , 21 2 cut down , 22 2 as soon as , 23 2 pick up , 24 2 wake up , 25 2 crowbar

out 2010: 1 3 fractional distillation , 2 3 గుండీ , 3 2 పరిపక్వత , 4 2 సుద్ద , 5 2 జాగిలము , 6 2 చాకిరీ , 7 2 చాకచక్యము , 8 2 పానము , 9 2 పడిగాపు , 10 2 నిమిషము , 11 2 ప్రాణవాయువు , 12 2 ఎత్తైన , 13 2 చిత్రం , 14 2 నూర్పిడి , 15 2 గాలించు , 16 2 చెండు , 17 2 నిర్వచనము , 18 2 నియంత్రణ , 19 2 కజ్జికాయచెక్క , 20 2 ఎర్రగడ్డ , 21 2 సోయా చిక్కుడు , 22 2 జల్లిగరిట , 23 2 తెల్లపాయలు , 24 2 మినపప్పు , 25 2 గీతా జయంతి

nov 2010: 1 3 మిత్రద్రోహి , 2 3 సముద్రం , 3 3 నిరుత్సాహము , 4 3 శాఖము , 5 3 క్యాబేజీ , 6 3 ఆర్గాన్ , 7 3 ధూళి , 8 3 జీడిపప్పు , 9 3 రంపము , 10 2 చిమ్ముబిల్ల , 11 2 అష్టాదశ , 12 2 గరుడవర్ధనం పువ్వు , 13 2 బొరుగుల ఉప్మా , 14 2 అప్పము , 15 2 మురికికాలువ , 16 2 పచ్చగడ్డి , 17 2 నిర్మాణకౌశలము , 18 2 సంగీతకళాశాల , 19 2 ప్రదర్శనశాల , 20 2 చెక్కభజన , 21 2 సరుగుడుమొక్క , 22 2 జిల్లేడు పువ్వు , 23 2 సరుగుడు , 24 2 జిల్లేడుమొక్క , 25 2 దానిమ్మచెట్టు

dez 2010: 1 2 కుంకుడు గింజ , 2 2 కుంకుడు వృక్షం , 3 2 కుంకుడు కాయ , 4 2 కుంకుడు ఆకు , 5 2 ధన్వంతరి , 6 2 గరిడె , 7 2 నటరాజు , 8 2 మలికితము , 9 2 కొబ్బరి నూనె , 10 2 దత్తాత్రేయుడు , 11 2 ఆదిశేషుడు , 12 2 ఇండియా గేట్ , 13 2 కాళి , 14 2 అఱుపు , 15 2 జనప్రవాహము , 16 2 కూజా , 17 2 ఢమరుకం , 18 2 గిటారు , 19 2 ఉమ్మెత్త , 20 2 అచల , 21 2 ఆంధ్రప్రదేశ్ , 22 2 దేవుడి గూడు , 23 2 సముద్రతీరము , 24 2 ఇసుక గూడు , 25 2 కంజీర

jan 2011: 1 2 హడపు , 2 2 హఠము , 3 2 wiki , 4 2 హరిశ్చంద్రుడు , 5 2 పెన్సిలు , 6 2 అంగ మర్దనము , 7 2 అంగమర్ధుడు , 8 2 అక్కటికము , 9 2 అంకగణితము , 10 2 వర్గము , 11 2 మర , 12 2 తురగము , 13 1 హరిసఖుడు

fev 2011: 1 2 burning , 2 1 హోత

mar 2011: 1 1 ఘర్షకం

abr 2011: 1 1 கணினி

mai 2011: 1 2 ఆధునిక , 2 2 అనగా , 3 2 అనంతం , 4 2 అధ్యయనము , 5 1 అధునిక

jun 2011: 1 2 అనువాదాలు , 2 2 క్షమ , 3 1 క్రోసుడు

jul 2011: 1 2 అనుభోగము , 2 2 అనుభవము , 3 2 అనుపమానము , 4 2 mastiff , 5 1 అగ్ని (దేవుడు)

ago 2011: 1 1 మాత్రము

set 2011: 1 2 ఈత , 2 2 అతుకు , 3 1 గాయకురాలు

out 2011: 1 1 రాచనగరు

nov 2011: 1 1 శంఖం

dez 2011: 1 2 నిర్యాణము , 2 2 zoro , 3 2 sehatra , 4 2 మిరపకాయ , 5 2 జనపనార , 6 2 airy , 7 1 ప్రపితామహం

jan 2012: 1 3 చేయి , 2 3 చెవి , 3 3 మొదటి పేజీ , 4 2 యవ్వారం , 5 2 కపోతము , 6 2 ఛాతీ , 7 2 గుర్రప్పందాలు , 8 2 వ్రేలాడదీయు , 9 2 విజ్ఞాన శాస్త్రము , 10 2 తత్వ శాస్త్రము , 11 2 జీవ శాస్త్రము , 12 2 వృక్ష శాస్త్రము , 13 2 జంతు శాస్త్రము , 14 2 వాస్తు శాస్త్రము , 15 2 అర్ధ శాస్త్రము , 16 2 ఆర్ధిక శాస్త్రము , 17 2 మానసిక శాస్త్రము , 18 2 భూగోళ శాస్త్రము , 19 2 గణిత శాస్త్రము , 20 2 తర్క శాస్త్రము , 21 2 పౌర శాస్త్రము , 22 2 వైద్య శాస్త్రము , 23 2 యంత్ర శాస్త్రము , 24 2 భూగర్భ శాస్త్రము , 25 2 వ్యాకరణ శాస్త్రము

