Estatísticas da Wikcionário tigrinya

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 

  May 2016: Wikistats' days will be over soon. A successor is in the works. 


  Read more at this announcement. Please tell us which reports you want to see preserved, in this survey.

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2016
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 20164   567 3,9 12      3
mai 20164   567 3,9 16      3
abr 20164   567 3,8 6      3
mar 20164   567 3,8 7      3
fev 20164   567 3,8        3
jan 20164   567 3,8 2      3
dez 20154   567 3,8 10      3
nov 20154   567 3,8 8      3
out 20154   567 3,8 13      3
set 20154   567 3,8 6      3
ago 20154   567 3,8 34      3
jul 20154   567 3,7 9      3
jun 20154   566 3,7 6      3
mai 20154   566 3,7 68      3
abr 20154   565 3,6 9      3
mar 20154   565 3,53714112 kb2,4 k1883,3 k 83
fev 20154   565 3,53711111 kb2,4 k1883,2 k 83
jan 20154   561 3,5377110 kb2,4 k1803,2 k 83
dez 20144   561 3,5378110 kb2,4 k1803,1 k 83
nov 20144   561 3,537 109 kb2,4 k1803,1 k 83
out 20144   561 3,5375109 kb2,4 k1803,1 k 83
set 20144   561 3,53711109 kb2,4 k1803,1 k 83
ago 20144   561 3,53717109 kb2,4 k1803,1 k 83
jul 20144   561 3,4377109 kb2,4 k1803,1 k 83
jun 20144   561 3,4371109 kb2,4 k1803,1 k 83
mai 20144   561 3,4371109 kb2,4 k1803,1 k 83
abr 20144   561 3,4372109 kb2,4 k1803,1 k 83
mar 20144   561 3,4371109 kb2,4 k1803,1 k 83
fev 20144   561 3,4371109 kb2,4 k1803,1 k 83
jan 20144   561 3,4375108 kb2,4 k1803,1 k 83
dez 20134   561 3,437226108 kb2,4 k1803,1 k 83
nov 20134   561 3374102 kb2,3 k1802,7 k 83
out 20134   561 337 102 kb2,3 k1802,7 k 83
set 20134   561 337 102 kb2,3 k1802,7 k 83
ago 20134   561 33727102 kb2,3 k1802,7 k 83
jul 20134   561 2,93718101 kb2,3 k1802,6 k 83
jun 20134   561 2,93722101 kb2,3 k1802,6 k 83
mai 20134   561 2,9378101 kb2,3 k1802,6 k 83
abr 20134   561 2,9374100 kb2,3 k1802,6 k 83
mar 20134   561 2,93725100 kb2,3 k1802,6 k 83
fev 20134   561 2,8379100 kb2,3 k1802,5 k 83
jan 20134   561 2,8377100 kb2,3 k1802,5 k 83
dez 20124   561 2,8377100 kb2,3 k1802,5 k 83
nov 20124   561 2,8376100 kb2,3 k1802,5 k 83
out 20124   561 2,8375100 kb2,3 k1802,5 k 83
set 20124   561 2,7376100 kb2,3 k1802,5 k 83
ago 20124   561 2,73713100 kb2,3 k1802,5 k 83
jul 20124   561 2,7373099 kb2,3 k1802,5 k 83
jun 20124   561 2,737599 kb2,3 k1802,5 k 83
mai 20124   561 2,7371199 kb2,3 k1802,4 k 83
abr 20124   561 2,6371499 kb2,3 k1802,4 k 83
mar 20124   561 2,6373199 kb2,3 k1802,4 k 83
fev 20124   561 2,6371098 kb2,3 k1802,4 k 83
jan 20124   561 2,5371498 kb2,3 k1802,4 k 83
dez 20114   561 2,5373898 kb2,3 k1802,4 k 83
nov 20114   561 2,4373298 kb2,3 k1802,3 k 83
out 20114   561 2,4372297 kb2,3 k1802,3 k 83
set 20114   561 2,337396 kb2,3 k1802,3 k 83
ago 20114   561 2,337996 kb2,3 k1802,3 k 83
jul 20114   561 2,337596 kb2,3 k1802,2 k 83
jun 20114   561 2,337796 kb2,3 k1802,2 k 83
mai 20114   559 2,337895 kb2,3 k1762,2 k 83
abr 20114   559 2,3371095 kb2,3 k1762,2 k 83
mar 20114   559 2,3371995 kb2,3 k1762,1 k 83
fev 20114   559 2,237695 kb2,3 k1762,1 k 83
jan 20114 1 559 2,2371594 kb2,3 k1762,1 k 83
dez 20104   556 2,2372193 kb2,3 k1692,0 k 83
nov 20104   553 2,2371092 kb2,3 k1631,9 k 83
out 20104 1 553 2,237992 kb2,3 k1631,9 k 83
set 20104 1 553 2,2372091 kb2,3 k1631,9 k 83
ago 2010412 553 2,1372791 kb2,3 k1631,9 k 83
jul 20103 2 553 2,1374991 kb2,3 k1551,9 k 83
jun 20103 1 549 2373689 kb2,3 k1481,7 k 83
mai 20103 1 541 2374386 kb2,2 k1311,6 k 83
abr 20103 1 534 1,9361782 kb2,2 k961,3 k 83
mar 20103 1 531 1,9361481 kb2,2 k901,3 k 83
fev 20103 1 531 1,9363081 kb2,2 k901,2 k 83
jan 20103 1 528 1,8352479 kb2,1 k811,1 k 83