fev 2012: 1 3 calf , 2 3 రాజు , 3 3 పక్షవాతము , 4 3 ఔషధము , 5 2 పోగుచేసిన , 6 2 మృదువైన , 7 2 సీసా , 8 2 అస్థిరత , 9 2 ఊరివాడు , 10 2 నల్లచేవమాను , 11 2 బొగ్గు నలుపు , 12 2 ఆకుపచ్చ , 13 2 చామనఛాయ , 14 2 ఇతివృత్తము , 15 2 గౌరవమైన , 16 2 వాత్సల్యము , 17 2 ప్రియమైన , 18 2 సహజముగా , 19 2 ప్రశంసనీయం , 20 2 కమ్మని , 21 2 నియంత , 22 2 అంటువ్యాధి , 23 2 వాతం , 24 2 నవ్యత , 25 2 నిర్దాక్షణ్యం

mar 2012: 1 2 మైకము , 2 2 బలుపాకురాయి , 3 2 దక్షిణధృవము , 4 2 ఉత్తరధృవము , 5 2 ధృవము , 6 2 తడిపొడి , 7 2 సుదతి , 8 2 కొరత , 9 2 అనుగుణ్యము , 10 2 కక్షిదారు , 11 2 బడలిక , 12 2 శోభ , 13 2 దౌత్యము , 14 2 రక్తహీనత , 15 2 అంబరు , 16 2 దేశ్యము , 17 2 ఎగుమతి , 18 2 దిగుమతి , 19 2 కోశాధికారి , 20 2 పుంలింగము , 21 2 తెడ్డు , 22 2 పేక , 23 2 నూలు , 24 2 పాఠశాల , 25 2 గుర్రము

abr 2012: 1 3 ఇరుసు , 2 3 ఆస్ట్రేలియా , 3 3 గంటము , 4 3 పూస , 5 2 తాచుపాము , 6 2 సౌదీ అరేబియా , 7 2 ఉత్తర కొరియా , 8 2 దక్షిణ కొరియా , 9 2 ఆఫ్రికా , 10 2 గంటసాల , 11 2 చెంగావి , 12 2 ముక్కిన , 13 2 తొండం తాడు , 14 2 కదురుగోలు , 15 2 కపిలి బండి , 16 2 ములుగర్ర , 17 2 కొండ్ర , 18 2 దాపట , 19 2 మోట , 20 2 కపిలి , 21 2 ఎలపట , 22 2 మడవ , 23 2 గూడ , 24 2 హీలియము , 25 2 ఉండ్రాళ్ళు

mai 2012: 1 3 కడుపుతో నుండుట , 2 2 కడపర , 3 2 కడతెగు , 4 2 రాజకీయాలు , 5 2 ఆటవెలది , 6 2 తపాలాబిళ్ళ , 7 2 పిరంగి , 8 2 జగము , 9 2 కంకర , 10 2 వాడి , 11 2 కార్యాలయము , 12 2 కడపటి , 13 2 ఎనుము , 14 2 నందివర్ధనం చెట్టు , 15 2 చల్ల , 16 2 కోడిపుంజు , 17 2 ఉత్తరక్రియ , 18 2 వరము , 19 2 ఛాపము , 20 2 పరము , 21 2 మట్టిపాత్రలు , 22 2 బస్సు , 23 2 సంస్కృత నిఘంటువు , 24 2 నీరుల్లి , 25 2 అలరు

jun 2012: 1 2 షట్కోణము , 2 2 జీవకణము , 3 2 ఠంకారము , 4 2 కడలు , 5 2 టెలిఫోన్ , 6 2 నకలు , 7 2 రోమము , 8 2 ఓడ , 9 1 రామ

jul 2012: 1 2 శిఖండి , 2 2 హిడింబి , 3 2 కీచకుడు , 4 2 కేంద్రకము , 5 2 అంగప్రదక్షిణము , 6 2 బీజము , 7 2 శంతనుడు , 8 2 జనమేజయుడు , 9 2 ఆదిత్యుడు , 10 2 వ్యాసుడు , 11 1 జంబూ

ago 2012: 1 3 గీత , 2 2 అరకన్ను , 3 2 అరకాని , 4 2 అయ్యవారు , 5 2 అయోగము , 6 2 అయుక్తము , 7 2 అయశస్కరము , 8 2 అయశము , 9 2 అయత్నము , 10 2 అమృతకలశము , 11 2 అమృతుడు , 12 2 అమృతాంశువు , 13 2 అమృతాంధనుడు , 14 2 అముద్రితము , 15 2 అమిత్రుడు , 16 2 అమాంతవర్తకుడు , 17 2 అమవస , 18 2 అమలుదారుడు , 19 2 అభూతము , 20 2 అమరావతి , 21 2 అమరాద్రి , 22 2 అమరాంగన , 23 2 అభ్యున్నతము , 24 2 అభ్యుచితము , 25 2 అభ్యారోహణము

set 2012: 1 3 దుర్గ , 2 2 ఈల , 3 2 ఈడ , 4 2 ఇలకోడి , 5 2 ఇర్వురు , 6 2 ఇరువురు , 7 2 ఇరువది , 8 2 ఇరుగుపొరుగు , 9 2 ఇరుగు , 10 2 ఇట్టిక , 11 2 ఇటిక , 12 2 ఇచ్చట , 13 2 ఇగో , 14 2 ఇక్షువు , 15 2 ఇండ్లు , 16 2 జాగా , 17 2 ఆవంత , 18 2 ఆదివరాహము , 19 2 ఆజ్ఞానుసారముగా , 20 2 ఆజ్ఞానుసారము , 21 2 ఆజ్ఞానువర్థి , 22 2 ఆకుపురుగు , 23 2 ఆబోతు , 24 2 గీతము , 25 2 ఉష్ణం

out 2012: 1 3 కాపురస్థుడు , 2 3 తెలుగు మహిళల పేర్లు , 3 3 ఎతడు , 4 3 ఎడ్లు , 5 3 ఎడ్డము , 6 3 ఎడారె , 7 3 ఎడవాడు , 8 3 ఎడద , 9 3 ఊదా , 10 3 ఉల్లంఘించు , 11 3 ఉలగరము , 12 3 ఉరోజము , 13 3 ఉరము , 14 3 ఉముక , 15 3 ఉబ్బు , 16 3 ఉపవనము , 17 3 ఉంపుడుకత్తె , 18 3 ఉంపడము , 19 3 ఉంఛవృత్తి , 20 3 ఉంఛము , 21 3 ఉంగ్రము , 22 3 కంచరగాడిద , 23 3 ఉక్కిరిబిక్కిరి , 24 3 ఉల్బము , 25 3 ఎగురు

nov 2012: 1 3 షట్చక్రవర్తులు , 2 3 అష్టదిక్పాలకులు , 3 3 తెలుగు పురుషుల పేర్లు , 4 3 లక్షాధికారి , 5 3 తెలుగు మహిళల పేర్లు , 6 3 కమ్మ , 7 3 తెలుగు జాతీయములు , 8 3 కుట్టు , 9 3 విను , 10 3 చింత , 11 3 కట్టు , 12 2 అంగలూరు , 13 2 కృష్ణా జిల్లా గ్రామాలు , 14 2 చిదుగు , 15 2 చిదాత్మ , 16 2 చిదగొద , 17 2 చిత్రిణి , 18 2 చిత్రాసనము , 19 2 చిత్రాన్నము , 20 2 చిత్రశిఖండిజుడు , 21 2 చిత్రశాల , 22 2 చిత్రవాలము , 23 2 చిత్తిని , 24 2 చిత్తవృత్తి , 25 2 చిత్తవిప్లవము

dez 2012: 1 3 కక్కాయి , 2 3 ద్వయము , 3 2 నాటుకొను , 4 2 కలువరాయడు , 5 2 కమ్మరీడు , 6 2 ధేనుక , 7 2 దావాగ్ని , 8 2 తేలుకొండి , 9 2 తెగ , 10 2 తీర్థకాకము , 11 2 తీతువు , 12 2 తుల , 13 2 తడక , 14 2 తంతివాద్దెము , 15 2 తండువు , 16 2 డోలనము , 17 2 డలాయతు , 18 2 డవాలి , 19 2 డయనము , 20 2 డమాయి , 21 2 డమాను , 22 2 డమరువు , 23 2 డమరము , 24 2 డబ్బాటు , 25 2 నామాలపురుగు

jan 2013: 1 2 డంబరము , 2 2 జయఘంట , 3 2 పొట్టపోసికొను , 4 2 తెలుగు నిఘంటువులో పేర్కొన్న ఉర్దూ పదాలు , 5 2 పులిదుంప , 6 2 పుంఖానుపుంఖము , 7 2 గొణగు , 8 2 గుండియ , 9 2 పాణి , 10 2 గాలికుంటు , 11 2 గాముల ఱేడు , 12 2 పరివేశము , 13 2 పరశువు , 14 2 గవకు , 15 2 ఖడ్గి , 16 2 புவியியல் , 17 2 பகுதி , 18 2 அகண்டதீபம் , 19 2 அகங்கரிப்பு , 20 2 அகக்கமலம் , 21 2 நாடோடி , 22 2 கிழக்கு , 23 2 அங்குசம் , 24 2 அகிம்சை , 25 2 నేతిబీర

fev 2013: 1 2 మృగనా భి , 2 2 రక్తగంధము , 3 2 మాతాపితలు , 4 2 రత్నాకరము , 5 2 చంద్రగిరి , 6 2 కాళహస్తి , 7 2 భూగర్భము , 8 2 గర్భగృహము , 9 2 గర్భవతి , 10 2 రోడ్డు , 11 2 లెంపకాయ , 12 2 ముడ్డి , 13 2 తాపి , 14 2 గిరి , 15 2 ద్వారం , 16 2 తరువు , 17 2 తీరు , 18 2 తుండు , 19 2 తాడు , 20 2 మగ , 21 2 సముద్రము , 22 2 కాలము , 23 2 ముగ్గు , 24 1 తుటారికత్తియ

mar 2013: 1 4 దిగంబరుడు , 2 2 తొంటచేతివాడు , 3 2 తైషము , 4 2 తెల్లయేనుగు , 5 2 తెలికలు , 6 2 వెండ్రుక , 7 2 వెండిగుండు , 8 2 వెంట్రువ , 9 2 వృషుడు , 10 2 వృషాంకుడు , 11 2 వృక్షచరము , 12 2 వృకదంశము , 13 2 వీగియాడు , 14 2 చుర్రు , 15 2 విశిష్టుడు , 16 2 విశ్వనాథుడు , 17 2 వజ్రాయుధము , 18 2 త్రిపురాంతకుడు , 19 2 తేలాడు , 20 2 తేఱు , 21 2 గంగాధరుడు , 22 2 కంఠాభరణము , 23 2 వట్టకాయ , 24 2 వృషణము , 25 2 ఫాలనేత్రుడు