dez 20093 1 526 1,8352077 kb2,1 k701,0 k 83
nov 20093 1 525 1,7351076 kb2,1 k65964 83
out 20093 1 525 1,7351376 kb2,1 k65957 83
set 20093   525 1,735376 kb2,1 k65944 83
ago 20093 1 525 1,7352676 kb2,1 k65941 83
jul 20093 1 523 1,6353575 kb2,1 k61885 83
jun 20093   513 1,635371 kb2,1 k38589 83
mai 20093 1 513 1,635771 kb2,1 k38586 83
abr 20093 1 513 1,6351270 kb2,1 k38579 83
mar 20093221513 1,63524570 kb2,0 k38580 83
fev 20091   499 1,145162 kb9176100 83
jan 20091   499 1,145162 kb917699 83
dez 20081   499 1,145 62 kb917698 83
nov 20081   499 1,145 62 kb917698 83
out 20081   499 1,145 62 kb917698 83
set 20081   499 1,145 62 kb917698 83
ago 20081   499 1,1451362 kb917698 83
jul 20081   499 1,1472161 kb856655 83
jun 20081   499 1,149 61 kb7966107 82
mai 20081   499 1,149 61 kb7966107 82
abr 20081   499 1,149 61 kb7966107 82
mar 20081   499 1,149 61 kb7966107 82
fev 20081   499 1,149161 kb7966107 82
jan 20081   499 149261 kb7895107 82
dez 20071   499 149 61 kb7844107 82
nov 20071   499 149261 kb7844107 82
out 20071   498 149161 kb7844107 82
set 20071   497 149 61 kb7844107 82
ago 20071   497 149161 kb7844107 82
jul 20071   497515017461 kb7904107 82
jun 20071   32811113633543 kb2444107 81
mai 20071   2 4500 1,8 kb75 107 81
abr 20071   2 4500 1,8 kb75 107 81
mar 20071   2 4500 1,8 kb75 107 81
fev 20071   2 450011,8 kb75 107 81
jan 20071   2 3,5  77      1
dez 20061   2 3,5  77      1
nov 20061   2 3,5  77      1
out 20061   2 3,5  77      1
set 20061   2 3,5  77      1
ago 20061   2 3,5 477      1
jul 20061   1 3 166       
jun 20061   1 2  44       
mai 20061   1 2  44       
abr 20061   1 2  44       
mar 20061   1 2  44       
fev 20061   1 2 144       
jan 200611  1 1 144       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  100  1  3  5  10  1  3  5  10  5  10 
jun 2016    11         11
mai 20161   2      1     
abr 2016           11    
mar 2016    1            
fev 2016                 
jan 2016                 
dez 2015    1      111 11
nov 2015    1  1   2     
out 20151   1      1   21
set 20151      32      11
ago 20151   22     1   11
jul 2015    1  1   1   1 
jun 2015    1          11
mai 2015    11         11
abr 2015    1    2 1   11
mar 2015    11 2 1111  11
fev 201521  1  31  821 11
jan 2015    1  1   11  1 
dez 2014    1  1   1   11
nov 2014       21  2     
out 2014    1      2     
set 2014    11 3   3     
ago 2014    11     31    
jul 2014    1            
jun 2014                 
mai 2014           1     
abr 20141          3     
mar 2014       1   2     
fev 2014       1   3     
jan 2014    1  1   41    
abr 2016           11    
jan 2016                 
out 20151   1      1   21
jul 2015    1  1   1   1 
abr 2015    1    2 1   11
jan 2015    1  1   11  1 
out 2014    1      2     
jul 2014    1            
abr 20141          3     
jan 2014    1  1   41    
out 2013       1   41    
jul 2013    11     1     
abr 2013           1     
jan 2013    1            
out 2012           31  1 
jul 2012    22     3     
abr 2012    2  11  211   
jan 2012    2      2   1 
out 2011    21 1   4     
jul 2011       1   21    
abr 2011    1      211   
jan 2011211         3     
out 2010111         1     
jul 201022211             
abr 20101111    1   31    
jan 20101111    1   1111  
out 20091111        2     
jul 20091111        2   1 
abr 20091111        3111  
jan 2009           111   
out 2008       1   322   
jul 200811  11 2         
abr 2008                 
jan 2008           1     
out 2007           1     
jul 2007           1     
abr 2007                 
jan 2007                 
out 2006           1     
jul 2006           1     
abr 2006                 
jan 20061      2   41    