abr 2013: 1 4 మొదటి పేజీ , 2 3 ద్విజరాజు , 3 3 చతుర్భుజి , 4 3 శుక్రుడు , 5 2 నల్లెరు , 6 2 నమస్కృతి , 7 2 నఫా , 8 2 నగరి , 9 2 నగధరుడు , 10 2 నక్తంచరము , 11 2 ఎప్సిలోన్ , 12 2 శుక్కు , 13 2 సీలించు , 14 2 శీర్ణము , 15 2 శీతాంసువు , 16 2 అంతర్జాతీయ న్యాయస్థానం , 17 2 వ్యభిచారిణి , 18 2 వైజయంతుడు , 19 2 వేశము , 20 2 కరీంనగర్ జిల్లా , 21 2 ఆదిలాబాదు జిల్లా , 22 2 ఆగ్నేయ మధ్య రైల్వే , 23 2 ఆగ్నేయ రైల్వే , 24 2 దక్షిణ రైల్వే , 25 2 వాయువ్య రైల్వే

mai 2013: 1 4 పాడు , 2 3 ఏలు , 3 3 నశించు , 4 3 శునకము , 5 3 పూయు , 6 3 శ్లోకము , 7 3 కవిత , 8 2 ఏకలింగ పుష్పములు , 9 2 ఎఱ్ఱరక్తకణములు , 10 2 ఉపజిహ్విక , 11 2 ఆయస్కాంతికక్షేత్రము , 12 2 ఆమ్లీకరణము , 13 2 ఆమ్లజనీకరణము , 14 2 సేవించు , 15 2 సమర్పించు , 16 2 సిద్ధార్థుడు , 17 2 ఎముకలగూడు , 18 2 శ్వానకాసము , 19 2 శ్రీకాంతుడు , 20 2 శ్రీకరుడు , 21 2 శ్రాద్ధదేవుడు , 22 2 శోషము , 23 2 శుభకరము , 24 2 శుని , 25 2 సంరక్షించు

jun 2013: 1 2 వృషభచక్రం , 2 2 వృద్దావస్థ , 3 2 పరాజిత , 4 2 పాపలగ్నాలు , 5 2 సూత్రంపట్టడం , 6 2 భిత్తి , 7 2 జీర్ణోద్దారం , 8 2 తృణం , 9 2 కర్ణికారం , 10 2 శత పత్రం , 11 2 ఆమ్రం , 12 2 నింబం , 13 2 రాజవృక్షం , 14 2 రుధిరదోషం , 15 2 బధిరగృహం , 16 2 విగ్రహాలు , 17 2 కూపం , 18 2 రథరేణువు , 19 2 శల్యోథ్ధారం , 20 2 నవకోష్టకం , 21 2 ఆయుత భూమి , 22 2 వాయుయానము , 23 2 శల్యాలు , 24 2 భూశోధన , 25 2 వర్గులు

jul 2013: 1 3 తలపు , 2 3 అన్నము , 3 2 తొంగొను , 4 2 తినగతినగ , 5 2 మ్రోగెను , 6 2 చెలరేగెను , 7 2 కమ్మగా , 8 2 బాల్యక్రీడలు , 9 2 అంబరరత్నము , 10 2 అంబరమణి , 11 2 అంశుడు , 12 2 తెల్లవాడు , 13 2 మృగేంద్రుడు , 14 2 మాతలుడు , 15 2 మకరధ్వజుడు , 16 2 పన్నగాశనుడు , 17 2 అంగరంగవైభవము , 18 2 పోగాలము , 19 2 అమిషము , 20 2 కాగిలి , 21 2 వృచ్ఛికవానర న్యాయము , 22 2 వృశ్చికచోరన్యాయము , 23 2 స్వరూపం , 24 2 బధిరవీణాన్యాయము , 25 2 మార్జాలకబళన్యాయము

ago 2013: 1 3 ఉల్లి , 2 2 అఖేటనుడు , 3 2 అఖురథుడు , 4 2 అఖుబుక్కు , 5 2 ఆక్షారితుడు , 6 2 ఆక్లేదము , 7 2 ఆక్రోశనము , 8 2 ఆకుజల్ల , 9 2 అకతాళ్ళు , 10 2 ఆగాకర , 11 2 ఆకపడు , 12 2 అంధ్యము , 13 2 ఎండుచేప , 14 2 అర్పించుట , 15 2 అరుచుట , 16 2 అరుగుట , 17 2 పోటముంజు , 18 2 పొంగట్టు , 19 2 పంద , 20 2 నేస్తకాడు , 21 2 నేలపట్టి , 22 2 నేత్రిక , 23 2 నెలవీసము , 24 2 నెలవెలుగు , 25 2 నెలవత్తి

set 2013: 1 2 ఏతయ్య , 2 2 విజయవాడ , 3 2 తలారి , 4 2 ప్రేమించు , 5 2 దధీచి , 6 2 కంపరము , 7 2 కంబము , 8 2 కండూతి , 9 2 కంచు , 10 2 సవ్యసాచి , 11 2 తండి , 12 2 ఓడు , 13 2 కంకణము , 14 2 కంద , 15 2 కందిరీగ , 16 1 కుంటగలగరమొక్క

out 2013: 1 2 తుహినకరుడు , 2 2 నాకు , 3 1 మధము

nov 2013: 1 3 పొదుగు , 2 2 సాకుట , 3 2 పాపిష్టి , 4 2 ముచ్చటించు , 5 2 అలీన ఉద్యమం , 6 2 మొఱ్ఱి , 7 2 మొగుదారి , 8 2 మేఘపుష్పము , 9 2 మృగధరుడు , 10 2 ధారణము , 11 2 అస్థిపంజర వ్యవస్థ , 12 2 గుగ్గిలము , 13 2 కాబేజీ , 14 2 గర్భాదానము , 15 2 మొండి , 16 2 మొలత్రాడు , 17 2 మొద్దు , 18 2 ముంగురులు , 19 2 పొగ , 20 2 సాకు , 21 2 వదంతి , 22 2 rambling , 23 2 acquit , 24 2 billingsgate , 25 2 brinjal

dez 2013: 1 2 బుద్ధిపూర్వకముగా , 2 2 హుషారుగా , 3 2 సంపూర్ణముగా , 4 2 నిశ్చయముగా , 5 2 స్థిరముగా , 6 2 శాశ్వతముగా , 7 2 విశ్వాసముగా , 8 2 దయగా , 9 2 ఉగ్రముగా , 10 2 విచిత్రముగా , 11 2 చల్లగా , 12 2 వేడిగా , 13 2 బోర్లించుట , 14 2 చప్పగా , 15 2 అగోచరముగా , 16 2 నిత్యత్వము , 17 2 మనుష్యహత్య , 18 2 పుణ్యదివసము , 19 2 మనఃపూర్వకముగా , 20 2 హేయముగా , 21 2 కుంటుతూ , 22 2 సుఖముగా , 23 2 అసూయగా , 24 2 సుధర్ముడు , 25 2 వ్యాకరణవేత్త

jan 2014: 1 3 చెల్లించుట , 2 3 ఫలం , 3 2 సిద్ధపరచు , 4 2 అచలించు , 5 2 అగడుపఱచు , 6 2 అక్కఱకువచ్చు , 7 2 అంతుతేల్చుకొను , 8 2 అంతముచూడు , 9 2 అంతమునొందించు , 10 2 ఊగు , 11 2 సాత్వికముగా , 12 2 సరదాగా , 13 2 శ్రావ్యముగా , 14 2 కాపాడుట , 15 2 సంధించు , 16 2 సంకోచించు , 17 2 వర్ణించు , 18 2 లభించు , 19 2 బోధించు , 20 2 బండెలుక , 21 2 ప్రాబల్యము , 22 2 ప్రతిసరము , 23 2 దురవస్థ , 24 2 తమ్మిచూలి , 25 2 మంగలివాడు

fev 2014: 1 3 తుచ్ఛుడు , 2 2 చందము , 3 2 గడుచు , 4 2 ఓగులవాడు , 5 2 నాంతరీయకన్యాయము , 6 2 మత్తకాశినీన్యాయం , 7 2 దాక్షిణ్యము , 8 2 చినిగిన , 9 2 పీపాయి , 10 2 విరిగిన , 11 2 వినయముగా , 12 2 చొరబడడము , 13 2 గ్రామ్యము , 14 2 తంత్రము , 15 2 రథము , 16 2 కుతంత్రము , 17 2 నీచుడు , 18 2 ప్రతిధ్వని , 19 2 కరుణ , 20 1 జాగారణము

mar 2014: 1 2 గొప్పలు , 2 2 అంగజము , 3 2 మహాపండితుడు , 4 2 సురపతి , 5 2 స్మరించుట , 6 2 కారకం , 7 2 గార్హస్థ్యసన్యాసపరీక్షాన్యాయం , 8 2 చిరునగవు , 9 2 సంహరించుట , 10 2 అవతరించు , 11 2 ప్రతిభావంతుడు , 12 2 కాంచనుడు , 13 2 మునివాహనుడు , 14 2 పరాంకుశదాసుడు , 15 2 భక్తిసారుడు , 16 2 నారదుఁడు , 17 2 పురుమీఢుడు , 18 2 హస్తికుఁడు , 19 2 అంగుఁడు , 20 2 వామనుఁడు , 21 2 ఉపేంద్రుఁడు , 22 2 మరచుట , 23 2 వాదోపవాదములు , 24 2 మహిషుడు , 25 2 అలసుడు

abr 2014: 1 2 కుమ్మరిపురుగు , 2 2 అలుగుట , 3 2 మెలగుట , 4 2 కలుగుట , 5 2 కుందనం , 6 2 నువ్వు , 7 2 ఆరోగ్యవంతుడు , 8 2 వ్యాధిగ్రస్తుడు , 9 2 వ్యాధిపీడితుడు , 10 2 పూచుట , 11 2 రుణం , 12 2 తప్పిదం , 13 2 గరిమము , 14 2 క్రూరలోచనుడు , 15 2 భవిత , 16 2 మీరుట , 17 2 బొప్పాయిపండు , 18 2 శూద్రుడు , 19 2 వేలుపుబానిస , 20 2 వెలయింతి , 21 2 వారకాంత , 22 2 తిరము , 23 2 యజమానుడు , 24 2 మెలగు , 25 2 పర్యాయపదము