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
121100.0%578100.0%
3419.0%55295.5%
10314.3%54794.6%
3214.8%50587.4%
10014.8%50587.4%
31614.8%50587.4%

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC1505fev 20, 20092686out 20, 20102079
虎の女の児UC222jul 10, 20102181jun 13, 20111843
PiolinfaxUC320mar 05, 20092673mar 05, 20092673
SpacebirdyUC45jul 21, 20082900jul 29, 20082892
KoavfUC53ago 01, 20063620ago 01, 20063620
බිඟුවාUC63dez 31, 20102007dez 31, 20102007
MalaysiaboyUC73fev 22, 2015493fev 22, 2015493
DanydŵrUC82mai 08, 20102244mai 08, 20102244
NewriteUC92jan 08, 20111999jan 08, 20111999
JAn DudíkUC102fev 18, 2015497fev 18, 2015497
GangleriUC111jan 05, 20063828jan 05, 20063828
Az1568UC121fev 14, 20073423fev 14, 20073423
OcotonigiqUC131nov 23, 20102045nov 23, 20102045
MercyUC141nov 24, 20102044nov 24, 20102044
Piet-cUC151mai 22, 20121499mai 22, 20121499
GhiutunUC161abr 27, 2014794abr 27, 2014794
Syum90UC171ago 28, 2015306ago 28, 2015306
Infinite0694UC181set 05, 2015298set 05, 2015298
Stanko6UC191out 02, 2015271out 02, 2015271
CasetteTapeMasterUC201mai 19, 201641mai 19, 201641

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 627 edições foram feitas por usuários anônimos, de um total de 2207 edições ( 28e %)
  