mai 2014: 1 3 దీపము , 2 2 ఋజుమార్గేణ్ సిధ్యతి , 3 2 అక్షిగోళము , 4 2 అంధాక్షిమీలనన్యాయము , 5 2 నక్షత్రమండలము , 6 2 అంధదర్పణన్యాయము , 7 2 అంధగోక్షేత్రన్యాయము , 8 2 అంధగజన్యాయము , 9 2 సలుపుట , 10 2 అంధపరంపరాన్యాయము , 11 2 అంకోలబీజన్యాయము , 12 2 ఊర్ధ్వముఖము , 13 2 అంకుశన్యాయము , 14 2 నిండుచందమామ , 15 2 నింపుట , 16 2 అంధపరంపరాన్యాయం , 17 2 లావిక , 18 2 పుష్పలావిక , 19 2 పుంగర్భము , 20 2 అప్రసక్తనిషేధన్యాయము , 21 2 ఇక్షురసన్యాయము , 22 2 వితానము , 23 2 కంటకన్యాయము , 24 2 మహోదరము , 25 2 మహావీరుడు

jun 2014: 1 2 కన్నుకుట్టు , 2 2 ఎనక , 3 2 సోపానారోహణన్యాయము , 4 2 జలమథనన్యాయము , 5 2 జలతుంబికాన్యాయము , 6 2 చిత్రితాంగజంబుకన్యాయము , 7 2 ఆమ్రవనము , 8 2 మలినం , 9 2 కంబళభోజనన్యాయము , 10 2 మహిషము , 11 2 బదరము , 12 2 చాలనము , 13 2 చండాలుడు , 14 2 చంచల , 15 2 స్ఫటికము , 16 2 గుడము , 17 2 కాకము , 18 2 ఆడ , 19 2 ఉల్లాసం , 20 2 బిల్వము , 21 2 జిగురు , 22 2 ఒలుకు , 23 2 మూగ , 24 2 క్షీరము , 25 2 గొప్ప

jul 2014: 1 2 తల్లడిల్లి , 2 2 మిధ్యామతి , 3 2 మోసంచేయు , 4 2 పురాతన , 5 2 అనుగ్రహించు , 6 2 నలువ , 7 2 అంకం , 8 2 కుత్తుక , 9 2 సీమంతము , 10 2 ఉద్రేకం , 11 2 అవలీల , 12 1 ఉత్ఖాతదంష్టభుజగన్యాయము

ago 2014: 1 2 బ్రహ్మ జ్ఞానం , 2 2 ఆత్మబంధువు , 3 2 గుబాళింపు , 4 2 సంధ్యవేళ , 5 2 జానపదం , 6 2 పర్యావరణ , 7 2 పదనిధి , 8 2 సమ్మోహనం , 9 2 విక్రయ కేంద్రం , 10 2 మరకలు , 11 2 సిరిసంపదలు , 12 2 భారం , 13 2 ఏగుట , 14 2 షట్కర్మ , 15 2 వటారము , 16 2 రక్షామణి , 17 2 బొంకరి , 18 2 ప్రవేశపెట్టు , 19 2 తంతు , 20 2 డేకురు , 21 2 ఠవళి , 22 2 శాకము , 23 2 ఋతుశాంతి , 24 2 వైవిధ్యము , 25 2 అతిక్రమించు

set 2014: 1 3 వృషణము , 2 2 పలవరింపు , 3 2 చక్రబంధం , 4 2 ముందస్తు , 5 2 వాస్తుపూజ , 6 2 రుణం , 7 2 లౌకికము , 8 2 పులుగు , 9 2 గమనించు , 10 2 ఆచరించు , 11 2 సందడి , 12 2 రంభ , 13 2 నిందితుడు , 14 2 ఆసక్తి , 15 2 తిమ్మిరి , 16 2 సదస్సు , 17 2 అమ్మకము , 18 2 నగుబాటు , 19 2 విందు , 20 2 కొలువు , 21 2 భాస్కరుడు , 22 2 వృషణం , 23 2 ఆజ్ఞ , 24 2 ధనము , 25 2 అంగడి

out 2014: 1 2 సునిశితము , 2 2 అగ్నిహోత్రి , 3 2 పండబారు , 4 2 విశ్వప్రయత్నం , 5 2 మిశ్రమం , 6 2 అక్షగ్లహము , 7 2 కౌగిలింత , 8 2 సహస్రాంశు , 9 2 పరిశుభ్రత , 10 2 సాధికారత , 11 2 చక్రాంకితము , 12 2 అనుక్షణం , 13 2 శిల్పకళ , 14 2 ప్రవచనాలు , 15 2 గుబాళించు , 16 2 చుట్టిల్లు , 17 2 జాగిలము , 18 2 సంకల్పం , 19 2 ఉత్తరీయం , 20 2 ఉరి , 21 2 కునుకు , 22 2 గుహ , 23 2 మాటు , 24 2 సేవ , 25 2 అలంకారము

nov 2014: 1 2 మంత్రగాడు , 2 2 అతిధృతి , 3 2 దారుణం , 4 2 పండుకప్ప , 5 2 విధవరాలు , 6 2 మంకి , 7 2 పొలికె , 8 2 ఎందువలన , 9 2 చంకగోడ , 10 2 వీరంగము , 11 2 సంజనము , 12 2 అననము , 13 2 అనన్య దృష్టి , 14 2 ముంగరి , 15 2 ముంగత్తి , 16 2 నాగేలి , 17 2 పుష్కలం , 18 2 జింకపిల్ల , 19 2 రాంకవము , 20 2 ఎక్కటి , 21 2 పచ్చ , 22 2 వంటకము , 23 2 పొగబండి , 24 2 జాలరి , 25 2 జానపదము

dez 2014: 1 3 మృగతృష్ణ , 2 2 తటస్థమైన , 3 2 సర్వసంగ , 4 2 గిడ్లదొడ్డి , 5 2 సర్వస్వతంత్రుడు , 6 2 పరాగ , 7 2 వీర రాత్రి , 8 2 వృద్ధిచేయు , 9 2 సాత్వికమైన , 10 2 మేళా , 11 2 అన్యభృత్తు , 12 2 అందచందములు , 13 2 అదుపు , 14 2 ప్రశంస , 15 2 లోహండి , 16 2 మరీచిక , 17 2 ధేనుక , 18 2 ఆహారము , 19 2 ఎత్తుగడ , 20 2 సంస్కారము , 21 2 చిల్లర , 22 2 పల్లె , 23 2 నేర్పు , 24 2 సాక్ష్యము , 25 2 అద్భుతము

jan 2015: 1 2 లంకె , 2 2 పంచుకొను , 3 2 లేవనెత్తు , 4 2 మేకొను , 5 2 అర్గళము , 6 2 కరణములు , 7 2 ఆకర్షణము , 8 2 నీరాజనము , 9 2 బుద్ధి , 10 2 తిలకము , 11 2 ఉపదేశము , 12 2 ఎత్తు , 13 1 మువ్వన్నె

fev 2015: 1 2 గుబురు , 2 2 అందము , 3 1 అజాకృపాణీయన్యాయం

mar 2015: 1 3 స్వరక్షణ , 2 3 అభయ , 3 3 భాసము , 4 3 తోవ , 5 3 గహ్వరము , 6 3 ఆహారము , 7 3 అపదేశము , 8 3 అధీనము , 9 3 తాటిచెట్టు , 10 3 తనువు , 11 3 apathy , 12 3 వెలుగు , 13 3 చిగురు , 14 3 కేశము , 15 2 మృత్తికాస్నానము , 16 2 మేదిరము , 17 2 మధ్యమస్తిష్కము , 18 2 మెడ పట్టని మేనరికం , 19 2 మహసూలు , 20 2 భూతం భవ్యాయోపదిశ్యతే , 21 2 రుద్రాక్షపూస , 22 2 మైథునాంగములు , 23 2 రాజకార్యాంగములు , 24 2 రాగోపాంగములు , 25 2 రాగాంగములు

abr 2015: 1 4 శిల్పము , 2 3 మేషపుచ్ఛన్యాయము , 3 3 బాణోష్ట్రీన్యాయము , 4 3 బిల్వఖల్వాటన్యాయము , 5 3 బిలవర్తిగోధాన్యాయము , 6 3 ఉవ్వలపోటీ , 7 3 మ్రానుగోయిల , 8 3 సరే , 9 3 మానాధీనా మేయసిద్ధి , 10 3 సనాతనము , 11 3 శతపత్రము , 12 3 రంగనాథుడు , 13 3 సర్పయాగము , 14 3 మండలము , 15 3 శోభనము , 16 3 విషయం , 17 3 సంధి , 18 2 యాదృశీ భావనా తాదృశీ సిద్ధిః , 19 2 వరాటకాన్వేషణే ప్రవృత్త శ్చింతామణిం లబ్ధవాన్ , 20 2 మధ్యమమణిన్యాయము , 21 2 మణిమంత్రన్యాయము , 22 2 కేవలై ర్వచనై ర్నిర్ధనాధమర్ణిక ఇవ సాధూన్‌ భ్రామయన్ , 23 2 కాచమణిన్యాయము , 24 2 తటాకపరివాహన్యాయము , 25 2 గడ్డురికాన్యాయము, గడ్డులికాప్రవాహన్యాయము

mai 2015: 1 2 మొంద , 2 2 తక్కోలము , 3 2 లటుడు , 4 2 పహాడ్‌ , 5 2 పావి , 6 2 సమవాయసంబంధన్యాయం , 7 2 పాఠక్రమన్యాయము , 8 2 పతితః పర్వతో లఘుః , 9 2 కారణనాశే కార్యనాశః , 10 2 కార్యేణ కారణసమ్ప్రత్యయః , 11 2 కార్యకారణన్యాయం , 12 2 యుధ్యత్కుక్కుటన్యాయము , 13 2 ఋజుమార్గేణ సిద్ధ్యతి న్యాయం , 14 2 ముండితశిరోనక్షత్రాన్వేషణన్యాయం , 15 2 పరస్పరవిరోధే హి న ప్రకారాన్తరస్థితిః , 16 2 నృపనాపిత(పుత్ర) న్యాయం , 17 2 అపసారితానలభూతలన్యాయం , 18 2 గంధాసక్తషట్పదన్యాయం , 19 2 గణపతిన్యాయము , 20 2 శుష్కస్తనీన్యాయం , 21 2 పథికసర్పమారణన్యాయం , 22 2 నోపకారం వినా ప్రీతిః కథంచిత్‌ కస్యచి ద్భవేత్ , 23 2 ప్రాసాదవాసిన్యాయము , 24 2 ధావద్గండభేరుండన్యాయం , 25 2 అరుంధతీ నక్షత్ర ప్రదర్శనన్యాయం