15 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Luckas-botUC1290mar 27, 20092651jan 27, 2014884--
JAnDbotUC2252mai 23, 20111864jun 23, 20166--
HydrizBotUC3198abr 24, 20121527jun 12, 201617--
KamikazeBotUC489out 18, 20111716mar 07, 20131210--
YS-BotUC537mar 28, 20131189out 04, 2015269--
WikitanvirBotUC631abr 24, 20111893jan 11, 20121631--
AvocatoBotUC723nov 05, 20111698mai 26, 20121495--
VolkovBotUC819jul 29, 20082892mar 21, 20131196--
SpaceBirdyBotUC916jul 21, 20082900jan 20, 20092717--
ArthurBotUC1016nov 20, 20102048mai 30, 20111857--
MjbmrbotUC1113fev 14, 20111962mar 26, 20111922--
RoggBotUC127dez 23, 20102015jan 18, 20111989--
CarsracBotUC136out 21, 20092443mai 19, 20131137--
WarddrBOTUC143jul 29, 20121431jul 31, 20121429--
Makecat-botUC152dez 04, 20121303dez 04, 20121303--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
jun 201657032910 1103 15       
mai 20165703299 1103 15       
abr 20165703289 1103 15       
mar 20165703279 1103 15       
fev 20165703279 1103 15       
jan 20165703279 1103 15       
dez 20155703279 1103 15       
nov 20155703249 1103 15       
out 20155703249 1103 15       
set 20155703249 196 15       
ago 20155703249 196 15       
jul 20155703249 195 15       
jun 20155693239 195 15       
mai 20155693239 195 15       
abr 20155683239 195 15       
mar 20155683229 195 15       
fev 20155683229 195 11      5
jan 20155643169 192 8       
dez 20145643149 192 8       
nov 20145643149 192 8       
out 20145643129 192 8       
set 20145643119 191 8       
ago 20145643079 191 8       
jul 20145643039 191 8       
jun 20145643039 191 8       
mai 20145643039 191 8       
abr 20145643039 191 8      1
mar 20145643019 191 8       
fev 20145642999 191 8       
jan 20145642969 191 8       
dez 20135642929 191 8       
nov 20135642929 191 7       
out 20135642879 191 7       
set 20135642839 191 7       
ago 20135642709 191 7       
jul 20135642679 191 7       
jun 20135642659 191 7       
mai 20135642649 191 7       
abr 20135642639 191 7       
mar 20135642609 191 7       
fev 20135642559 191 7       
jan 20135642509 191 7       
dez 20125642499 191 7       
nov 20125642459 191 7       
out 20125642459 191 7       
set 20125642419 191 7       
ago 20125642379 191 7       
jul 20125642349 191 7       
jun 20125642339 191 7       
mai 20125642259 191 7      1
abr 20125642219 191 7       
mar 20125642159 191 7       
fev 20125642149 191 7       
jan 20125642069 190 7       
dez 20115642039 190 7       
nov 20115642009 190 7       
out 20115641909 189 7       
set 20115641859 189 7       
ago 20115641829 189 7       
jul 20115641789 189 7       
jun 20115641709 189 7      3
mai 20115621679 189 7       
abr 20115621629 189 7       
mar 20115621559 189 7       
fev 20115621559 189 7       
jan 20115621509 189 7      7
dez 20105591479 189 7      7
nov 20105561469 189 7      2
out 20105561429  89 7      9
set 20105561419  89 7      20
ago 20105561369  89 7      27
jul 20105561209  89 7      47
jun 20105521209  89 7      27
mai 20105441089  89 6      21
abr 20105371069  89 6      10
mar 20105341019  89 6      14
fev 2010534979  89 6      23
jan 2010531959  89 6      16
dez 2009529829  89 6      9
nov 2009528819  88 6      9
out 2009528799  88 6      11
set 2009528779  88 6      3
ago 2009528739  88 6      21
jul 2009526739  88 6      15
jun 2009516709  88 6      3
mai 2009516699  87 6      7
abr 2009516689  87 6      10
mar 2009516618  87 6      234
fev 2009502576  80 6      1
jan 2009502516  80 6       
dez 2008502516  80 6       
nov 2008502516  80 6       
out 2008502396  80 6       
set 2008502286  80 6       
ago 2008502286  80 6       
jul 2008502266  80 6      5
jun 2008501266  80 6       
mai 2008501235  80 6       
abr 2008501225  80 6       
mar 2008501225  80 6       
fev 2008501175  80 6       
jan 2008501175  80 6       
dez 2007501165  80 5       
nov 2007501155  80 5       
out 2007500145  80 5       
set 2007499134  80 5       
ago 2007499124  80 5       
jul 2007499104  80 5       
jun 2007329104  80 3       
mai 20073103  79         
abr 20073103  79         
mar 20073103  79         
fev 20073103  78         
jan 2007393  78         
dez 2006393  78         
nov 2006393  78         
out 2006383  78         
set 2006373  78         
ago 2006373  78         
jul 2006173  78         
jun 2006163  78         
mai 2006163  78         
abr 2006163  78         
mar 2006163  78         
fev 2006163  78         
jan 2006163  78         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2006: 1 1 መበገሲ ገጽ

fev 2006: 1 1 መበገሲ ገጽ

ago 2006: 1 1 main Page

fev 2007: 1 1 መበገሲ ገጽ

jul 2008: 1 1 Main Page

fev 2009: 1 1 hello

mar 2009: 1 2 water , 2 2 ውኃ , 3 2 ወፍ , 4 2 bird , 5 2 hurricane , 6 1 mountain

abr 2009: 1 1 hello

mai 2009: 1 1 mountain

jun 2009: 1 1 water

jul 2009: 1 1 one

ago 2009: 1 1 መብላት

set 2009: 1 1 bee

out 2009: 1 1 eat

nov 2009: 1 1 eat

dez 2009: 1 1 silver

jan 2010: 1 1 December

fev 2010: 1 1 March

mar 2010: 1 1 eat

abr 2010: 1 1 April

mai 2010: 1 2 ዐይን , 2 1 hyena

jun 2010: 1 1 ከልብ

jul 2010: 1 2 ጣት , 2 2 finger

ago 2010: 1 1 star

set 2010: 1 1 star

out 2010: 1 1 horse

nov 2010: 1 2 ሃገር

dez 2010: 1 1 እንሰሳ

jan 2011: 1 1 ሐያ

jun 2011: 1 1 ሁለት

mai 2012: 1 1 መበገሲ ገጽ

abr 2014: 1 1 ከልቢ

fev 2015: 1 1 فيبرواري

ago 2015: 1 1 መበገሲ ገጽ

set 2015: 1 1 ብዛዕብኣ

out 2015: 1 1 ኤርትራ

mai 2016: 1 1 መበገሲ ገጽ

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de julho 2016 20:35

Dump file tiwiktionary-20160701-stub-meta-history.xml.gz (edits only), size 221 kb as gz -> 1.6 Mb
Dump processed till Jun 30, 2016, on server stat1002, ready at Sat-09/07/2016-12:34 after 6 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.