jun 2015: 1 3 ఆలరకి , 2 3 ముళ్ళమారి , 3 3 లోకేశము , 4 3 వ్యాహారము , 5 3 రాధస్సు , 6 2 పొగరుఁబోతు , 7 2 చిద్రము , 8 2 సహకరించు , 9 2 మున్నీటిపట్టి , 10 2 సగంధ , 11 2 సత్త్రి , 12 2 కార్యకత్తె , 13 2 విధాతృడు , 14 2 స్వరువు , 15 2 నాళీకాకరము , 16 2 మూర్ఖుఁడు , 17 2 స్తిభి , 18 2 జలమయం , 19 2 కోసం , 20 2 కోసరం , 21 2 కోసరము , 22 2 పూర్ణానకము , 23 2 కలఁత , 24 2 అలంకరణము , 25 2 హవణింపు

jul 2015: 1 2 తొత్తుపడుచు , 2 2 రెడ్డిగము , 3 2 సుడిగట్టు , 4 2 లోకాంతాద్రి , 5 2 చూడనిచ్ఛ , 6 2 కొనువాడు , 7 2 బేరగాడు , 8 2 మూడడం , 9 2 గుడిపాత్ర , 10 2 నైపుణ్య , 11 2 ఇంటింటి , 12 2 పురాలు , 13 2 రిక్కదారి , 14 2 సురతాణి , 15 2 ఉపక్షేపము , 16 2 వాసెగ్రోలు , 17 2 చెంత , 18 2 మానవతి , 19 2 మతి , 20 2 అంతర్ధానము , 21 1 boost

ago 2015: 1 2 నెమలియడుగు , 2 2 వృషాకపాయి , 3 1 ప్రకీర్య

set 2015: 1 3 అస్థిమాలి , 2 2 విగర్హణ , 3 2 గుడంబా , 4 2 అజకవము , 5 2 విళంగీలు , 6 2 అధ్యర్బుదము , 7 2 ఆయము , 8 2 అమాంబాపతు , 9 2 మిటారము , 10 2 ఉఱుము , 11 2 ఉప్పతిల్లు , 12 2 చంగము , 13 2 గవి , 14 2 ఒత్తు , 15 2 ఎక్కించు , 16 2 ఈడ , 17 2 ఇంటికాపు , 18 2 ఆయకట్టు , 19 2 అలము , 20 2 గురుకులము , 21 2 అభిషంగము , 22 2 అబ్ధి , 23 2 అదంత్రము , 24 2 అగదము , 25 2 అంశుకము

out 2015: 1 2 భానుజుడు , 2 2 ప్రొద్దుచూలి , 3 2 కలిసిపోవు , 4 2 మమత్వము , 5 2 దేవోత్సవము , 6 2 నాశిల్లు , 7 2 లాంఠిని , 8 2 ఱంకువెలది , 9 2 నరభోజనుడు , 10 1 సమితము

nov 2015: 1 2 గైర్హాజరు , 2 2 మండ్రాటము , 3 2 కుతపుడు , 4 2 విలాసిని , 5 2 దక్షిణగంగ , 6 2 విలాసము , 7 1 ఆరజం

dez 2015: 1 2 సంజ , 2 2 అధ్వాన్నము , 3 2 పెనుగాలి , 4 2 సొంటి , 5 2 మాకు , 6 2 అడ్డదారి , 7 2 గోరు చిక్కుడు , 8 2 మీకు , 9 2 కాపరి , 10 2 మదము , 11 2 మోక్షము , 12 2 వయసు , 13 2 జ్యేష్ఠము , 14 2 సిగ్గు , 15 1 అద్వితీయకము

jan 2016: 1 2 పంబు , 2 2 రేఱేడు , 3 2 తాకులాట , 4 2 నిట్టూర్చు , 5 2 బొంబసు , 6 2 జాంబు , 7 2 మామి , 8 2 మురువు , 9 2 వత్తిఅగు , 10 2 ఏమరిక , 11 2 దాటరి , 12 2 సారంగము , 13 2 వివర్ణుడు , 14 2 వింగడము , 15 2 వటగ , 16 2 పోటరి , 17 2 పదింబదిగ , 18 2 నలువ , 19 2 నోటిమాట , 20 2 మోపు , 21 2 వరద , 22 2 అంగజ , 23 2 ప్లవగము , 24 1 సీలు

fev 2016: 1 2 అజాపుత్త్రనామోత్కీర్తనన్యాయము , 2 2 షండ , 3 2 చింకలిక్క , 4 1 ఆఘూర్ణనము

mar 2016: 1 2 నింకెర , 2 2 ప్రయత్నము , 3 1 బిఱీలున

abr 2016: 1 2 మౌలుడు , 2 2 శిశుమారము , 3 2 బోసి , 4 2 కమురు , 5 2 అతి , 6 1 వ్యతిరిక్త

mai 2016: 1 1 జలంత్రం

jun 2016: 1 2 సైసిక , 2 1 స్తంబకరి

jul 2016: 1 2 gyilefully , 2 2 పాఱ , 3 1 నికరనష్టం

ago 2016: 1 1 పాంశుచామరము

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 18 de setembro 2016 16:50

Dump file tewiktionary-20160901-stub-meta-history.xml.gz (edits only), size 45 Mb as gz -> 406 Mb
Dump processed till Aug 31, 2016, on server stat1002, ready at Wed-07/09/2016-12:02 after 6 min, 37 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.